2KDNA

Solution structure of pfe0790c, a putative bola-like protein from the protozoan parasite plasmodium falciparum.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEYDKLKSKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein PFE0790c
publication title Solution-state NMR structure of the putative morphogene protein BolA (PFE0790c) from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 27
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kdnA00
2KZ0A 4PUHA 2KDNA 1NY8A 2MM9A 3TR3A 4PUGA 5LCIA 1XS3A 2NCLA 2MCQA 2MMAB 3O2EA 4PUIA 1V60A 2DHMA
chains in the Genus database with same CATH superfamily
4G36A 5T8TA 4JI8C 2JNVA 1MDFA 3IPLA 3IEUA 1MD9A 3I08A 5BSVA 1UWDA 1V60A 4DG9A 3T1YC 3H2TA 4D57A 2E8FA 5LCIA 1WCJA 3CW8X 4JI2C 2PROA 5BSMA 2E8EA 2UXCC 4L7IA 4G1IA 4ODJA 2EGTA 3L95X 2WD9A 3E7WA 4OYCA 2D28C 4GKKC 3UX2A 2Y27A 2WP0C 1HNWC 2VSQA 4DCUA 1TH5A 1O9TA 4I9GA 4DV1C 4I9FA 4FUTA 2QVZX 3A26A 3I07A 3N2QA 5IWAC 1M6XC 4ZLPA 4JI4C 4PHTA 3NYRA 4D4IA 4DV4C 5KYTA 1XMOC 4MTNA 3R9WA 5KEIA 4LF8C 3RG2A 1HNXC 2DPLA 3ETOA 4OXIA 3PESA 4GKJC 2D1TA 1ZB9A 3EERA 1ZB8A 1IBLC 1MXBA 2UXDC 2VQFC 4PUHA 3E7XA 4D4GA 1L2FA 3CQ2A 3GR1A 2XR1A 4LFCC 4KHPC 1T5DX 4LE5A 1IBMC 3RV2A 1LCIA 4FUQA 4DR3C 4KTTA 3DHVA 1N36C 3OTOC 1PG4A 5GTDA 1USPB 1BA3A 2M5HA 2QVXX 4D56A 2P2MA 2BH1X 3C5EA 3FCCA 2UUAC 1MXAA 1XRBA 1XMQC 5IT9D 1M6XA 2CU6A 2MCQA 3TUFA 4GXRA 1N34C 4LFAC 4JI1C 2E7GA 1LQLA 5E7QA 2YX1A 4LF9C 3NPDA 3CJEA 1HR0C 2OBVA 4B3RC 3CQ3A 3GPCA 2MM9A 2E5LC 1K0RA 1VEHA 1USPA 2VQEC 3EQ6A 2UXBC 3AF5A 3IEVA 4X64C 4JI6C 5DV9A 1WH9A 3DLPX 5BUQA 3IMLA 4DR1C 4RLQA 1RY2A 1QWIA 4XX2A 4DV7C 2D7VA 3AF6A 3SO4A 4LFBC 5AE2A 2NCLA 1NY8A 1I94C 4RM2A 2HJGA 2D1SA 4NOZA 4JI0C 2D1QA 1FJGC 4DR4C 5ADZA 4PUIA 2ONFA 1ULTA 2KZ0A 4R1MA 2HHHC 1PA4A 3T1HC 3UEBA 3CQ1A 5A19A 4ZJZA 1N32C 2F4VC 1MXCA 4DG8A 4DCSA 4IR7A 5K85A 2E0GA 5JRHA 1IBKC 4G37A 2OO4A 3PBKA 2KZFA 3GKUA 4DR6C 1O93A 4LF5C 3CW9A 4BCAA 1N33C 1FUGA 4BC9A 4ISBA 5BURA 1O90A 4EATA 2V7BA 1J5EC 4OX9C 2ASBA 4L4QA 1YJ7A 4RLFA 2UU9C 2YCBA 3FCEA 3A9UA 4DUZC 4R1LA 3R9XA 1MDBA 5AE1A 2P2JA 3L8CA 3KXWA 4IZ6A 4BC7A 2M5OA 5KYVA 1PG3A 4WV3A 1KKGA 4R0MA 5LMNC 4FTFA 4RVNA 4DCTA 5BSWA 1FLOA 3LAXA 2DHMA 3PROC 4PZPA 2YWBA 2CXCA 4DV3C 3O2EA 1XRAA 2Y4NA 1V25A 3LNOA 4DCVA 4DR2C 3VNRA 3A4IA 3DAYA 1UKKA 2DYJA 4NDNA 4LF7C 4JM1A 3NI2A 5CZVA 1VLAA 2Y4OA 1IB8A 5IFIA 1P7LA 2P2FA 4RMNA 4PUGA 1T5HX 3R44A 5BSRA 5AE3A 3UX3A 5K8FA 3B7WA 4DV5C 4LF4C 4B3MC 3TDEA 2P20A 4JI7C 1P4EC 2Z51A 3J81D 3NYQA 3K6RA 1HH2P 1WF3A 5A1GA 4DUYC 3UOWA 3S82A 4YY3C 2VZEA 1XRCA 2YWCA 4X62C 4TPSB 1XHJA 4JI5C 2E8CA 2OPLB 3J80D 2CY1A 4PROC 1XNRC 3N54B 1AMUA 2PT7G 4LF6C 4X66C 4KTVA 4RVOA 3LGXA 4DV6C 2PN2A 3LUSA 3TR3A 4X65C 2P2QA 5CZXA 1NYEA 5BR8C 5FLXD 4RM3A 5BSUA 5T8SA 2ZM6C 4BSZA 3GR0A 4U5YD 3UZ0A 2UUBC 1PU1A 3A25A 4L2ZA 1P4EA 4JYAC 1V26A 4DV0C 2KDNA 2BJOA 4K0KC 1XS3A 3TQIA 2UUCC 2OPLA 5LMUC 1O92A 3A9VA 3G7SA 4GXQA 1EGAA 5A2QD 4NXNC 2AYAA 4GS5A 2QL8A 2JMPA 1GPMA 4DR5C 1N2FA 4DR7C 4B3TC 2MMAB 2P02A 3ETCA 4NXMC 2D1RA 3JAMD 4B3SC 3VNSA 1QM4A 5H9UA 1XNQC 4HPVA 3VNQA 1JOSA 2ATWA 3LNVA 5BSTA 2QVYX 4JV5C 4BBYA 4DV2C 1RG9A 3AY0A 1ML8A 4K0BA 5BUSA 2ZZMA 4AQYC 4WS9A 1HNZC 2P2BA 4YHHC 2QW0X 4MH4A 2D27A 5A1IA 2ZZNA 4JI3C 1MKYA
chains in the Genus database with same CATH topology
2KZ0A 4PUHA 2KDNA 1NY8A 2MM9A 3TR3A 4PUGA 5LCIA 1XS3A 2NCLA 2MCQA 2MMAB 3O2EA 4PUIA 1V60A 2DHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ0 A;  4PUH A;  2KDN A;  1NY8 A;  2MM9 A;  3TR3 A;  4PUG A;  5LCI A;  1XS3 A;  2NCL A;  2MCQ A;  2MMA B;  3O2E A;  4PUI A;  1V60 A;  2DHM A; 
#chains in the Genus database with same CATH topology
 4G36 A;  5T8T A;  4JI8 C;  2JNV A;  1MDF A;  3IPL A;  3IEU A;  1MD9 A;  3I08 A;  5BSV A;  1UWD A;  1V60 A;  4DG9 A;  3T1Y C;  3H2T A;  4D57 A;  2E8F A;  5LCI A;  1WCJ A;  3CW8 X;  4JI2 C;  2PRO A;  5BSM A;  2E8E A;  2UXC C;  4L7I A;  4G1I A;  4ODJ A;  2EGT A;  3L95 X;  2WD9 A;  3E7W A;  4OYC A;  2D28 C;  4GKK C;  3UX2 A;  2Y27 A;  2WP0 C;  1HNW C;  2VSQ A;  4DCU A;  1TH5 A;  1O9T A;  4I9G A;  4DV1 C;  4I9F A;  4FUT A;  2QVZ X;  3A26 A;  3I07 A;  3N2Q A;  5IWA C;  1M6X C;  4ZLP A;  4JI4 C;  4PHT A;  3NYR A;  4D4I A;  4DV4 C;  5KYT A;  1XMO C;  4MTN A;  3R9W A;  5KEI A;  4LF8 C;  3RG2 A;  1HNX C;  2DPL A;  3ETO A;  4OXI A;  3PES A;  4GKJ C;  2D1T A;  1ZB9 A;  3EER A;  1ZB8 A;  1IBL C;  1MXB A;  2UXD C;  2VQF C;  4PUH A;  3E7X A;  4D4G A;  1L2F A;  3CQ2 A;  3GR1 A;  2XR1 A;  4LFC C;  4KHP C;  1T5D X;  4LE5 A;  1IBM C;  3RV2 A;  1LCI A;  4FUQ A;  4DR3 C;  4KTT A;  3DHV A;  1N36 C;  3OTO C;  1PG4 A;  5GTD A;  1USP B;  1BA3 A;  2M5H A;  2QVX X;  4D56 A;  2P2M A;  2BH1 X;  3C5E A;  3FCC A;  2UUA C;  1MXA A;  1XRB A;  1XMQ C;  5IT9 D;  1M6X A;  2CU6 A;  2MCQ A;  3TUF A;  4GXR A;  1N34 C;  4LFA C;  4JI1 C;  2E7G A;  1LQL A;  5E7Q A;  2YX1 A;  4LF9 C;  3NPD A;  3CJE A;  1HR0 C;  2OBV A;  4B3R C;  3CQ3 A;  3GPC A;  2MM9 A;  2E5L C;  1K0R A;  1VEH A;  1USP A;  2VQE C;  3EQ6 A;  2UXB C;  3AF5 A;  3IEV A;  4X64 C;  4JI6 C;  5DV9 A;  1WH9 A;  3DLP X;  5BUQ A;  3IML A;  4DR1 C;  4RLQ A;  1RY2 A;  1QWI A;  4XX2 A;  4DV7 C;  2D7V A;  3AF6 A;  3SO4 A;  4LFB C;  5AE2 A;  2NCL A;  1NY8 A;  1I94 C;  4RM2 A;  2HJG A;  2D1S A;  4NOZ A;  4JI0 C;  2D1Q A;  1FJG C;  4DR4 C;  5ADZ A;  4PUI A;  2ONF A;  1ULT A;  2KZ0 A;  4R1M A;  2HHH C;  1PA4 A;  3T1H C;  3UEB A;  3CQ1 A;  5A19 A;  4ZJZ A;  1N32 C;  2F4V C;  1MXC A;  4DG8 A;  4DCS A;  4IR7 A;  5K85 A;  2E0G A;  5JRH A;  1IBK C;  4G37 A;  2OO4 A;  3PBK A;  2KZF A;  3GKU A;  4DR6 C;  1O93 A;  4LF5 C;  3CW9 A;  4BCA A;  1N33 C;  1FUG A;  4BC9 A;  4ISB A;  5BUR A;  1O90 A;  4EAT A;  2V7B A;  1J5E C;  4OX9 C;  2ASB A;  4L4Q A;  1YJ7 A;  4RLF A;  2UU9 C;  2YCB A;  3FCE A;  3A9U A;  4DUZ C;  4R1L A;  3R9X A;  1MDB A;  5AE1 A;  2P2J A;  3L8C A;  3KXW A;  4IZ6 A;  4BC7 A;  2M5O A;  5KYV A;  1PG3 A;  4WV3 A;  1KKG A;  4R0M A;  5LMN C;  4FTF A;  4RVN A;  4DCT A;  5BSW A;  1FLO A;  3LAX A;  2DHM A;  3PRO C;  4PZP A;  2YWB A;  2CXC A;  4DV3 C;  3O2E A;  1XRA A;  2Y4N A;  1V25 A;  3LNO A;  4DCV A;  4DR2 C;  3VNR A;  3A4I A;  3DAY A;  1UKK A;  2DYJ A;  4NDN A;  4LF7 C;  4JM1 A;  3NI2 A;  5CZV A;  1VLA A;  2Y4O A;  1IB8 A;  5IFI A;  1P7L A;  2P2F A;  4RMN A;  4PUG A;  1T5H X;  3R44 A;  5BSR A;  5AE3 A;  3UX3 A;  5K8F A;  3B7W A;  4DV5 C;  4LF4 C;  4B3M C;  3TDE A;  2P20 A;  4JI7 C;  1P4E C;  2Z51 A;  3J81 D;  3NYQ A;  3K6R A;  1HH2 P;  1WF3 A;  5A1G A;  4DUY C;  3UOW A;  3S82 A;  4YY3 C;  2VZE A;  1XRC A;  2YWC A;  4X62 C;  4TPS B;  1XHJ A;  4JI5 C;  2E8C A;  2OPL B;  3J80 D;  2CY1 A;  4PRO C;  1XNR C;  3N54 B;  1AMU A;  2PT7 G;  4LF6 C;  4X66 C;  4KTV A;  4RVO A;  3LGX A;  4DV6 C;  2PN2 A;  3LUS A;  3TR3 A;  4X65 C;  2P2Q A;  5CZX A;  1NYE A;  5BR8 C;  5FLX D;  4RM3 A;  5BSU A;  5T8S A;  2ZM6 C;  4BSZ A;  3GR0 A;  4U5Y D;  3UZ0 A;  2UUB C;  1PU1 A;  3A25 A;  4L2Z A;  1P4E A;  4JYA C;  1V26 A;  4DV0 C;  2KDN A;  2BJO A;  4K0K C;  1XS3 A;  3TQI A;  2UUC C;  2OPL A;  5LMU C;  1O92 A;  3A9V A;  3G7S A;  4GXQ A;  1EGA A;  5A2Q D;  4NXN C;  2AYA A;  4GS5 A;  2QL8 A;  2JMP A;  1GPM A;  4DR5 C;  1N2F A;  4DR7 C;  4B3T C;  2MMA B;  2P02 A;  3ETC A;  4NXM C;  2D1R A;  3JAM D;  4B3S C;  3VNS A;  1QM4 A;  5H9U A;  1XNQ C;  4HPV A;  3VNQ A;  1JOS A;  2ATW A;  3LNV A;  5BST A;  2QVY X;  4JV5 C;  4BBY A;  4DV2 C;  1RG9 A;  3AY0 A;  1ML8 A;  4K0B A;  5BUS A;  2ZZM A;  4AQY C;  4WS9 A;  1HNZ C;  2P2B A;  4YHH C;  2QW0 X;  4MH4 A;  2D27 A;  5A1I A;  2ZZN A;  4JI3 C;  1MKY A; 
#chains in the Genus database with same CATH homology
 2KZ0 A;  4PUH A;  2KDN A;  1NY8 A;  2MM9 A;  3TR3 A;  4PUG A;  5LCI A;  1XS3 A;  2NCL A;  2MCQ A;  2MMA B;  3O2E A;  4PUI A;  1V60 A;  2DHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...