2KDNA

Solution structure of pfe0790c, a putative bola-like protein from the protozoan parasite plasmodium falciparum.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQNIHAFSMKCHTPLEYDKLKSKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PFE0790c
publication title Solution-state NMR structure of the putative morphogene protein BolA (PFE0790c) from Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Unknown function
total genus 27
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2kdnA00
2DHMA 4PUIA 1NY8A 2KDNA 2MM9A 1XS3A 5LCIA 3TR3A 2KZ0A 2MCQA 3O2EA 4PUGA 2MMAB 4PUHA 2NCLA 1V60A
chains in the Genus database with same CATH superfamily
2P2JA 1XS3A 1RY2A 4BC9A 2YWCA 5KYTA 2VQEC 5BUSA 4HPVA 4DV3C 3R9WA 1ML8A 5A2QD 3I08A 2OPLB 2QVYX 4BBYA 3UX3A 3IMLA 2HJGA 4BC7A 4G1IA 3R44A 3TQIA 2E7GA 1N32C 2AYAA 4RM3A 1EGAA 3N54B 1VEHA 4FUQA 3B7WA 4DV7C 3TDEA 4L7IA 3DLPX 2ATWA 3J81D 1PG4A 4K0BA 4DV1C 2JMPA 4YY3C 4B3MC 2KDNA 3A9UA 5AE3A 2OO4A 4L2ZA 1XMQC 3VNSA 5IT9D 3CQ1A 1QM4A 2JNVA 3GKUA 1HNZC 5K85A 1K0RA 4XX2A 4DR3C 3EQ6A 3CW9A 4DV5C 4ZLPA 1NY8A 4MH4A 5KYVA 5BSWA 3CQ2A 3CW8X 1NYEA 3RV2A 4JI5C 2QVXX 4DR4C 4OX9C 2KZ0A 3JAMD 4BSZA 2UU9C 4DV4C 3K6RA 1HNXC 3PESA 1N34C 3VNRA 4GXRA 4DV6C 4DR6C 2D1QA 4DV0C 4DR2C 5AE2A 4RM2A 2UUCC 3EERA 3GPCA 3I07A 5K8FA 4LFBC 4R0MA 4NXNC 5JRHA 4X65C 2UXBC 3L8CA 5BSVA 4DG8A 2DPLA 3E7XA 3FCEA 2VQFC 1MD9A 1YJ7A 3TUFA 4X64C 4JI1C 2D1SA 1O9TA 2ZZNA 5BSTA 2DYJA 4I9GA 3A26A 1XNRC 3A9VA 3UOWA 1XRAA 4U5YD 1V25A 5BR8C 3KXWA 5ADZA 3IEVA 2D7VA 1ZB8A 3LAXA 1FJGC 3VNQA 3G7SA 4KTTA 2P20A 4GKJC 4GS5A 2YCBA 4YHHC 3AY0A 1I94C 2P2MA 4DV2C 4JV5C 5A1IA 3OTOC 1MXBA 4D4GA 1XHJA 2BH1X 2E8CA 2KZFA 2M5HA 3NI2A 1IBKC 4BCAA 1T5DX 2Z51A 2VZEA 5T8SA 5BUQA 5A1GA 4ISBA 4JI0C 1IBMC 4R1MA 1RG9A 3IPLA 4MTNA 3E7WA 3A4IA 3UX2A 2ZM6C 2BJOA 2EGTA 4RLQA 4WS9A 1GPMA 1MKYA 3DHVA 2XR1A 4L4QA 1M6XA 2P02A 2ZZMA 1IB8A 4D4IA 5DV9A 2ONFA 4DUYC 3UEBA 3C5EA 4B3SC 1FLOA 1XNQC 1V60A 4LFAC 4JYAC 1M6XC 3L95X 5BSMA 2HHHC 2Y4NA 4JI8C 1O90A 1PA4A 2PN2A 4JI6C 5BURA 4JM1A 1HH2P 1MXCA 1UKKA 1J5EC 4ZJZA 1WH9A 4DCVA 5H9UA 4OXIA 4DG9A 4D56A 5BSUA 3DAYA 2CXCA 2Y4OA 1WCJA 4LE5A 2UUBC 5A19A 1BA3A 5IWAC 1LQLA 2DHMA 1MXAA 5IFIA 4LF4C 4G36A 1P4EA 4JI4C 3NYQA 1HR0C 4LF8C 1XMOC 3LNVA 2UUAC 2VSQA 5T8TA 1KKGA 2P2BA 3AF5A 2QW0X 1N2FA 2CU6A 1L2FA 2MCQA 4PZPA 2YWBA 4FTFA 4PHTA 1PG3A 3N2QA 3LNOA 3T1YC 1UWDA 4AQYC 1WF3A 2YX1A 4NXMC 4OYCA 4LF6C 3AF6A 1PU1A 1MDBA 3R9XA 1T5HX 2D1TA 4PROC 5LMUC 4IZ6A 5LCIA 2QVZX 1MDFA 2WD9A 1USPA 4LF9C 2P2QA 2WP0C 4NOZA 1QWIA 4R1LA 3A25A 5AE1A 2MM9A 5CZVA 4X66C 3GR1A 4KHPC 2E5LC 2P2FA 2NCLA 3UZ0A 4B3RC 4FUTA 4GKKC 2D1RA 2E8FA 4DUZC 2UXCC 5BSRA 1USPB 4IR7A 3TR3A 3GR0A 2QL8A 1AMUA 5E7QA 2MMAB 5CZXA 5FLXD 1ZB9A 4PUIA 1FUGA 3SO4A 4PUGA 4RMNA 3ETCA 4X62C 1XRBA 1P7LA 3PROC 2D27A 4PUHA 4RVOA 4ODJA 3FCCA 3S82A 1IBLC 2V7BA 5KEIA 1N36C 2E0GA 4JI3C 4GXQA 2ASBA 4WV3A 1HNWC 4DR5C 3LUSA 4JI7C 2F4VC 4D57A 1JOSA 3CJEA 3O2EA 4DCSA 1LCIA 4DCTA 3J80D 1ULTA 1O93A 4I9FA 5GTDA 4LF5C 2CY1A 2PROA 3RG2A 4G37A 3NPDA 3ETOA 1V26A 1N33C 4DR1C 1TH5A 4TPSB 3LGXA 2PT7G 4RVNA 1VLAA 1XRCA 2E8EA 3IEUA 3PBKA 4JI2C 2OBVA 2M5OA 3H2TA 4EATA 4LFCC 1P4EC 1O92A 2D28C 5LMNC 4B3TC 2Y27A 3T1HC 4NDNA 3NYRA 2UXDC 4LF7C 4RLFA 4DCUA 4KTVA 2OPLA 4K0KC 3CQ3A 4DR7C
chains in the Genus database with same CATH topology
2DHMA 4PUIA 1NY8A 2KDNA 2MM9A 1XS3A 5LCIA 3TR3A 2KZ0A 2MCQA 3O2EA 4PUGA 2MMAB 4PUHA 2NCLA 1V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHM A;  4PUI A;  1NY8 A;  2KDN A;  2MM9 A;  1XS3 A;  5LCI A;  3TR3 A;  2KZ0 A;  2MCQ A;  3O2E A;  4PUG A;  2MMA B;  4PUH A;  2NCL A;  1V60 A; 
#chains in the Genus database with same CATH topology
 2P2J A;  1XS3 A;  1RY2 A;  4BC9 A;  2YWC A;  5KYT A;  2VQE C;  5BUS A;  4HPV A;  4DV3 C;  3R9W A;  1ML8 A;  5A2Q D;  3I08 A;  2OPL B;  2QVY X;  4BBY A;  3UX3 A;  3IML A;  2HJG A;  4BC7 A;  4G1I A;  3R44 A;  3TQI A;  2E7G A;  1N32 C;  2AYA A;  4RM3 A;  1EGA A;  3N54 B;  1VEH A;  4FUQ A;  3B7W A;  4DV7 C;  3TDE A;  4L7I A;  3DLP X;  2ATW A;  3J81 D;  1PG4 A;  4K0B A;  4DV1 C;  2JMP A;  4YY3 C;  4B3M C;  2KDN A;  3A9U A;  5AE3 A;  2OO4 A;  4L2Z A;  1XMQ C;  3VNS A;  5IT9 D;  3CQ1 A;  1QM4 A;  2JNV A;  3GKU A;  1HNZ C;  5K85 A;  1K0R A;  4XX2 A;  4DR3 C;  3EQ6 A;  3CW9 A;  4DV5 C;  4ZLP A;  1NY8 A;  4MH4 A;  5KYV A;  5BSW A;  3CQ2 A;  3CW8 X;  1NYE A;  3RV2 A;  4JI5 C;  2QVX X;  4DR4 C;  4OX9 C;  2KZ0 A;  3JAM D;  4BSZ A;  2UU9 C;  4DV4 C;  3K6R A;  1HNX C;  3PES A;  1N34 C;  3VNR A;  4GXR A;  4DV6 C;  4DR6 C;  2D1Q A;  4DV0 C;  4DR2 C;  5AE2 A;  4RM2 A;  2UUC C;  3EER A;  3GPC A;  3I07 A;  5K8F A;  4LFB C;  4R0M A;  4NXN C;  5JRH A;  4X65 C;  2UXB C;  3L8C A;  5BSV A;  4DG8 A;  2DPL A;  3E7X A;  3FCE A;  2VQF C;  1MD9 A;  1YJ7 A;  3TUF A;  4X64 C;  4JI1 C;  2D1S A;  1O9T A;  2ZZN A;  5BST A;  2DYJ A;  4I9G A;  3A26 A;  1XNR C;  3A9V A;  3UOW A;  1XRA A;  4U5Y D;  1V25 A;  5BR8 C;  3KXW A;  5ADZ A;  3IEV A;  2D7V A;  1ZB8 A;  3LAX A;  1FJG C;  3VNQ A;  3G7S A;  4KTT A;  2P20 A;  4GKJ C;  4GS5 A;  2YCB A;  4YHH C;  3AY0 A;  1I94 C;  2P2M A;  4DV2 C;  4JV5 C;  5A1I A;  3OTO C;  1MXB A;  4D4G A;  1XHJ A;  2BH1 X;  2E8C A;  2KZF A;  2M5H A;  3NI2 A;  1IBK C;  4BCA A;  1T5D X;  2Z51 A;  2VZE A;  5T8S A;  5BUQ A;  5A1G A;  4ISB A;  4JI0 C;  1IBM C;  4R1M A;  1RG9 A;  3IPL A;  4MTN A;  3E7W A;  3A4I A;  3UX2 A;  2ZM6 C;  2BJO A;  2EGT A;  4RLQ A;  4WS9 A;  1GPM A;  1MKY A;  3DHV A;  2XR1 A;  4L4Q A;  1M6X A;  2P02 A;  2ZZM A;  1IB8 A;  4D4I A;  5DV9 A;  2ONF A;  4DUY C;  3UEB A;  3C5E A;  4B3S C;  1FLO A;  1XNQ C;  1V60 A;  4LFA C;  4JYA C;  1M6X C;  3L95 X;  5BSM A;  2HHH C;  2Y4N A;  4JI8 C;  1O90 A;  1PA4 A;  2PN2 A;  4JI6 C;  5BUR A;  4JM1 A;  1HH2 P;  1MXC A;  1UKK A;  1J5E C;  4ZJZ A;  1WH9 A;  4DCV A;  5H9U A;  4OXI A;  4DG9 A;  4D56 A;  5BSU A;  3DAY A;  2CXC A;  2Y4O A;  1WCJ A;  4LE5 A;  2UUB C;  5A19 A;  1BA3 A;  5IWA C;  1LQL A;  2DHM A;  1MXA A;  5IFI A;  4LF4 C;  4G36 A;  1P4E A;  4JI4 C;  3NYQ A;  1HR0 C;  4LF8 C;  1XMO C;  3LNV A;  2UUA C;  2VSQ A;  5T8T A;  1KKG A;  2P2B A;  3AF5 A;  2QW0 X;  1N2F A;  2CU6 A;  1L2F A;  2MCQ A;  4PZP A;  2YWB A;  4FTF A;  4PHT A;  1PG3 A;  3N2Q A;  3LNO A;  3T1Y C;  1UWD A;  4AQY C;  1WF3 A;  2YX1 A;  4NXM C;  4OYC A;  4LF6 C;  3AF6 A;  1PU1 A;  1MDB A;  3R9X A;  1T5H X;  2D1T A;  4PRO C;  5LMU C;  4IZ6 A;  5LCI A;  2QVZ X;  1MDF A;  2WD9 A;  1USP A;  4LF9 C;  2P2Q A;  2WP0 C;  4NOZ A;  1QWI A;  4R1L A;  3A25 A;  5AE1 A;  2MM9 A;  5CZV A;  4X66 C;  3GR1 A;  4KHP C;  2E5L C;  2P2F A;  2NCL A;  3UZ0 A;  4B3R C;  4FUT A;  4GKK C;  2D1R A;  2E8F A;  4DUZ C;  2UXC C;  5BSR A;  1USP B;  4IR7 A;  3TR3 A;  3GR0 A;  2QL8 A;  1AMU A;  5E7Q A;  2MMA B;  5CZX A;  5FLX D;  1ZB9 A;  4PUI A;  1FUG A;  3SO4 A;  4PUG A;  4RMN A;  3ETC A;  4X62 C;  1XRB A;  1P7L A;  3PRO C;  2D27 A;  4PUH A;  4RVO A;  4ODJ A;  3FCC A;  3S82 A;  1IBL C;  2V7B A;  5KEI A;  1N36 C;  2E0G A;  4JI3 C;  4GXQ A;  2ASB A;  4WV3 A;  1HNW C;  4DR5 C;  3LUS A;  4JI7 C;  2F4V C;  4D57 A;  1JOS A;  3CJE A;  3O2E A;  4DCS A;  1LCI A;  4DCT A;  3J80 D;  1ULT A;  1O93 A;  4I9F A;  5GTD A;  4LF5 C;  2CY1 A;  2PRO A;  3RG2 A;  4G37 A;  3NPD A;  3ETO A;  1V26 A;  1N33 C;  4DR1 C;  1TH5 A;  4TPS B;  3LGX A;  2PT7 G;  4RVN A;  1VLA A;  1XRC A;  2E8E A;  3IEU A;  3PBK A;  4JI2 C;  2OBV A;  2M5O A;  3H2T A;  4EAT A;  4LFC C;  1P4E C;  1O92 A;  2D28 C;  5LMN C;  4B3T C;  2Y27 A;  3T1H C;  4NDN A;  3NYR A;  2UXD C;  4LF7 C;  4RLF A;  4DCU A;  4KTV A;  2OPL A;  4K0K C;  3CQ3 A;  4DR7 C; 
#chains in the Genus database with same CATH homology
 2DHM A;  4PUI A;  1NY8 A;  2KDN A;  2MM9 A;  1XS3 A;  5LCI A;  3TR3 A;  2KZ0 A;  2MCQ A;  3O2E A;  4PUG A;  2MMA B;  4PUH A;  2NCL A;  1V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...