2KDNA

Solution structure of pfe0790c, a putative bola-like protein from the protozoan parasite plasmodium falciparum.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEYDKLKSKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PFE0790c
publication title Solution-state NMR structure of the putative morphogene protein BolA (PFE0790c) from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Unknown function
total genus 27
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kdnA00
1V60A 1XS3A 2MMAB 2KZ0A 3TR3A 2KDNA 1NY8A 2NCLA 2DHMA 4PUGA 2MCQA 4PUHA 2MM9A 5LCIA 3O2EA 4PUIA
chains in the Genus database with same CATH superfamily
2CXCA 4LFBC 3KXWA 4MTNA 3UZ0A 1EGAA 4DCSA 3ETCA 2OPLB 3K6RA 5K85A 5ADZA 4RM2A 4DV0C 2PN2A 1ML8A 5IT9D 2ZM6C 4PROC 2DHMA 3EERA 3VNRA 5H9UA 4PUIA 4BC9A 2Y4OA 2P2QA 5BSVA 3EQ6A 5AE2A 1YJ7A 2QVYX 4DR7C 1PU1A 4LF9C 5A1IA 5JRHA 1N34C 3NI2A 5KEIA 2Y27A 3A26A 1N2FA 3GKUA 3I08A 4JI4C 1PG4A 5BSUA 5BSTA 1MXBA 4DV6C 4GS5A 4PUGA 2KZFA 2UXBC 1QM4A 3H2TA 1XMQC 5A2QD 5BUQA 3R9XA 4LF7C 5BURA 3I07A 4JI8C 3DLPX 4JI5C 2PT7G 4JYAC 1P4EC 1XNRC 2KDNA 5BSMA 5CZXA 4LFCC 2UUAC 2JNVA 3FCEA 2NCLA 4AQYC 2D7VA 4X62C 2E7GA 2XR1A 4BBYA 1XS3A 3T1YC 4EATA 3IPLA 1MXAA 2E5LC 1O93A 1N33C 3N2QA 2P2BA 1MXCA 5KYTA 4R0MA 4GXRA 4LF5C 4NXNC 2ONFA 3OTOC 2P20A 4JI2C 1IB8A 1M6XA 1L2FA 2M5HA 2QW0X 4OXIA 2V7BA 5A1GA 1XRAA 3AY0A 2M5OA 3NPDA 2MCQA 1HNZC 1NYEA 2PROA 4KTVA 1FUGA 2CY1A 1GPMA 1MDFA 2AYAA 2WD9A 2QVXX 4D57A 4DCUA 3A25A 2BJOA 4DV5C 2UUCC 2DYJA 4DG8A 5A19A 1N32C 2ATWA 2UXCC 4ZLPA 2P2MA 4NOZA 4B3MC 1FJGC 4PZPA 4U5YD 4JI0C 2KZ0A 2BH1X 3GR0A 2UUBC 4JI3C 1PA4A 2WP0C 4ZJZA 2P2JA 3A9UA 1HNXC 2D1RA 4L4QA 1ULTA 4DR5C 3A9VA 4NDNA 3TDEA 4JI7C 3SO4A 3DAYA 2P02A 1I94C 1T5DX 2OO4A 3UX3A 3TR3A 1USPA 3CQ2A 4RMNA 4GXQA 1P7LA 1RY2A 3E7WA 5LMUC 1LCIA 5T8TA 1KKGA 4KTTA 2YWCA 4YY3C 2UU9C 1T5HX 2D27A 1HNWC 4KHPC 4WV3A 5E7QA 1TH5A 3UOWA 4G37A 1RG9A 3CW9A 1WF3A 4LF6C 2E0GA 4GKJC 4YHHC 3S82A 2D1QA 2ZZMA 1FLOA 3CQ1A 2YWBA 3B7WA 5IWAC 2EGTA 1O9TA 4DUYC 1P4EA 2VQEC 1UWDA 5BSWA 2D1SA 2VZEA 1O92A 4JV5C 1V25A 5LMNC 4LE5A 1XMOC 1NY8A 4X65C 2YCBA 4TPSB 3IMLA 1MDBA 4DR6C 2ASBA 3R44A 3E7XA 1BA3A 4NXMC 2F4VC 4G36A 3RG2A 4K0BA 5GTDA 2YX1A 4DV3C 5T8SA 2E8CA 1USPB 3IEUA 3CQ3A 3J80D 2ZZNA 4ODJA 4DV7C 4JI6C 2UXDC 4DR1C 3L8CA 1ZB9A 3PROC 4ISBA 1J5EC 1MKYA 3J81D 2P2FA 3VNQA 4R1LA 4G1IA 4PHTA 4B3TC 5LCIA 3CJEA 3L95X 4K0KC 3IEVA 1V26A 1XHJA 3AF5A 3LNVA 1VLAA 4IR7A 4I9FA 3UEBA 4L7IA 4IZ6A 3VNSA 4DR3C 3A4IA 4DCVA 5IFIA 3NYQA 1MD9A 4RVOA 4OYCA 4JM1A 4R1MA 2Z51A 5DV9A 5K8FA 3ETOA 3LGXA 1UKKA 2E8EA 1QWIA 2HHHC 4DR2C 4L2ZA 3UX2A 3PESA 4DV4C 4FUTA 1PG3A 1XRCA 3AF6A 5CZVA 1V60A 3DHVA 4RVNA 3PBKA 5BUSA 4LF4C 4RLFA 2OBVA 4DV2C 3JAMD 1LQLA 3TUFA 4DCTA 3RV2A 5AE1A 2QVZX 4LFAC 5BR8C 2VQFC 1IBKC 4PUHA 1AMUA 4RM3A 4BC7A 2QL8A 4B3RC 2VSQA 5KYVA 1IBLC 4X64C 3TQIA 4B3SC 2MMAB 2OPLA 4GKKC 1K0RA 4BCAA 4RLQA 4FTFA 4D4IA 5BSRA 3FCCA 3LNOA 3GPCA 2D1TA 3N54B 1WCJA 4DUZC 4LF8C 3NYRA 4XX2A 3C5EA 4OX9C 1N36C 4D56A 1WH9A 4WS9A 4HPVA 1XRBA 3R9WA 1IBMC 1M6XC 3LAXA 4X66C 1O90A 2Y4NA 4DG9A 3LUSA 4DR4C 4D4GA 5AE3A 3T1HC 1HR0C 1HH2P 4BSZA 5FLXD 2DPLA 2HJGA 3O2EA 2JMPA 1VEHA 4MH4A 3G7SA 3CW8X 4JI1C 3GR1A 2D28C 4DV1C 2CU6A 1JOSA 2MM9A 4FUQA 2E8FA 4I9GA 1ZB8A 1XNQC
chains in the Genus database with same CATH topology
1V60A 1XS3A 2MMAB 2KZ0A 3TR3A 2KDNA 1NY8A 2NCLA 2DHMA 4PUGA 2MCQA 4PUHA 2MM9A 5LCIA 3O2EA 4PUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V60 A;  1XS3 A;  2MMA B;  2KZ0 A;  3TR3 A;  2KDN A;  1NY8 A;  2NCL A;  2DHM A;  4PUG A;  2MCQ A;  4PUH A;  2MM9 A;  5LCI A;  3O2E A;  4PUI A; 
#chains in the Genus database with same CATH topology
 2CXC A;  4LFB C;  3KXW A;  4MTN A;  3UZ0 A;  1EGA A;  4DCS A;  3ETC A;  2OPL B;  3K6R A;  5K85 A;  5ADZ A;  4RM2 A;  4DV0 C;  2PN2 A;  1ML8 A;  5IT9 D;  2ZM6 C;  4PRO C;  2DHM A;  3EER A;  3VNR A;  5H9U A;  4PUI A;  4BC9 A;  2Y4O A;  2P2Q A;  5BSV A;  3EQ6 A;  5AE2 A;  1YJ7 A;  2QVY X;  4DR7 C;  1PU1 A;  4LF9 C;  5A1I A;  5JRH A;  1N34 C;  3NI2 A;  5KEI A;  2Y27 A;  3A26 A;  1N2F A;  3GKU A;  3I08 A;  4JI4 C;  1PG4 A;  5BSU A;  5BST A;  1MXB A;  4DV6 C;  4GS5 A;  4PUG A;  2KZF A;  2UXB C;  1QM4 A;  3H2T A;  1XMQ C;  5A2Q D;  5BUQ A;  3R9X A;  4LF7 C;  5BUR A;  3I07 A;  4JI8 C;  3DLP X;  4JI5 C;  2PT7 G;  4JYA C;  1P4E C;  1XNR C;  2KDN A;  5BSM A;  5CZX A;  4LFC C;  2UUA C;  2JNV A;  3FCE A;  2NCL A;  4AQY C;  2D7V A;  4X62 C;  2E7G A;  2XR1 A;  4BBY A;  1XS3 A;  3T1Y C;  4EAT A;  3IPL A;  1MXA A;  2E5L C;  1O93 A;  1N33 C;  3N2Q A;  2P2B A;  1MXC A;  5KYT A;  4R0M A;  4GXR A;  4LF5 C;  4NXN C;  2ONF A;  3OTO C;  2P20 A;  4JI2 C;  1IB8 A;  1M6X A;  1L2F A;  2M5H A;  2QW0 X;  4OXI A;  2V7B A;  5A1G A;  1XRA A;  3AY0 A;  2M5O A;  3NPD A;  2MCQ A;  1HNZ C;  1NYE A;  2PRO A;  4KTV A;  1FUG A;  2CY1 A;  1GPM A;  1MDF A;  2AYA A;  2WD9 A;  2QVX X;  4D57 A;  4DCU A;  3A25 A;  2BJO A;  4DV5 C;  2UUC C;  2DYJ A;  4DG8 A;  5A19 A;  1N32 C;  2ATW A;  2UXC C;  4ZLP A;  2P2M A;  4NOZ A;  4B3M C;  1FJG C;  4PZP A;  4U5Y D;  4JI0 C;  2KZ0 A;  2BH1 X;  3GR0 A;  2UUB C;  4JI3 C;  1PA4 A;  2WP0 C;  4ZJZ A;  2P2J A;  3A9U A;  1HNX C;  2D1R A;  4L4Q A;  1ULT A;  4DR5 C;  3A9V A;  4NDN A;  3TDE A;  4JI7 C;  3SO4 A;  3DAY A;  2P02 A;  1I94 C;  1T5D X;  2OO4 A;  3UX3 A;  3TR3 A;  1USP A;  3CQ2 A;  4RMN A;  4GXQ A;  1P7L A;  1RY2 A;  3E7W A;  5LMU C;  1LCI A;  5T8T A;  1KKG A;  4KTT A;  2YWC A;  4YY3 C;  2UU9 C;  1T5H X;  2D27 A;  1HNW C;  4KHP C;  4WV3 A;  5E7Q A;  1TH5 A;  3UOW A;  4G37 A;  1RG9 A;  3CW9 A;  1WF3 A;  4LF6 C;  2E0G A;  4GKJ C;  4YHH C;  3S82 A;  2D1Q A;  2ZZM A;  1FLO A;  3CQ1 A;  2YWB A;  3B7W A;  5IWA C;  2EGT A;  1O9T A;  4DUY C;  1P4E A;  2VQE C;  1UWD A;  5BSW A;  2D1S A;  2VZE A;  1O92 A;  4JV5 C;  1V25 A;  5LMN C;  4LE5 A;  1XMO C;  1NY8 A;  4X65 C;  2YCB A;  4TPS B;  3IML A;  1MDB A;  4DR6 C;  2ASB A;  3R44 A;  3E7X A;  1BA3 A;  4NXM C;  2F4V C;  4G36 A;  3RG2 A;  4K0B A;  5GTD A;  2YX1 A;  4DV3 C;  5T8S A;  2E8C A;  1USP B;  3IEU A;  3CQ3 A;  3J80 D;  2ZZN A;  4ODJ A;  4DV7 C;  4JI6 C;  2UXD C;  4DR1 C;  3L8C A;  1ZB9 A;  3PRO C;  4ISB A;  1J5E C;  1MKY A;  3J81 D;  2P2F A;  3VNQ A;  4R1L A;  4G1I A;  4PHT A;  4B3T C;  5LCI A;  3CJE A;  3L95 X;  4K0K C;  3IEV A;  1V26 A;  1XHJ A;  3AF5 A;  3LNV A;  1VLA A;  4IR7 A;  4I9F A;  3UEB A;  4L7I A;  4IZ6 A;  3VNS A;  4DR3 C;  3A4I A;  4DCV A;  5IFI A;  3NYQ A;  1MD9 A;  4RVO A;  4OYC A;  4JM1 A;  4R1M A;  2Z51 A;  5DV9 A;  5K8F A;  3ETO A;  3LGX A;  1UKK A;  2E8E A;  1QWI A;  2HHH C;  4DR2 C;  4L2Z A;  3UX2 A;  3PES A;  4DV4 C;  4FUT A;  1PG3 A;  1XRC A;  3AF6 A;  5CZV A;  1V60 A;  3DHV A;  4RVN A;  3PBK A;  5BUS A;  4LF4 C;  4RLF A;  2OBV A;  4DV2 C;  3JAM D;  1LQL A;  3TUF A;  4DCT A;  3RV2 A;  5AE1 A;  2QVZ X;  4LFA C;  5BR8 C;  2VQF C;  1IBK C;  4PUH A;  1AMU A;  4RM3 A;  4BC7 A;  2QL8 A;  4B3R C;  2VSQ A;  5KYV A;  1IBL C;  4X64 C;  3TQI A;  4B3S C;  2MMA B;  2OPL A;  4GKK C;  1K0R A;  4BCA A;  4RLQ A;  4FTF A;  4D4I A;  5BSR A;  3FCC A;  3LNO A;  3GPC A;  2D1T A;  3N54 B;  1WCJ A;  4DUZ C;  4LF8 C;  3NYR A;  4XX2 A;  3C5E A;  4OX9 C;  1N36 C;  4D56 A;  1WH9 A;  4WS9 A;  4HPV A;  1XRB A;  3R9W A;  1IBM C;  1M6X C;  3LAX A;  4X66 C;  1O90 A;  2Y4N A;  4DG9 A;  3LUS A;  4DR4 C;  4D4G A;  5AE3 A;  3T1H C;  1HR0 C;  1HH2 P;  4BSZ A;  5FLX D;  2DPL A;  2HJG A;  3O2E A;  2JMP A;  1VEH A;  4MH4 A;  3G7S A;  3CW8 X;  4JI1 C;  3GR1 A;  2D28 C;  4DV1 C;  2CU6 A;  1JOS A;  2MM9 A;  4FUQ A;  2E8F A;  4I9G A;  1ZB8 A;  1XNQ C; 
#chains in the Genus database with same CATH homology
 1V60 A;  1XS3 A;  2MMA B;  2KZ0 A;  3TR3 A;  2KDN A;  1NY8 A;  2NCL A;  2DHM A;  4PUG A;  2MCQ A;  4PUH A;  2MM9 A;  5LCI A;  3O2E A;  4PUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...