4GXQA

Crystal structure of atp bound rpmatb-bxbclm chimera b1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
505
structure length
476
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAFVVLREFAPSEILAEELAFVDRLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Substrate Specificity of the Rhodopseudomonas palustris Protein Acetyltransferase RpPat: IDENTIFICATION OF A LOOP CRITICAL FOR RECOGNITION BY RpPat.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
molecule keywords Malonyl CoA synthetase, Benzoate-CoA ligase Chimeric protein
total genus 139
structure length 476
sequence length 505
chains with identical sequence B, C
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gxqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gxqA01
3NI2A 3VNSA 3WVNA 4R1LA 4RM3A 3T5AA 5BSWA 3E7WA 2Y27A 3A9VA 5K85A 4W8OA 4D4IA 4ISBA 2VSQA 4OYCA 3IESA 2QW0X 3TSYA 4RM2A 4DG9A 1T5DX 4OXIA 4IR7A 3DHVA 1ULTA 5GTDA 2P2QA 3ITEA 3IPLA 1YJ7A 3NYQA 1MD9A 2QVZX 3DAYA 4EATA 4PZPA 5DWVA 3EQ6A 5BSRA 2QVYX 4RLFA 3QYAA 1BA3A 1LCIA 2D1SA 4D4GA 5KYVA 2P2FA 3IVRA 4DG8A 4GR5A 5D6NA 3B7WA 5BUSA 3FCEA 3WV5A 3DLPX 2QVXX 5BSMA 1AMUA 4M46A 1V26A 3GPCA 3O83A 4GS5A 4LGCA 5BUQA 5JRHA 3VNQA 1PG4A 4FUTA 5BSUA 1T5HX 5KEIA 2D1QA 3U17A 4GXRA 2P2BA 5BURA 4U5YD 5E7QA 3G7SA 4RVOA 3T5BA 2P2JA 3PBKA 4GR4A 3NYRA 3A9UA 1PG3A 2P20A 2WD9A 4G36A 5BSTA 3U16A 3CW8X 5DV9A 1RY2A 3IEPA 4WV3A 4RLQA 2D1TA 4D57A 3VNRA 5K8FA 4G37A 4E5DA 3L8CA 4D4HA 2VZEA 1MDFA 3C5EA 4FUQA 2Y4NA 2D1RA 3O84A 2P2MA 4GXQA 3T5CA 5KYTA 2Y4OA 4D56A 3WV4A 3E53A 2V7BA 3FCCA 5BSVA 3ETCA 3LGXA 5IFIA 3IERA 3CW9A 3RG2A 3LNVA 3RIXA 4ZJZA 4R1MA 3E7XA 3R44A 3LAXA 3O82A 1V25A 4R0MA 4RMNA 1MDBA 3KXWA 4RVNA 4IZ6A
chains in the Genus database with same CATH superfamily
5TEVA 3WTCA 3GUHA 3NBZC 4JI3C 3QKRB 1Z25A 5AMXA 2FLWA 1OHHA 2E89A 3OLZA 5IAGA 4I4LA 1U98A 1NAIA 7ABPA 3FZNA 4PG8A 4YLEA 4TL6A 3N2GA 1VE6A 1RKUA 4H2DA 3I6QA 4BECA 2EF1A 2AN3A 3ZWQA 1K5GA 2DULA 5CVEA 3COZA 2HO4A 2GPSA 3CEJA 5FA5A 4BBAA 3V7NA 4NICA 1OA0A 1J1ZA 2H48A 5G2OA 1NU6A 5AHOA 3DDZX 3AF6A 1EQAA 2CU6A 3HKEB 1GO2A 3LCRA 3SS9X 3F5MA 4WAUA 3GKUA 1O89A 1E2JA 2W48A 3FYUA 3R75A 3FWPA 5A1TA 5KKCA 2J4FA 4P80A 3RFVA 3ZV4A 1II8B 2G0AA 3UH0A 3GCZA 1Q0QA 2RJNA 3KUUA 4LRXA 2ZIFA 1P7YA 3TVYA 1VL1A 4DT1B 2D62A 1TW3A 5FWXA 2OZLB 4BRWA 3GVIA 1N5KA 2E4UA 2Y0DA 2O3RA 4V0NA 4LYGA 4ZYZA 3HYCA 5L9AA 2IHVA 1CW2B 5BVHA 3G8AA 4PRYA 2FQQA 4C4YA 1X7XA 1RJFA 3JVVA 3QITA 3VTZA 2FQYA 1I7QB 2HDNB 4IEIA 5I01A 5L4SA 1V1MB 1Y4ZA 2EARA 5ADZA 5DEIA 3RROA 4A6PA 3F49S 3FPHA 1ODCA 4XWGA 1UKAA 2V65A 4O4JB 3LBIA 4FN5A 1OF1A 1HM5A 3CF2A 1YKGA 5ER9A 1MQSA 1FXUA 3IYLW 3BJZA 2RGEA 4XX1A 3O03A 1R74A 5JTTA 1HPLA 1IZZA 5LQDA 4YBZA 2XR1A 1LJ8A 1EGVB 1MXHA 4BAUA 4M54A 4Y9RA 1JZSA 1M66A 2JLBA 4FINA 1FF9A 3Q6MA 2VTBB 3E0QA 4JV5C 1GZUA 4GSKA 4LZOA 2FZ4A 5CB6A 1ZAYA 1CJTC 2NV0A 3FKQA 5HE8A 3PEUA 4XCQA 1RYEA 1KAHA 2WUDA 1NRJB 1V1MA 5FPYA 4X24A 1BXZA 5KHLB 3R8CA 3UUFA 2PKRA 4YUVA 5K8LA 1GYRA 2IK8A 3T1VA 4E94A 4EW1A 2AXQA 2UUPA 4JBXA 4MR7B 4Q3CA 2AIRA 4QUBA 9LDBA 5L51A 1ZD3A 4O4LF 1E8DA 3ZLBA 1PZHA 4FJ1A 1KY4A 2HU5A 4MRPA 2ZJ0A 2NVWA 4JVOA 5D3ZA 2AYZA 5AE3A 2I2XB 2O50A 4ZQBA 2XUKA 2JLRA 4OSEA 3D6TB 5BN4A 2DE0X 3MD0A 4IMJB 1JEQA 2PK3A 3ZDRA 1GU7A 1HZZA 4MPTA 2DR2A 3A8TA 3KQMA 3G5MA 1E7SA 3EF1A 3OZFA 3TB4A 2AOUB 5ALZA 2OV2A 4GQBA 3S2UA 3EIOA 4EJSB 2SECE 1CJMA 2XBMA 4BQNA 4HEHA 4IIJB 1B3RA 5DK6A 1H8HD 3N8NA 4LK2A 4P2BA 4E6EA 5A2QA 1YRBA 3CLSC 1GDHA 2DUUA 2Q4BA 2QYTA 3TG2A 1NNUA 1T6XA 2XRMA 4I8XA 3ZYCA 2KSQA 3LT4A 1DBQA 3E0XA 5B1IA 3EGEA 2Y1OA 3G13A 1PR5A 1SD1A 3I72A 4M36A 4KQWA 3DMNA 1U3TA 1EB8A 5ESRA 1W5EA 2GEJA 5K0TA 5DE3A 3UT0A 3BSYA 2Z56A 1E77A 1E3DA 4XLZA 3RVOA 5CBPA 4IAOA 1VMEA 5IAKA 1T8PA 1DAFA 2AFIB 2GPYA 3CLVA 2BFCA 3QI2A 1ZCFA 4W8OA 2VT2A 3JARA 5IEJA 4P35A 2P67A 3TX6A 4NABA 4YC7A 3K4PA 2F3SA 3PU6A 3UG6A 5FIUA 3QELB 1HO3A 1QWOA 3IO5A 3LBNA 5GJCA 4OQPA 1QV7A 2WPDA 3S8MA 4QBIA 2JIDA 1QB8A 3NKFA 3U3KA 4RMGA 4G07A 1Z4IA 3DOOA 4L6AA 4M87A 4MS3B 4MA0A 3SHFA 1N7HA 5JSHA 2BCEA 3FCOA 4IRXA 1CDDA 4GLOA 1GZSA 3B6MA 1NJ1A 4QQ8A 5KQPA 1U8FO 2H6EA 4R2LA 3M9LA 4OP3A 3N54B 1EVQA 2B7BA 2OBYA 3CNEA 4B4KA 1AHPA 3WO1A 1V9SA 2IYSA 4ZQIA 3IUPA 5D6NA 5HS4A 4M1YA 2F55A 1HFWA 4RADA 3TRIA 5THKA 3AUFA 3WA6A 1KQ3A 1L9KA 5GM1A 4B3RB 4DGQA 4JQSA 4YONB 5A1IA 2AHRA 3H2IA 1OA1A 2FA9A 2HBZA 2ZI9A 2ZJ2A 1TM4E 3IP9A 3R41A 4DA6A 7ADHA 1KYVA 1XAHA 2I3GA 3AEUB 1KXZA 2JCBA 5EJ9A 5KEIA 1Y42X 5AM5A 3P9QA 5PNTA 5CVTA 4PLFA 4IJQA 1DEXA 4ASUD 1ZNQO 3ORFA 1G6KA 3RAGA 1L7RA 1Q3KA 3MOGA 4UVGA 1R6UA 2GK7A 2PVPA 3T3EA 1KP3A 3DM9B 4DV7B 1EG7A 3LO5A 2NPIA 1VGQA 2ZI5A 1XCMA 2Z9CA 4GLLA 2AFHA 4IHKA 2XE8A 3LHDA 4RH0A 3A3NA 5J2TB 5CFPA 2JBAA 5AKHA 3L40A 5FTNA 3WYBA 2Z51A 1W5SA 3F46A 3KVNA 3JQCA 5DNCA 1FUGA 4EPRA 5BSTA 4BB6A 1QM5A 5KQLA 3GCXA 5AK6A 4XAQA 5ALJA 3V9PA 4F7WA 4JI4B 1DAPA 1VG1A 2BEKA 5DIFA 3RUHA 2WTXA 3B3AA 3ESDA 3ZLUA 3PHBE 4JI8C 2YZ7A 3RYFB 4BX8A 2V4ZA 4PW0A 5REQB 3DZFA 3RE1A 3H4TA 3KEQA 5REQA 5FTWA 3QEMB 3L7DA 4A8TA 1I6KA 2C4UA 2C3YA 1G8HA 3W2TA 2GN4A 2GN1A 4FFSA 1QH1B 2C9BA 1H5UA 1Z5UA 3K8YA 3NHBA 2HRBA 4J6EA 4OGFA 1E2NA 4FJ0A 1YZQA 4GPIB 4TV8B 1P4AA 5FAKA 3W5DA 2J3EA 1RABA 2VYFA 5I47A 4I50F 3THYA 3S3TA 1ISRA 1YGPA 2FUG6 4BVLA 1V35A 1OB5A 2AQHA 2Z8XA 3EASA 3ECCA 1HYBA 1LI5A 3OIDA 4M60A 3BRWD 3LUCA 4PHHA 2GMWA 3H5NA 1IHXA 4KQ6A 2VP5A 1LNSA 5IHPA 5KKNB 1ZC3A 4P86A 1FL9A 3DFZA 5GM2A 3BFKA 4RXMA 3NWJA 4YAJA 1SBQA 2JGFA 1O97C 4E11A 4FDVA 5KYXA 3W1VA 1QLHA 2NNLD 5DN6D 4F46A 1KKUA 3D8NA 5ALNA 4DIOA 5CXUA 1WUYA 4F6RA 4LFCC 5KZMB 3O7MA 3MGBA 5A2QD 1VJDA 1VXOA 2C78A 3W7VA 4BC7A 1EFPB 1F8FA 1UM9A 2K2WA 2WNSA 1ZI6A 1ZRMA 2PS3A 3H2ZA 2IYUA 3VISA 4JC0A 4XD7D 3VOAA 4ZJYA 1C7IA 1GTG1 4LJKA 3TBHA 2HUNA 2UZ1B 1CP3A 3ENNA 4Q9HA 3FJOA 3UT6A 3V8PA 2Q62A 4DDVA 3MRVA 1P60A 2EHDA 1A88A 3CY6A 4YP6A 3AR3A 4EDFA 2E8EA 2QQ0A 4NBSA 3VMMA 4A6DA 3CRMA 4OXIA 1D2MA 2NZUG 4KXYA 3HJRA 1U2GA 2DY1A 5T4EA 2GBFA 3VVLA 3JALA 4PG6A 4UPVA 3A25A 4NZOA 4PZ0A 4NLLA 1F2UB 4DLXA 4Q93A 1CFJA 2O06A 4CMIA 4JV5B 2KZ0A 4ON9A 3V3TA 4IDBA 2TSYB 2YIVX 2HN9A 5DZSA 3JAKA 4OBBA 4JY7A 3FLEA 3N70A 2PVCA 2Q41A 5HJ7A 1GQQA 3L0DA 4P33A 4RYDA 4PPYA 2X1VA 4EUHA 3FOFC 4H7JA 1PJQA 2FR8C 4RKQA 4RD3A 2V1XA 3DOJA 1P1BA 4MI1A 4A27A 5CEEA 2Q1SA 5J2UF 5EIHA 1RVV1 3S99A 2H2DA 5IM4A 1CYEA 3TE6A 3LQ1A 1V71A 1JZTA 1CZKA 1QF7A 3BL6A 4K5QA 2ZZKA 2EX1A 3ZV7A 4BZPA 3SC3A 5JZSA 3HP4A 4FWTA 3F4KA 1HZZC 1ECGA 1XEFA 1OBHA 3HA3A 3IGFA 4MWEA 3GRVA 1M1YE 4Q9JA 2Y77A 4EHHA 2VYND 4RGBA 4MV6A 3ZW8A 2XA9A 4NPAA 1LLUA 2V6GA 4C3ZA 4IJWA 4R40A 1NF3A 1U0SY 3H5WA 3PL1A 4OQMA 4XYBA 3WLHA 3PP8A 1E3TA 5TX7A 5TF4A 4JBIA 4RMHA 4B7AA 2W4IA 1OZAA 1E1CB 3EGCA 3KKPA 2W22A 1GGHA 1ODTC 2GSWA 4LDAA 1R6BX 5KHAA 4CM1A 4JA0A 2VH5R 2QUIA 3KV3O 3NRBA 3ICQB 3RC3A 3QU4A 4ER7A 5GMOA 3SR4A 2HHCA 4WBNA 1ODKA 1Z29A 4JLDA 1P91A 1WM1A 3A4TA 3H84A 2X9LA 3LQRA 4PLZA 5DYYA 4CM8A 2QJOA 3C98A 3GG9A 4WX2B 2RC5A 3BQNB 2HHJA 3COWA 3HS3A 4MEAA 4BRUA 1LVGA 5KC9A 3AVQA 4WW0A 1FY2A 1J8VA 5ALLA 1ZM9A 4CKBA 4RMIA 2GAOA 1OWPA 1PBNA 4UCXA 1K0UA 3TWOA 1MKYA 2GK4A 1P2BA 3BICA 3CGWA 2VDOB 4G0VA 3E3AA 3QPAA 4L4ZA 5F9HA 1YTUA 4YCNA 2IEGA 4DNPA 1J9ZA 1IHDA 4OHBA 4NF2A 3WJ2A 4ECAA 3OC6A 1X2EA 3JVDA 2IPLA 3K32A 5ADUS 3WV4A 1T2FA 4PO8A 2X5KO 5HK9A 1V5GA 3QHQA 3E3NA 1OU4A 1JAYA 2DFNA 2UV8A 3IAEA 3E4CA 4ZYXA 1BDIA 3VDXA 1AZWA 4N9WA 3U0VA 4DF3A 3GZNB 1F38A 1YQEA 2CJXA 2IIQA 3PZBA 4KQFA 3WKBA 5B7PA 3TGPA 5CIYA 5K6RA 2AS0A 2YFYA 4V2IA 4GLJA 4NSNA 1UUFA 3RSCA 3KQUA 1WKBA 4XD7A 4UXJA 2NUPB 2MINB 5ELMA 3USZA 3W2FA 4FMCB 5G3YA 3DEZA 4YVFA 4PYOA 2XAAA 4UUBA 3T41A 2CK3A 1XRRA 2XDWA 5ITZA 1UBKS 1F20A 3BWVA 4HVCA 1H9BA 5LQSA 4H7KA 3HXTA 1UJBA 2Y8EA 3ELWA 2IU6A 2PRSA 4CEJB 3BK1A 1J5EC 4ATNA 2AE2A 1A76A 1L8QA 1C1HA 3MAGA 2Z2IA 3AWDA 3VR6D 4M49A 4RK4A 1PIWA 5GGYA 3M2TA 4DG9A 3R6WA 3MCWA 3ZWNA 3DKRA 4XGKA 1XJQA 2XTZA 2YH2A 4FZRA 4Y2RA 1MP0A 3C0KA 4KAXA 2WD8A 2NUPA 5JSFA 4V24A 5DWVA 1NXSA 5BSRA 4LFBB 1VSTA 3UJ9A 1CDZA 4CVNA 1QG6A 2DAPA 3IO3A 5ECYA 5KX5F 3MLEA 1LUAA 2GZSA 4M7PA 2FFRA 4ZMBA 4I66A 2HLDA 3OMXA 5B58T 1O9BA 4K6KA 2WIAA 1OI3A 4JP3A 3SEZA 4YUAA 4JB8A 2GZ1A 1L1RA 1LV8A 2ISCA 3U40A 4R41A 5BWBA 1EZ1A 4UM9D 2PWZA 3O83A 2E6UX 3SCZA 5FR1A 3UXHA 5G1OA 3EQ9A 3V7YA 3A4IA 3G2KA 3WWDA 3ZLVA 5C1PA 5CCDA 1IEVA 2GQ0A 3HY4A 1PVOA 4BMCA 1ZUNA 1UAAA 1BVRA 2XCIA 3FNRA 4PYRA 2VP4A 3UOGA 3E3LA 4X3OA 1S01A 4BJ6A 3V8BA 2Y1GA 1T4MA 2RGNC 4XGIA 2J5XA 1I0ZA 2WK1A 3CUWA 5KDLA 3RTGA 4EVSA 4B3CA 3HBNA 3AESB 2W8BB 4RENA 2FN8A 3PX3A 3LXUX 1LSOA 4PNEA 1Z88A 5D86A 2FMUA 3NOXA 3OEYA 4X7PA 4ZO7A 3UV6A 3Q3IA 4TROA 1NW5A 1PFQA 1QCDA 2C03A 2H18A 2YHIB 4JIMA 3NHZA 4K46A 4LMBA 4LTNA 4V02A 8AT1A 1SVLA 1B0UA 1OYOA 2I03A 3H5IA 3ISVA 3TN7A 1W88A 2D7DA 5EQDA 1LBQA 3HPQA 2DPYA 3T7KA 3GOHA 3ZGLA 2F4VC 2B8EA 3KOOA 1H2BA 1KJIA 2Q2VA 1XA0A 2WJVA 4RZXA 2JG3A 1ZFNA 4WFQA 5ERYA 5CEJA 2I4OA 1BXRB 3L8ZA 4DKXA 4P3NA 4Q16A 4B4VA 3HXKA 4WLEA 3SJUA 4PNHA 3V6MA 1ZBDA 4OYHA 3T1NA 3T4XA 2XIQA 1NLUA 1NKTA 4FOTA 1SHUX 2VDQB 4ARUA 2ZRKA 3EHEA 2C1EA 4OMUA 3WG9A 1SELA 1XRBA 2CC2A 1E66A 3ETJA 3KB1A 2JFOA 3RABA 4C6TA 3PQ3A 1N2JA 4FE3A 3S2EA 5AM2A 5ECWA 4M9QA 5K05A 5HE9A 1QGDA 4COOA 4MSUA 4NK5A 2ZZMA 2I55A 2C2XA 1LZKA 1XN4A 1WUJS 2HRZA 1RC8A 2GS9A 1S8OA 5EQTA 3CBQA 1QQ7A 5DOVA 3H2GA 3TZQA 1SN7A 1DHRA 2WE7A 10MHA 3RVPA 3QF7A 1Q0LA 3AY7A 1XZDA 4PIVA 4DM7A 4IDEA 3GMIA 1M34B 5GZ6A 4RKRA 1NYQA 5AHKA 2AX4A 3KOWA 3ICWA 5I6DA 3B5JA 2OVBA 2X0IA 2JHCA 2P9TA 3TRFA 3VNSA 4CM3A 2JGEA 2PUAA 3ANTA 1ZN9A 2DHRA 4UZEA 4BNZA 3V4SA 1F2TA 4W6ZA 2YZ2A 4MRVA 2XTNA 1T5SA 2UVDA 1T1RA 1SURA 1RZVA 1PWHA 3OT4A 4AQDA 5K6TA 4YUYA 1TZ2A 1JQLB 2Q27A 3B6EA 3B48A 3GGCA 3MM4A 1OAOA 2IWHA 1ZLXA 4G65A 3UJNA 1V7QA 1XRLA 4WZBB 3R3HA 2PX4A 3O2SB 3LUKA 1C8LA 3O4JA 3FVVA 2P2QA 5E38A 1P31A 2J6HA 4U2FA 1V16A 1QRTA 1YFKA 1KHTA 1EJ2A 5IS2A 1HEIA 4GDMA 3HJFA 1XLTC 4IS2A 1J5EB 3GX1A 1O6FA 3WZ2A 2WSYB 4IFBA 2CHGA 4DNQA 2GLUA 2NO9A 3V6LA 1H0RA 1SBNE 4IWYA 1BXRA 2E4AA 2D1SA 4W1QA 1WBBA 3UMBA 3UJ6A 1N4DA 2O7SA 3OKFA 4D46A 2X86A 4OO3A 3KQLA 3MK31 1GSIA 1UWDA 4UATA 2NUBA 4LDZA 2J6BA 2BP7B 3WHPA 2W4MA 4F9FA 3QFCA 3CJTA 1JAXA 2VEDA 3OOEA 3GR0A 9ABPA 5KU7A 3AM1A 8ATCA 1H85A 1E69A 5F76A 4W5QA 4E3ZA 3ILSA 1G8JA 1PWYE 2XYQA 3JQ7B 1UJCA 5H83A 4I5GA 4OAOA 4PHCA 3ZOZA 2YOGA 2HNAA 1I1NA 3SIWA 4NMXB 3LBAA 5CT8A 4X65B 2J59A 1W1IA 1Y1LA 1TJ4A 2FPWA 1VZ2A 2LTAA 1N2CB 4J8PA 5CM9C 5F7ZA 5EUCA 4MH0R 1YZLA 2H4YA 4YRLA 3CZPA 4TN5A 2FHSA 3ZDEA 4JP8A 1Z6AA 3H8SA 4I19A 3JRXA 4MGEA 5LZ5A 4NHEA 4DAOA 4J0FA 1V60A 3I04A 4KYUA 4DR1B 1H5QA 3IP5A 2P1RA 1Z2CA 2DWQA 4TWAA 5HQJA 4K28A 1CUYA 2ID8A 4ZYTA 3C74A 2B2NA 4TYPA 3ZU3A 1U3GA 2DHQA 5JAOA 2HA4A 3N74A 2HGSA 1GNRA 1I9CA 1N6IA 1PNOA 3O4IA 1UPAA 3PCRB 3HHPA 3NJRA 4D3ZA 3VO2A 4LMPA 5IDQA 3N0XA 4UJ5A 2QTHA 1G5RA 1UM8A 1IN4A 2QTTA 4P84A 3ZHXA 5COQA 2OZVA 1QIJA 1TM3E 3DOUA 3ZKAA 2JF0A 3HZRA 2B6NA 3BTSA 3CSDA 1Z06A 1WLYA 1XL0A 5CA0A 3ZK9A 4QSMA 1SC3A 1OBVA 2CMGA 4NI5A 5EE5B 3P2YA 5IUKC 1US8B 5DMXA 5DSXA 1MQAA 2VNIA 4MCAA 1YQWA 3ILHA 3O31A 4RACA 3B7PA 1E2PA 1FJ2A 1M6NA 5IT4A 1DBVO 4CG0A 1MRSA 2FZCA 1E7QA 1MW9X 2FFJA 4RZIA 5BR4A 3KNZA 3R5FA 1K97A 4QKQA 3DNMA 2E5WA 4LRUA 1QLWA 2R62A 3HNOA 2AJDA 4Q21A 5AKJA 3KYCB 1ADYA 3PYXA 5E6SB 5A9TA 9ATCA 2FZEA 3KUCA 2VQEC 1E96A 2R00C 5CFZA 3OG9A 3K35A 2Z2KA 4HYTA 5JHHB 2D13A 5KYNA 2I6UA 4QHYA 2GBIA 3WMXA 1JMVA 4TVOA 3RT7A 2Y66A 2FZLA 3W4IA 1I3MA 2VJMB 5IMBA 1QFJA 2O07A 2Z5GA 2ZBEA 5KNDH 5KNBD 4JI1C 2VHVA 4M2LA 3GFBA 2JJ1D 4MWTA 1XUOA 3UBMA 3DHWC 1IBLC 2VVTA 1VCHA 3A3OA 3LYHA 1Z9BA 1T9AA 4XYEA 4HC4A 3R7WB 3QTBA 1HDGO 1LQTA 1L5WA 1GPDG 2QPTA 3L06A 4BWVA 4F9TA 1EHCA 4IO1A 4MQ5A 3CLTC 1Q1AA 3UWDA 2JMPA 2HWUA 3T7TA 4D26A 2F1IA 1SWWA 2E55A 2P2NA 3VU8A 4ERNA 5FTLA 1JDSA 5KI6A 3GMTA 5CDHA 5HS6A 3EXG2 1XZ8A 4HDSA 2FPMA 4RA6A 3NGXA 1Q0ZA 4AZ0A 2A8YA 3D7NA 4JCOA 3O3CA 2QVBA 5JISA 2X0NA 3TBFA 4MVYA 3GNSA 4EB6B 1GPKA 1JAIA 3S0JA 2FSPA 4PCLA 4GKVA 3IVXA 4RHYA 4A2PA 4EJ0A 3D0KA 2J0EA 1GKKA 1ZCZA 1DKOA 3A9WA 3A31A 3CNLA 1PTJA 1KBZA 4WOCA 1HOXA 1YBVA 3HA2A 4K8RB 5IX8A 5LOVB 3K16A 2YCBA 2BZGA 4XJTA 1SUEA 1OXXK 2X8AA 4EL0A 2C8JA 2WF5A 3A6FA 3S40A 3M3HA 1EX1A 1GKYA 4YY3B 1C7FA 2GTHA 1Z2AA 4N5IX 4CETA 4EO4A 4ZTBA 4LRWA 1ONPA 4WBNB 2ZJ5A 8OHMA 3BWCA 2WWVD 3WQHA 5I45A 5JRHA 1ZGAA 2OAGA 2O23A 2ZJ1A 3L8FA 5JMPA 1RC1A 4TUYB 3FI9A 4UKDA 1HTTA 2P8SA 3UJPA 2QUKA 1UPUA 4LISA 1JJBA 3ZJ5A 2F8MA 4AJKA 1NVVQ 1J07A 2FPGA 3OM1A 2F62A 1QP0A 2UXCB 1ORWA 2VK2A 1CSEE 3KJNA 3T3HA 1PG3A 2RBGA 3Q0TA 4HNQA 4NBNA 3WDKA 1CS0B 5IASA 1N1EA 2C8LA 4GHWA 5JAZA 1W4AA 2E1RA 1QO9A 3V34A 4MUGA 4J1QA 1UANA 3TUZC 2HHLA 4YFYA 2YW2A 3AKCA 2QL9A 4UEWA 3WFIA 4B5KA 4JEUA 1GCOA 3TQRA 2J5RA 3BSWA 1U0JA 1HY3A 2EKPA 2ILTA 1GKUB 4XZ3A 2C5HA 1Y4SA 4QBKA 2C0CA 4ZQCB 4KR6A 4ESEA 4JD5A 5MHTA 4O4JA 4YUWA 4Y0VA 3TQCA 1E6LA 2EYQA 4MYSA 2OQVA 3GGJA 2FV8A 1XROA 4M76B 4QEZA 2VK1A 3MTJA 3E9QA 1HT0A 5FJJA 4PLTA 3WKEA 4L4QA 1NXVA 4KQXA 4D3DA 3NBFA 1QE5A 5JECA 1F14A 4IICA 1VM6A 2A9FA 4RBNA 1PA4A 2WSIA 1BS2A 2V7BA 4RXTA 1Y4DE 2IE0A 4H35A 1FSSA 1I94B 3EGDB 5C4MA 2AFHE 3QLEA 1C0PA 2ZXEA 3PIIA 4ZDKA 1GTRA 3U1BA 3ZLJA 2ZBGA 2YFKA 2XUZA 1JEDA 1LI7A 2ST1A 4P9NA 4R9SA 1ZK1A 1WCJA 3ZC3A 5JALA 2WMDA 4QYWA 5EIBD 3ZU6A 5M04A 2OLEA 2PLAA 2QLFA 3G23A 1ZM2A 3H2SA 2BFDB 2CXOA 2RGYA 4B46A 1E0AA 2P8JA 4YRBA 1XF9A 3W6OA 4RK7A 1QGOA 3TUJC 4X64B 1E1CA 3HKEA 3NHSA 4ITVA 1IDOA 3SJ7A 4DM4A 3AEXA 4X71A 2M2IA 4TMFA 1T4BA 1CZUA 1RQNA 4WLUA 3ENWA 3RAJA 1Q74A 1G6OA 1UBGA 3K0FA 3QRWA 5C7YA 4HUTA 1PQPA 1ULSA 2BFEB 2H51A 2XT6A 4JGBA 1EK0A 3WGTA 3TOCA 4DL9A 3ICEA 1XZPA 1EFLA 3M49A 4DADA 4E2ZA 2ZP1A 3I8SA 3CU5A 4GKBA 4F4CA 1GITA 5E1MA 4KJXA 5AKEA 1NI5A 3AHHA 2FJPA 3C39A 2AOTB 4N8SA 5EWLA 4MB2A 3KQSA 1YKFA 3OE1A 3VKWA 2BFWA 3LRPA 2OM6A 4BQPA 4L22A 5C32A 1NW4A 1VLHA 2ZIWB 5HKAA 1VRCA 3C3KA 2HLPA 3FFAA 4IDDA 4FTWA 3HTXA 2QPAA 2YXDA 2XI4A 2SKCA 3CF4G 3GEGA 4KDEA 4OHMA 4R8LA 1AXGA 2XWBF 1YZYA 2ZQYA 1XP5A 2JW5A 2V0NA 4DJEC 1MG0A 1CRPA 3PV0A 1RWKA 1NVGA 3G68A 5IK2D 1RI2A 1SVKA 2PX2A 3J7AC 1Y3AA 3EZGA 4I81A 4O29A 4WUVA 1KOFA 2Q5JA 3ETHA 1O77A 4HDRA 4QTUB 4DBVO 3OIYA 1V3UA 4EY5A 2QD1A 5CFMA 1U28A 3U7FB 2O8BA 1G19A 2QR3A 1E61A 4PZYA 1RPTA 4H6VA 2R8YA 1JHMA 4XVCA 1ODSA 1P2GA 3QX8A 3TZEA 3ZJUA 2H2IA 4GBED 3MBIA 3WK5A 2OB2A 1IEWA 3T35A 4HFJA 4WINA 1D0SA 1WDWB 2X2OA 3FROA 1TT5A 1X1AA 3REOA 1YCDA 1E4EA 3AU9A 3GZTB 3EW9A 1V1JA 3LHIA 2G07A 3TAUA 4CDMA 1N32B 4RSHA 2Z6UA 3BEOA 4ZU1X 4J76A 3OQIB 4X45A 1NN0A 5DLDA 1GZ5A 4ZI7B 1Q7RA 2Q45A 1FRFS 2VYNA 5K0SA 4KL8S 1BIFA 1P1HA 1QGUA 1WQ1R 4YT2A 5T8KC 1KEZA 1ODLA 3VDNB 4DMKA 2A0YA 5GV7A 5KNCH 2OBXA 1XC7A 4IZIA 4Q24A 1OW3B 3D4PA 1Y63A 3IP3A 3IJ5A 4YTEA 2C58A 3ONWA 2WYOA 2NXEA 5A3QA 1FLNA 2DUJA 1M8PA 4GP7A 1MUUA 1O6BA 3TLEA 4XLLA 1QF9A 5AKZA 1DVRA 3JQ6A 1CY1A 2UXCC 2IT1A 2VTKA 3CH4B 2I6GA 2HMVA 1XZKA 2Q3DA 2QXUA 1RDFA 2FOLA 3JZAA 4RGQA 3UMCA 4D4LA 4EYSA 2Z6AA 3NXKA 3NR2A 2VYVD 3IHTA 2QAIA 1JLHA 4YXFA 4P2GA 1ZJ6A 1JKFA 1R50A 1S7CA 5HJEA 3M9XA 2VG8A 2AWNA 4MS3A 4ZV7A 1BCRA 3PXUA 3IIEA 3KWFA 2EXXA 2IUSA 4ZHSA 4MUYA 4DCUA 4NQZA 4ZC1A 1DAKA 4M99A 3L0SA 2N1MA 2DXIA 3HR4A 3BCUA 3J81A 3WKCA 1O08A 4AYTA 4YT5A 2C9CA 3VYSB 4D9JA 4EF6A 1U8AA 3ZZTA 1BROA 1W9MA 1GV1A 1P9RA 1V4VA 1E3JA 2B4YA 1D5CA 2GWHA 1ZIDA 2R5FA 3EVBA 4BNDA 4OQLA 3BB1A 1H5NA 1NVMB 3Q3EA 2JLUA 2PL5A 5FL7D 3JWGA 1EFUA 4CCAA 3LKDA 2FE1A 2ZBFA 2AK3A 1RM3A 2GO1A 2X22A 4FC7A 4LHVA 3UH1A 4HDQB 3C8MA 2QKYA 4H1UA 2XOKD 1JDPA 3KT8A 4KDRA 4RETA 4TV9B 2X0EA 4CLXA 1SHTX 3K72B 5CFRA 2GB4A 4LSWA 3RWOA 1CEXA 1DAIA 3L8GA 4ZALA 5GOTA 1J20A 2VBIA 3DL4A 4IJ6A 3L79A 5LYYA 3RYIA 3HXMA 1VPVA 4CGZA 1UT6A 1Y7TA 3DXXA 2F9LA 2H52A 1KS9A 1HLDA 3SYLA 5IF3A 2BTQB 4YCDA 2HF2A 2C95A 4BZZA 5BW5A 4N47A 4B6FA 5CNMA 5DLPA 4EZEA 2XXAA 3EZLA 4Y7CA 4ICIA 2PT9A 4YUZA 3QOWA 3GGOA 3COSA 4RNCA 1KKMA 2OCPA 3W5JA 3K09A 5AVRA 1V41E 1JLKA 1N2FA 3GA7A 4OHWA 2I6QA 4JYCA 1Z7GA 2TMYA 1FS5A 2RAVA 3KQHA 4XRRA 5IUNC 5D5PA 1WQ3A 3P9XA 4YAWA 1EA5A 4YWHA 2O59A 3E61A 3SHWA 1M7HA 2RHHA 1YR6A 3ABRB 4IEEA 4ID3A 3SXUB 4P53A 2Z08A 1MNQA 1Z8DA 4WDRA 3JYHA 1TMYA 3PROC 4FJ2A 4L73A 4PEVA 4WJZA 5TS3A 2COUA 1QC5B 3BMOA 4JB2A 1U8TA 4EG6A 1MFZA 4JBNA 2I6TA 3I12A 3QJYA 2VUUA 3S81A 4ACBA 3E2IA 1SZCA 1MENA 1PEAA 1X1DA 2A0FA 1BXGA 2F00A 2H7CA 4ER3A 2AB0A 2WT9A 4WT7A 2EJBA 4EB0A 4KRXA 1J4AA 4F12A 2LCFA 2VDLB 4O3FA 5CAEB 4POOA 2PD3A 3I2YX 2HWWA 1V3QE 3DV0A 4QEKA 1E4OA 2J5KA 1G5FA 3FOZA 4OP1A 3WSVA 1TAUA 1KQGA 5CVDA 4FMCF 1KMHB 4Q0MA 4I50A 4AKSA 3WYFA 4WQMA 3GRAA 3TTWA 2GK3A 4FXOA 3E5RA 5IYZA 1XZGA 2VJKA 2GHIA 4EF5A 2NZ8A 3CLUC 4F3KA 2VRWA 1X7XB 3H1FA 1B43A 4MV5A 3REFA 3TZ6A 3A6JA 2B2CA 2FQ1A 2ESRA 1WOYA 1N32C 5IJ9A 3MWFA 3ZNNA 3D8BA 4KE6A 1SBYA 1EVYA 1KJWA 3BD6A 4ABTA 3AUSA 4MH4A 3MXOA 1ORHA 2COKA 2XVZA 3G82C 4KNWA 4UFOA 4DT1A 1XMOB 3Q6IA 4XX0B 1PW5A 2Y4NA 4KSBA 3T0IA 1S3SA 4KMMA 2QU8A 1PWXA 2GYUA 2ZT7A 3C5CA 2PCLA 3ETGA 1BHJA 4LQLA 3STUA 4DIKA 1AD2A 1XOIA 1ZD4A 1AQYA 1BCSB 2FZWA 2ZAYA 3I8OA 4URYR 1Q50A 2CBZA 2EG9A 2PO5A 3D7RA 1B23P 2ZSEA 2XCOA 4U7FA 1DKRA 3HLKA 3V4OA 5FCDA 1MAVA 1E5VA 2ZAGA 5WRFA 4O0LA 5IJ9B 5IT0A 3LDGA 4FX2A 5BR8C 1ENOA 3C5VA 4M6WB 4EEZA 5JI3E 5P8WA 3SQXA 3P9PA 1DBIA 3M34A 4Y1RB 1CT9A 3U44B 3DDSA 4A6XA 1IDN1 5KQSA 1SCDA 1JBQA 3DBLA 5SY9A 3TW8B 1U8CB 2ZYIA 1CEQA 1DAEA 4J9VA 2CJFA 2P65A 5TNXA 3PX7A 2BMDA 4E03A 4KLRA 3P5BA 1GXSA 1RAGA 2Y9MB 4B6RA 2L19A 4GMKA 3PQ7A 2X8BA 5KWIA 4OATA 2YN0A 1K9SA 4D97A 2A1UB 4HAXA 1JR4A 1NXQA 2XUQA 3EBPA 1Z33A 3HU2A 3FBGA 3II6X 2QRLA 3JXEA 1ZI8A 1FMCA 2ZKIA 1VHTA 2ZITA 3B89A 3CEAA 3DJYA 3MQFA 2MYPA 3H3JA 4DPKA 5BMVA 5KBYA 3LCJA 2AN1A 3ZU4A 3EXAA 2IPOA 1CC1S 1UBCA 2FDRA 4NMWA 1CQJA 2GYVA 2J6CA 3I5XA 4LF7C 2QE7D 1D9XA 3VNBA 2VDWA 1TA0A 3HRHA 3V33A 4A10A 2C92A 1O5TA 2ATVA 1IQUA 1L0BA 2GD6A 4QUKA 1YQQA 3K9LA 5EMHA 1MGOA 1VL5A 1THGA 1HE2A 3PC8A 2OXIA 3T9BA 4ZYYA 1BA3A 3TBKA 1SHKA 5B4UA 2EP8A 1BYIA 1GVNB 1WXXA 1WXIA 2EBUA 2H7XA 1NYTA 1RU3A 1LF5A 2OC9A 3K0CC 5TDHA 3U4MA 5FEMA 3UAVA 1KI1A 2ORWA 4KQHA 4O2BB 1OFIA 3AY3A 2VEOA 3LI2A 4EJMA 2PSDA 4QU5A 1ZRHA 1V26A 4MW1A 5IT9A 1J22A 1WVGA 3LPLA 1OCEA 3GLVA 2YDYA 3I9V6 2WP8J 4HNGA 4HRVA 2PA3A 4I5FA 3VSEA 4B82A 4DAEA 2RGGA 4N7BA 5AHRA 3QVGB 3O90A 2ECKA 4CLOA 3W3AA 3CRW1 4G2TA 4OXNA 4BQIA 2IY9A 4H27A 3V55A 1TZJA 4MKIA 1BQ3A 2JASA 2Q5CA 2XF8A 2JK1A 1EG2A 5AVQA 3F5SA 5LB4A 3THOA 1GIAA 2J7KA 2V6IA 4XH9B 4QLOA 5BNZA 1SQ0A 1DADA 2BH9A 3HJNA 1XD2B 4NE7A 5DPMA 3A2KA 1OBFO 2HBQA 2YYYA 4NPCA 2BBSA 1PFVA 3ZYZA 4B4UA 4DXAA 2VSOA 3A04A 3ESYA 2GJ4A 5K8VA 4HS4A 4QELA 4JBYA 1IVNA 2C2KA 1NBOA 4U3JB 2WJWA 2KI5A 2X8JA 3NTQA 3M82A 1Q0TA 2YIJA 4D8XA 2NTVA 2A1TR 1FNCA 1EQUA 1N7GA 1P7ZA 2J5BA 2JC3A 2QR5A 4LKRA 3DLIA 4NENA 5U9CA 1R15A 1AHHA 2CXPA 3LX6A 5AVKA 4RY0A 2BPOA 3PKJA 4S3MA 3SM9A 3URMA 1GPWB 2O8VA 2FW6A 3JQAD 4PZ9A 4GOXA 4UUAA 5F9MA 5AIAA 3S28A 5K8UA 4AYWA 2G17A 3IAHA 1EFPA 2VJCA 1XLVA 2PX8A 3HFSA 5CH5A 4BFSA 4CMBA 4KTVA 3AJDA 2Q5FA 3I1YA 4I8DA 5TQ0A 1E7WA 1QH8B 3NM6B 3L8DA 5HF6A 5TT1A 3HYSA 2AMYA 2QTAA 4ZCQA 1GG9A 1Y1KE 4Q1AA 4PQYA 3JYQA 3JQAA 1T5TA 4G01B 4MW0A 1G5IA 3KAQA 5CB8A 3A3KA 4Q3EA 3H9GA 1UKZA 1VKNA 4YXWA 3QENA 5IARA 2HFKA 2O54A 1W30A 2D2VA 2RSLA 1R66A 3KALA 2QAGB 5LQKA 3HNRA 1GYPA 2GUWA 4DR1C 1N5RA 2VNKA 4G5OA 1IK4A 2PS0A 3KVRA 4HAZA 1ADGA 1T6BY 4YCAA 4G0NA 3SBEA 2ZDQA 4CTMA 5BNWA 2CLFB 1Y5IA 5IYZF 2B6HA 4TN1A 1X8LA 5IRCD 1CUFA 1D1SA 3ANLA 2PTGA 2XTJA 3B1KA 4WLFA 1ILEA 1FXWF 1V3TA 1P1IA 1XKLA 3B53X 4RVSA 5DHFA 1I1HA 3U31A 2A5GA 2K6GA 4NAUA 5EWMA 2QV7A 3I2KA 4KXFB 3RG8A 2LE0A 2WJZB 1NJ8A 2VDVE 4M1KA 3SZMA 1ZM4A 2HRQA 1H4TA 4J49A 3UG7A 1DKPA 4JMLA 2ZWMA 3H5VA 4PPFA 3GLQA 1OV6A 4Y8VA 1G9TA 1E3SA 1I6MA 1ZP6A 4IHJA 2FOIA 5D87A 3G0OA 4RLHA 3EK2A 5FWDA 5AOCA 1OFTA 2B8WA 3IBGA 1QIFA 4AURA 3Q8KA 2UUCC 2IDMA 2J9YB 3SVTA 4Q4HA 1MJGA 3B8HA 3U3DA 4F5ZA 4LF8B 3U3XA 2YV4A 3K92A 2QK4A 3MCZA 1EU1A 2I29A 3DG9A 3T7JA 1P75A 1K89A 1C8BA 1N9GA 2JKZA 4K9DA 1TUEA 4YAOA 4FIDA 1P6XA 1UOOA 3QJGA 5FUVA 1LPSA 1XMOC 4MR9B 1IZ0A 1H22A 5JBQA 3O73A 4EGCB 1QYDA 3DONA 4HNAB 2C4WA 1C2YA 1OAAA 2G1KA 4KO8A 3G9XA 4N41A 4CUKA 3EQZA 4QXOA 2ZWAA 1U90A 2VSFA 4EY8A 3RK1A 4IDPA 4P4SA 3FF4A 1V95A 1ZL2A 2RI1A 4TXLA 3SY8A 1AA6A 1I4EB 4Y67A 5CTAA 2CSUA 3O75A 4J0IA 5A5DA 3CNQS 4ZQGA 3D54D 1SQFA 3H11B 3IIKA 2AR9A 1TUGA 1GTZA 3GD5A 1DC4A 1RZRD 3P0EA 3AO0B 2JLCA 4NNOA 1CK4A 1NFRA 4ENRA 2P2JA 3JRNA 1YL6A 4Z3OA 3MTAA 2G4CA 3GAMA 1UK8A 1E9CA 3EVFA 4G41A 4PR0A 4B6GA 1MBZA 3VZBA 4BO0A 2ID4A 1HL7A 3NC0C 5FHQA 1E9VA 3RIEA 1XPOA 1GA6A 4O4JF 5KAPA 1L5MA 4I5IA 4WGFA 4NECA 4KIFA 1UAYA 4RDHA 4IUBS 1K08A 1O0BA 2YJ4A 2GEUA 3FLBA 3L92A 4LMAA 5TEWA 3R3VA 3H5OA 5B64A 3I2IA 4Q7JB 3PNYA 2FG6C 3BK2A 4P3OA 4V2UA 4ZI7F 3DBRB 4D4HA 3LM8A 3PUHA 5C1DA 2CL5A 2ZB3A 1Q0HA 1SC1A 1WZUA 1ZA1A 4AN4A 4PN3A 1FPQA 4KXVA 4MV0A 4LQ4A 5EEGA 1G66A 3VR4D 1PSZA 1K3UB 3KTAB 4W1SA 5AD1A 5TXGA 5JCXA 3FYTA 5L6MB 1CLUA 2OYCA 2BBWA 4RTNA 3HO1A 2BEVA 3TLMA 2PJUA 5L4NA 2BONA 4O4IF 3D3WB 3I1FA 2IP2A 3I5UA 3EA4A 4JQCA 3GFSA 3TI7A 2HA3A 1PTJC 2JJ8A 1AKUA 1WMAA 2IYEA 1PG5A 5M2QA 4M0KA 5AQ1A 4ZGWA 4HN2A 5DK4A 1PI3A 1WA5A 1JTVA 1XR3A 3R0IA 3W8NA 3ZJ4A 5KNBH 1BFDA 3IB3A 3T1YC 2QTVB 1TLLA 3V7FA 4MAMA 1KDRA 2OHJA 1KKGA 4Q9NA 3NMUF 2IZZA 4IXNA 5F5NA 1YVUA 3G79A 5LKRA 4FWBA 4Y2UA 5AM0A 1IBRA 4LDQA 5B4TA 1BOFA 3A06A 3ZI7A 2GJ9A 2HSEA 2IPNA 1RAHA 4KV9A 4S1PA 3AEKB 4JXJA 2BEJA 4TRJA 4JUFA 4KWTA 1Z37A 4LE1A 4R16A 5T3YA 3PFBA 2FPPA 2CBXA 4NIMA 5LA6B 1M34E 1RLUA 3LPCA 4BCCA 2P9EA 3PENA 3WLKX 1UZMA 2PCJA 3FUVA 2JD0A 1LBIA 1VOTA 1QVRA 4H15A 5EGNA 3FA2A 2JJ2A 2JGDA 4LXTA 3A6KA 4LG1A 1ZHOA 3V8QA 2FR0A 3AQIA 4AD8A 1XJCA 3RTBA 1JFVA 1QFYA 1Y6ZA 3KTOA 3PUZA 4ZARA 3ZCRA 4R54A 4JN6B 1V6AA 1STOA 3HNPA 5JC1A 3AVUA 2CCJA 1WU8A 3HWSA 3FBTA 4B6QA 1LC0A 2R8OA 1IOLA 1TQ4A 1KGSA 1OD6A 3SZOA 3DHEA 3PFGA 2AG6A 3N8KA 3MAJA 2CNOA 5HRAA 1MTOA 16PKA 5G1NA 3JATB 1XB2A 2VNJA 3MXTA 2BTEA 4IFTA 3O2NA 5HGJA 5IVDA 4CF7A 2XOKA 3MS2A 4YGXB 5CZXA 3LQ4A 4G8JA 2FMIA 3TMAA 5A4KA 3DFKA 3IUJA 3DZDA 1Q2UA 3H9UA 2AG8A 2AHOA 4MV1A 5AK3A 4J1TA 4JJ7A 4IWNA 1DELA 2C8VA 4XUCA 4Z4HA 1VJRA 1F5NA 2W98A 2WVHA 3C6QA 4KXLA 3THXB 3C1UA 3DCJA 3O1JC 2I2BA 1E3QA 3L1KA 4C2BA 2H2AA 2Q6IA 5E3HA 5ILOA 3L1JA 3AL0C 5A0VA 1CWUA 1DEKA 1PT5A 1RPAA 5E7QA 2Y1XA 2B3DA 2Z04A 3LIIA 4M9CA 4MUHA 5T4FA 3VX3A 4BC1A 3PC3A 2JFXA 3D5TA 1YFZA 1UZAA 2GD1O 2ZUWA 3QF4A 4LPSA 4ACAA 5A6SA 2AUMA 4OQ4A 1AKNA 1X7WB 2XA2A 3A7EA 4JJ4A 1RI4A 1F8XA 2EV9A 2QRZA 5D5HA 2M98A 3WQSB 5IEBA 3AJ9A 4JI7B 3OP1A 1EK6A 2PBZA 1QV6A 3MOIA 3HYLA 4PICA 1TVCA 3W90A 1KEEA 5FULA 2EJWA 1NDUA 5DH9A 5DTRA 1Y6FA 2BRUC 5CA1B 3PFWO 1U1GA 4QIHA 1YU9A 3O1HB 4FVTA 3A0RB 2VF5X 2NUTA 1E9RA 5JBIA 1GN9A 1DIRA 4M9SA 5EI5A 5EWJA 3TQQA 4JCCA 3ADPA 1X92A 3EYAA 4MAAA 5FWYB 3P9SA 3K9HA 1PBTA 5K3FB 1US8A 4ZODA 4P38A 3W05A 1PLJA 3WY9A 5JCOC 4LYDA 5ALEA 4P7KA 2D8AA 3USCS 1WB9A 3G8YA 5BV7A 3HN2A 2PO7A 2DWUA 2XYPA 4FGZA 4J03A 4EBBA 2OV6A 2WWRA 2HSDA 4XWKA 1N9GB 1AUXA 2BH2A 2VFAA 4R9UC 1FE8A 3FVWA 1MOZA 1TVKB 3SKXA 1TRHA 3O6VA 1XNQB 3OPMA 2VF4X 3IAAA 4HQFA 5CVUA 1NX9A 2AF4C 1W6RA 3I9MA 2HADA 1COWA 4HNHA 1YE5A 3ORSA 1Y8QB 1PQUA 2ZUSA 5FWAA 2YFQA 2ACVA 4JSYA 1CF2O 4A16A 1JMYA 1LRKA 3BREA 3BN3A 4U7HA 4EOGA 2A2ZA 1ZRSA 2R6AA 5FDFA 3IPAA 1ZVJA 1SCBA 2FPIA 3NOVA 2R85A 3F98A 3LAWA 2OCBA 2OFPA 2EWMA 3A2MA 4BX0A 1E9SA 4L07A 5KHOC 4DR6C 5E9WA 3K6RA 1P62B 3A9VA 4MGKR 13PKA 3TJMA 4YFVA 4ISBA 1E9AA 1S96A 1DCKA 5EN4A 1LS6A 3WK6A 1J2TA 1VE3A 5ANRB 2B20A 5F3WB 1JHQA 4RW0A 4OXRA 2YJ5A 2ZJ8A 3OFNA 4M0FA 3JW8A 4A4DA 4N82A 1DDGA 5A06A 4HWRA 1QOZA 1ZMXA 5B7QA 3Q9LA 2GYYA 3OE7D 1NUTA 4I9FA 1GGFA 1SVIA 4IMRA 5JJBA 4AUKA 2R68A 4YRPA 4LFAB 1SC6A 3QQPA 1NQXA 2WHPA 5F2OA 3WSTA 4GKJC 1ECJA 2CLCX 2VZ8A 2XVAA 4KEAA 5C8VA 2PL1A 1L4FA 1JWAB 2FZKA 5DSZA 3ZH9B 4N9QA 2WPDD 4B0OA 5BYKA 4GOMD 3T4EA 4BLOA 4KQMA 5IT5A 3RUCA 5TGZA 4B5LA 3JQ9A 2EIXA 4DQLA 1JQKA 4EHAA 2R86A 1NW3A 3IR6A 1GL3A 5DNAA 3UIEA 2RHOA 4QFCA 4ZQFA 4YYZA 1D2GA 4WOPA 2EFJA 5C4IA 5G0TA 1YA8A 1DCTA 3DKIA 2H1WA 3Q7IA 5KNDA 4A2CA 3CZQA 5KWVA 1YFLA 3FNBA 3HXOA 1JS1X 1G4UR 4PZZA 1EE2A 1EVIA 1EUDA 1F6BA 1FFAA 2BEWA 2NTYC 1J7KA 2WUFA 2PXHA 1EGAA 1OROA 1MX3A 1CIPA 2QT9A 3BSFA 2IX9A 4KXXA 2BIFA 3K70C 1AZLA 1TIKA 4RYLA 2PUFA 2C4NA 1I7LA 1WW2A 2P78A 2I7XA 3BE4A 1TKRA 4L5CA 4H4DA 4YJHA 3ZWMA 3OF3A 3IBYA 3WQRA 2IV2X 1UKBA 4E5VA 5BN5A 4JC8A 2FN3A 4BMXA 3VO8A 4L9AA 1YZNA 2ZSBA 1JVNA 1JJIA 2PD4A 4FKMA 1NT2A 2ECFA 4GSLA 4YREA 2CZQA 1DMRA 2FX2A 4HTFA 2ZSKA 5CX1B 1C4KA 3V7UA 3EY9A 1VI6A 2IHUA 3N3AC 5EKTA 1RBZA 2QD4A 4JP2A 1JJVA 4ZTUB 3EDQA 1XE3A 1HGXA 3GLSA 3UEBA 1FYFA 4PC7A 1G7CA 5TMEA 3GEDA 3RYTC 3UJ7A 2NU6B 5HTOA 1GY8A 2Q2OA 3Q9NA 5GY7A 4C4TA 1VKOA 2CZGA 4QNNA 3ZZ0A 4FEYA 1JEYB 3A2NA 2ONFA 4NY1A 4UU7A 3TRKA 3UKDA 3Q7TA 5C5DA 2IV7A 2O0HA 5K0LA 1I2DA 3DDHA 3VKUA 3LF2A 5JNVA 1BHSA 4UNNA 4XEHA 3I62A 1CJSA 3A05A 2DB3A 1QU2A 1JHVA 2BCJQ 3LQQA 5K4GA 2HV9A 1TL7C 2MSLA 3MUOA 3GQBB 2OL4A 3WGYA 4CYMA 1RFLA 3U4CA 3LNVA 1TYEB 4C20A 3B6JA 3U37A 3GUUA 4HDMB 4M1SA 3HB5X 3KWMA 3ENQA 1QYXA 3LUBA 3B8EA 1FIUA 4Z6KA 1UJ5A 2AG1A 5FLYA 5A0TA 2EHJA 3NQ41 4A0RA 3ZHSA 4NMHA 4PNZA 2FPIB 1UFVA 4P36A 1JIJA 1V5WA 4W1PA 1QH0A 4NJMB 1IVYA 3MS7A 1XAJA 2RHCA 4PF1A 1ZW6A 2OAQ1 2Y05A 3KOUA 5DT9A 3H75A 1P5FA 5A4FS 2VRBA 2ZRPA 3IEVA 3PTLA 3RUEA 4ND8B 2VJQA 3VHRA 1E1LA 2BE9A 5AP9A 5A3SA 4YMHA 1YASA 5KWJA 3IUEA 4GU5A 4BE7B 4DMGA 2B30A 5LP6B 4KFCA 4B09A 3DZ8A 2WM3A 4LYFA 1ZOSA 1PZEA 1XALA 1MA0A 1O93A 1ZN2A 2UVPB 4NTZA 4RTRA 2G9VA 4QG3A 2PJDA 1OASA 2GF2A 3B85A 3COPA 4HX2A 4JJGA 5J58A 1UXKA 1SK9A 3TRJA 2VTDA 1J09A 4YJFB 4BX3A 1KAOA 3CZRA 4TWZA 2XVYA 3RIMA 3V8VA 4YLYA 3U6BA 1LDMA 3TIIA 4KTTE 4PBSA 4WA7A 4BC9A 1B3BA 3NB0A 1WBJB 3AI1A 4YI3A 2ZTUA 5K5EA 2Y1FA 3ACBA 1N78A 3JPYA 2AV6A 1DPGA 4XIFA 3D3EA 4D8VA 4K87A 2QGNA 4DYHA 4D8UA 4F2HA 5BVGB 3DQPA 5THQA 3MUEA 3N8IA 1Z2NX 4BUZA 2WMOB 3ZV5A 3BPSA 4U2GA 3T1TA 4OQXA 1IZ8A 5MF6A 2A5FA 3QWBA 3W78A 3KSDO 3WGNA 2WLSA 1KY2A 3CYFA 3PPIA 4BZWA 4DWOA 3KRTA 2YUIA 3IV9A 4MKRA 2YOFA 1ZR2A 3EVTA 1NPYA 3H2TA 2QLJA 2VI5A 1P0CA 2RG7A 3WK4A 4MR7A 4D3FA 1CF9A 2O52A 2XWSA 3AOEC 3DFIA 3EYWA 4HRXA 4AROA 3FXAA 4DXDA 1T25A 2C4TA 4J4HA 4NZNA 5B6PA 1IN8A 1O6CA 5A71A 3O74A 4DMUB 1G0NA 4DV1C 4BNXA 2PGLA 2AG0A 2HNKA 1Z5PA 1NWCA 4F4JA 4RS3A 2R9VA 1WPRA 2OSVA 4OYYA 5DGIA 5JDCC 3RVQA 3TSCA 4JOQA 2VBFA 1G59A 4CEJA 1PGJA 1WPXA 4DSZA 4M55A 2IW1A 1FU8A 2NP7A 4AULA 1T9KA 3FVTA 2HWYA 1E2LA 1XTJA 2YWHA 2JIZA 3FCYA 3K4HA 4XIIA 4OLJA 1KPGA 1NM5A 4PGFA 5FAXA 5CAEA 2WFZA 1XPJA 1XRCA 2CFSA 2X2PA 5EE1A 1KDPA 1DINA 2E49A 4OOEA 3RFFA 4YAGA 3SFVA 3OIUA 2IUTA 4GDFA 3ACDA 3H3XA 4F2PA 5P21A 4IY1A 2PBRA 4G09A 4M7OA 4BU1A 1ZZGA 3C48A 4M37A 1EHIA 3D7MA 4YJ2F 2YYAA 1F0PA 3KP1A 5AVTA 1E1YA 1PL6A 1T1EA 5DKFA 1OMOA 4X62B 3CX8A 4I2VA 1T6ZA 3MINA 1IMOA 1H42A 3BMCB 3K96A 3C1TA 3LUHA 1IQRA 2XT0A 6NULA 2X1HA 3VPSA 3PE6A 5C52B 2BWJA 3DLAA 3ED5A 3ZV6A 1TECE 1YS6A 1HG0A 2REOA 1RHKA 4QGFA 2CHQA 3F6BX 3ID6C 1NKSA 3ME5A 4LZNA 2G5CA 5CIQA 1SCUA 1XXHE 3HP1A 2WB2A 3N2LA 5FBKA 2OCKA 1PZMA 1SPXA 3FMOB 2H2GA 1V2HE 3G8BA 3AG5A 2J6IA 4NEHB 4YY3C 1M54A 4EY4A 3RS5A 2E0IA 4R0MA 1DXQA 1C30B 1JDBC 1V39A 2B7LA 1EYZA 2HRCA 2PQ2A 3N39C 4GGOA 4KR3A 2YVAA 3QP9A 4E46A 1T8RA 1YT5A 3VU3A 1HDRA 4B45A 1O94C 3IMEA 4Q82A 5KS2A 2JIQA 3IXMA 5TPWB 2VPXA 4RUKA 1DWPA 1YA4A 2GFIA 4YJGA 4EI8A 4YRMA 4ZHQF 1AMOA 5B3KA 1NMZA 1YVEI 4JJZA 2IH2A 3JWEA 3NRJA 3ZXUB 2P9BA 4X64C 3L7IA 3ESAA 4I50B 2NSDA 2R97A 4MQBA 3JS5A 4ES6A 2PZBA 1CQIA 2BBTA 4ETNA 3IOMA 3WNDA 3PC7A 1L5YA 1J33A 1PJSA 4ARBA 3EAFA 4PWYA 3PL5A 2W2MA 3M6VA 5JJKA 4N0EA 3FLAA 4HB4A 5HTKA 4RD1A 4R3NA 1HDIA 2V6MA 4G5GA 1WMFA 2XUDA 3ZTWA 4D9MA 2XVMA 3PXGA 1PNQA 1QYWA 2OBNA 1J8MF 1BMQA 1Z2EA 2W58A 3AMVA 4G24A 1P3DA 1CZHA 4ETMA 3PJEA 4EVRA 3SX4A 4UHBA 2JJ2D 3VVMA 3D2LA 1WCIB 1BW9A 2FWIA 3IVAA 1MXCA 3L6EA 3DAHA 3U7JA 2A57A 3HZZA 1OX4B 4DUZB 4Y2XA 4RU1A 1WDMA 1BCRB 1TI7A 5DXJA 5KTSA 2IGTA 4F86A 4ZVPA 4TS9A 5FO0A 4OHYA 2C2BA 4G23A 1KNXA 3AEQA 3OP4A 1A8UA 2ZYUX 3K20A 4TMVA 4W6QA 2OA0A 4OGGA 2BMVA 4UE6A 4WZZA 4Y9SA 4C0HA 4ZDIA 1OR8A 2WVGA 1EJ6A 4NARA 1UPFA 1Z7BA 1I94C 1P80A 4JUCA 1PL7A 1EAYA 2R60A 1XEAA 2N1BA 2YWCA 3H1BA 2R1TB 5IDYA 4DSNA 2UKDA 4G5XA 1GD1O 5EP2A 4YIHA 1R1DA 1IZYA 2ZBUA 4FFOA 2E48A 5E8JA 3WP1B 3GA0A 3WYCA 3AFOA 3NG1A 2G6BA 4D4MA 2I4RA 4WH0A 1PS9A 3UK1A 4C03A 1SHZA 1V6SA 3BOSA 4WFJA 1WTCA 1ID8A 2OBBA 2CWDA 3PQEA 1H4SA 4HQ6A 3KELA 4D0SA 2G0TA 2VZ9A 4DRYA 2DR0A 2UVPA 3UAGA 4LZAA 4TZTA 1MAAA 1XEWX 1JA1A 5FQNA 1D09A 3OIFA 2F1KA 2ZW9A 1XMIA 1NRIA 2HTFA 1MRNA 1L5SA 1K8ZB 4JEMA 4OMFG 5EMLA 1KVSA 2QX8A 1NQUA 3DDUA 4J0CA 5J1TB 3VU0A 4UTVA 2FEWB 3DW3X 2UYCA 3NUZA 1VKZA 3FDXA 4QU9A 1P39A 3SS8A 4EG0A 3DFUA 4GWKA 1U1FA 4QPCA 2QVGA 3UT5A 1Z0KA 5LP6C 3H05A 1JFFA 4OV6B 4YJHB 1PS8A 2BVNA 3V48A 5CYPA 2X4IA 4PIPA 5C5IA 1P2SA 4M88A 3GELA 1P7VA 4R1UA 4DV2B 5YASA 1I2BA 4BO9A 4B0PA 2H7YA 1HE8B 1C1DA 1QV9A 1U9YA 2V7UA 3QW2A 4J29A 3FCCA 1TIPA 3WL4A 3UMYA 2NMVA 4AZVA 4DJJA 1GNVA 4UDOA 3AP1A 3COYA 4MXDA 1XYGA 4DANA 3H3FA 2FXVA 3TQOA 4A1FA 4AAYA 4GPBA 1GJRA 4KK4A 3IQEA 3GD7A 1ZGCA 3GQBA 2Q4RA 2PZMA 3S44A 3UY4A 4EO7A 3BH0A 4UEKA 4QVKA 2MSKA 5ALQA 2RKBA 2O0JA 3WYAA 2UXBC 3R3XA 4HFRA 2B83A 5HDQA 4C3OB 5FOVA 1J2YA 3KYBA 4U39A 1JA9A 3DC7A 5DLQC 2YWGA 3FWYA 1Z5NA 1AQJA 3L0OA 4Q4AA 4XWYA 4BLWA 3GLGB 4DNFA 2WHXA 3IT3A 3MCVA 4L4YA 1ND5A 3H1EA 2WI8A 3JQ8A 1FRZA 2QMQA 4WCFB 4NCIA 3OHSX 1RBYA 1VL0A 4B3DA 1AUOA 1QOPB 1CR2A 3D8HA 3OJOA 3CVYA 3G2HA 1SKBA 1C0KA 4Z9AA 3A36A 1V7PC 3GBPA 3IIJA 3IEKA 3NLLA 2EIHA 3DYVA 4IDQA 3RF6A 4CWAA 4HSEA 4ENUA 5IW8A 5IF9A 1OZ0A 2QSJA 1DGQA 3RU7A 3GFRA 3TLYA 1HDYA 4FN4A 2QLTA 3EDRA 1WXFA 1CUCA 4KHPC 2Q5LA 3P0RA 3P19A 2W90A 4F7DA 3ZE6A 2QMHA 4YJ2A 1E2BA 2GZ2A 1E4EB 1PG2A 3T95A 5LYJB 4X3PA 4R8SA 3VHXB 1Z26A 2WG0A 3SDZA 2OCGA 1UWCA 4R7TA 2AC2A 1L4GA 4QFDA 3MGCA 3E7DA 2QUZA 2YJ6A 1E0JA 1WCIA 2DMRA 2AI1A 4CT0A 2O2IA 2ATXA 3KQPA 4AK9A 4DZRA 4B6JA 1F8GA 3Q72A 2CBGA 3DKVA 3CRZA 4TWIA 2ID9A 1BGWA 1WF3A 3IUNA 3OPVA 1BS9A 3L49A 3PLNA 3INYA 3PIDA 5BNFA 3S7ZA 3DVQX 2B8NA 1Q1GA 3PVZA 4FMPA 1PDOA 4PINA 2XCTB 4ML3A 2X7JA 4MQEB 1SUSA 1Y3HA 3VH4A 1FFGA 3GEMA 3UATA 5JS7A 3GUZA 2YY7A 5CBPB 1GR0A 4LXHA 4ZVUA 4HQLA 1H1DA 3WSWA 3C3EA 3ZD8A 1UDCA 4ZO9A 5BSGA 1FSFA 3JYPA 1FFDA 3QMMA 4MV9A 1F3LA 2HBRA 4P93A 5FWYA 1NVUQ 5IC6A 3Q1KA 4B6SA 3RVDA 2GM3A 1CUDA 4YPFA 3C87A 1WUTA 4BWFB 4PXSA 1RI3A 4QT0A 1TD9A 5I4CA 2NOAA 5ESDA 4MVWA 2JATA 2V7VA 1J0XO 2ORYA 3K0FB 3O9MA 3SP1A 1RY2A 4OA8A 4OKNA 4BP9A 3ZD6A 1GQFA 2A5DA 2XH8A 5A1JA 1X1RA 4R1NA 4OCZA 3QOXA 5LN1A 2B1JA 3IX7A 1GOTA 4NEGA 2DLDA 4X41A 4HNRA 2B94A 1H4QA 2GESA 4LECA 5HNKA 1E3EA 2E87A 5CR9A 3ZCQA 3GIDA 3BTOA 5CNJA 5ARBA 4F4DA 1ATIA 2WA2A 3L4BA 4NDAA 1JHUA 4BTLA 4OB6A 2OC4A 5KOYA 3MINB 3LHSA 3PUXA 3E53A 4HEA6 4TMZA 1YCGA 3ZE2B 1GR1A 4UQLA 1Z68A 5HIIA 3ADDA 2IYTA 2HHAA 2R8BA 3O4RA 1R8YA 1F1BA 3OHPA 1TQHA 1H0SA 3OJLA 2GEDA 1PU1A 3Q9SA 2EGUA 2XA1A 4GE3A 3RG2A 3Q6NA 2RGNA 2P1ZA 2QYHA 2FF5A 3L18A 4KO2S 1L4MA 4LXQA 4PS1A 4LCJA 3OLXA 4X5OA 3BCSA 3PIRA 5BQOA 4D8WA 2PUTA 3KTFA 2BR3A 1NT4A 3IOBA 3OBBA 2D1FA 1AUVA 1FTYA 3RC1A 3TZBA 5BWCA 2GSDA 4HGNA 5L3QB 1TZKA 1R9MA 4AXBA 1LW6E 3DF9A 3CLRD 3ORQA 5EINA 2MJLA 3QFSA 4BFYA 2ADFA 3L9WA 4KE7A 2HZ7A 2I62A 2PBLA 2PUJA 3UFXB 5BT8A 3KEGA 2X9VA 4QOEA 1DLIA 4YJGB 3V2IA 4C04A 1UOQA 5A3RA 1QQAA 2V54A 4ZDJA 4JR2A 2PGNA 3PPXA 1M2VA 1H2EA 4R81A 4B8YA 4B8ZA 3KZVA 4BN5A 4FM9A 4CFSA 5CB4A 1S9HA 2I1QA 3BL5A 1M7BA 4MLPA 4YP0A 3U1TA 4CMHA 5ICGA 2W0MA 3H0KA 4MNTA 5IAAA 2FYTA 4OPMA 2X0RA 4WKGA 5BQ5A 3PGJA 2W11A 3C3BA 1BO6A 3JQQA 3LP8A 4ZU3A 3O3NB 4BBZA 4RTPA 5D1HA 4ZT2A 1H0KA 1OREA 3W2GA 4ZYLA 1ZGJA 1USPA 3TSWA 2OY0A 4OTZA 1FP1D 1RC0A 2J7PA 4BMVA 2QT1A 4MYRA 4W1RA 5KYGA 3F7TA 1R6XA 1M2VB 1N5IA 3AT1A 5BVGA 3Q4GA 1F4VA 4Q1VA 3HN6A 1P7WA 4BB9A 2BHRA 1TKCA 1Z16A 2WSSA 5ECGC 3BHJA 2PUVA 4XDYA 1AMUA 2QX9A 1KFCB 1M83A 1X3SA 3BE5A 3LWDA 3NEYA 4JXZA 2OYSA 3Q2KA 1YB1A 3PQDA 4RANA 2P7IA 1QRRA 2Y6UA 2BI7A 1KETA 2HCJB 3REGA 5ABPA 2JDID 1IBMB 4AYXA 4HMOA 1WH9A 1E62A 2D1QA 2KDNA 4LDRA 4BQRA 5HZMA 1KU0A 5LL6P 2JD1A 1N6LA 3H1TA 3OOWA 1U9IA 5EHXA 2J46A 4I1SA 2XOEA 3USES 3KCNA 1SVOA 4KJZA 1OAKA 2GD2A 4EYOA 5D01A 3IMFA 1B6TA 1TNDA 2FK8A 2EBHX 3JD3A 3F1LA 4Q5IA 3CF4A 4ENSA 4Y0NA 1DPFA 1MV8A 2FG5A 4LBZA 1ACMA 1NF2A 2C57A 2DU8A 4LFCB 4P81A 3C70A 3P2OA 1M8KA 2RB4A 2OBMA 3LUDA 5DNWA 4E4YA 1ENYA 2X77A 2BN4A 3AFMA 3GP3A 3M81A 4GUAA 4IFIA 4CDGA 821PA 4RLQA 3D8UA 4FSXA 4BRSA 4Z4IA 3DPIA 4HPVA 1Y1RA 3PXAA 1VIYA 1XTIA 1IBKB 2PU5A 1CJCA 4UOEA 1EIWA 5IP5A 1IB8A 2QN8A 4BGUA 1NF9A 3W04A 1XTBA 4QOFA 3U7QA 4UPDA 1AH2A 2P7HA 1Z8NA 3BWEA 5K3EA 2H1LA 3CJEA 1XVTA 1ZKDA 5KYUB 2VQEB 2XQFA 1TU4A 1TQ2A 1TYCA 2I71A 2QYOA 3CF6R 5PGMA 3WIBA 3QFTA 2AC4A 4FYXA 4X1IB 4ZV4A 4LF7B 4EW6A 5CPBA 3BULA 5G0UA 2W2XA 4UTZA 5F7OA 1QX4A 2HWXA 3ROPA 5CDFE 1OXKB 3KJZA 2ZIZA 4NZMA 3HB0A 1AMNA 2VZLA 1ZGBA 3L6BA 4WEOA 2OOKA 3O47A 3QLUA 4R6WA 4V0OA 4YMIA 5ALOA 5DNDA 1N2HA 4HNAA 4R1MA 4GKKC 4DPLA 4EDHA 4MJLA 3V80A 3IELA 1NMXA 1NY5A 2MMAB 1I4DD 2IHYA 4OX9Y 2FETA 3IHKA 4C3VA 4E5UA 1M0WA 1E1RD 4XQGA 1B2RA 4C5AA 3WNBA 1MC8A 1QOQB 3DLTA 2HHHC 2OD2A 2VDKB 4PHFA 3WICA 2C7PA 3DR3A 3CB2A 4YV0A 1XJ0A 4TLDA 2W6JA 4PAMA 2A7QA 1E1RA 2R84A 3QUBA 5JD4A 1ZX1A 3GNTA 5KWEA 4ZVKA 4CKYA 4OA5A 3OESA 2ZB4A 3ET5A 4YRAA 4DUYC 4M9ZA 3MCUA 2ZDGA 4OX9B 3T1HC 1AM4D 4XB1A 3GGSA 3I01M 1BDMA 3GYBA 2UDPA 2WEKA 4ZGGA 5LQMA 2QY6A 2DFPA 4HAYA 4L2IB 1JKJA 1GG5A 2D2EA 2FSSA 2VQ3A 3JYLA 4GKAA 4QBFA 4TQAA 1Z0UA 4X54A 5EQFA 4CTKA 4Q4CA 1HE4A 2OP0A 3Q0IA 1OPXA 1VBMA 2KYRA 4DA7A 3ESRA 4ZN6A 2DHDA 4XQ0A 3TKYA 2NQ8A 4X3CA 4GF5A 2JEZA 1LX7A 2C84A 3GPBA 5LP1A 1CEEA 4P92A 4I3HA 4G2NA 4Q3KA 2H59A 4CQMA 3OLVA 1U9JA 4X0EA 2O3UA 4A0GA 3R6TA 1SUAA 1Z18A 3RRZA 3BJRA 3TKLA 2PLWA 4F56A 2F8SA 3G02A 2Y6VA 1BN6A 1CBUA 1SBZA 1TOAA 2HIGA 4N0MA 3HABA 1NHGA 5DYNA 4B3SB 3CR7A 3D5EA 3QPWA 3WYEA 5J43A 3QVWA 2UUAC 3FYHA 4KNVA 1DIAA 1SKUA 4EW3A 4X1YA 1O3YA 1U8EA 2E4XA 3I45A 4QOJA 4CU5A 3BGWA 3T15A 3VR3D 5FLKA 1FNNA 1PLLA 5SZJA 3SYNA 2OHHA 2OILA 2JVKA 3DC2A 2ATWA 1CV2A 2QD2A 2W2KB 1DKLA 3QG5A 5IKMA 1X15A 2XE7A 3T52A 5CDGA 3D1VA 1TUIA 4Q9DA 4ALJA 1QJCA 3J81D 4CM4A 3EVCA 1M6XC 4TT3A 4TL7A 4LE5A 3UJ8A 5DN6A 2V9CA 4YT4A 5BV2P 5GADl 1G2QA 2GRUA 4A8JA 5LLSA 4DV5C 4BQQA 5FOXA 1GPAA 3BJIC 3S1AB 4BIIA 1HBJA 3D4IA 4PTLA 3RHSA 3RYHB 3ZE8A 5ALIA 1QKJA 3SPXA 3HM2A 5C0OE 2BEWB 1UMCA 2BLLA 4F8JA 1Y5MA 1G9XA 4UHHA 1FDWA 2HMYB 4GMFA 1PYOA 4WIAA 5I7AA 1VP3A 4JJFA 3Q7PA 4JJEA 4OL0A 3LQFA 3AY6A 4PLHA 3R74A 3N6RA 5EJ5A 2FDCA 1A98A 2JHGA 2RJ3A 1A4RA 5H80A 3W8RA 1GT91 4DBLE 3V4ZA 3W6ZA 1USGA 3KB8A 1Y80A 1GUAA 1L7EA 2XQJA 1IBKC 4PBTA 4Q47A 5CH3A 4D43A 3QVGA 3T9AA 5HCUA 1Q19A 1TCBA 2QV0A 3STVA 4MZDA 3PCTA 3WQBA 1AK2A 2FW8A 2YRFA 4XPIB 2ALJA 1TK9A 3RKUA 2E8CA 2VUIB 3TECE 3ZHYA 1P4SA 2YJTD 1E0SA 1QANA 4W7HA 2VQSA 3ZWPA 4ILKA 4R1SA 3BF8A 2IOFK 2O0MA 4X97A 3I9V1 2PGXA 3R5JA 1R9GA 4WNYA 2XYVA 3EEYA 3EIUA 5DBHX 1PGNA 2KZFA 2GCOA 3W7AA 2IU3A 1DB3A 3LL4A 4JOBA 4ZVRA 3T5AA 1YS2X 2P9HA 1SZPA 1ISFA 4R68A 4CLRB 1A7UA 2DFLA 4AS2A 4R6XA 1U5CA 4IDFA 2QTGA 4NCJA 3CZ4A 3FPBA 4KB5A 2KLHA 2OM2A 4B8WA 1M72A 1ZNWA 4L76A 4X84A 4HZGA 4IIVA 1YDWA 3NH9A 2O7NA 4UNQA 3WGOA 2H63A 2JGJA 4GWGA 2DQ4A 4IDOA 3IRVA 3BBPA 1ONSA 2R6GA 2WJPA 1GQSA 2PT7G 3GROA 4DV4C 3OKCA 3A9SA 3VC3A 1VC2A 4OQYA 1NYEA 1ZUNB 2WSBA 2Y1DA 4UXIA 2EBFX 4OK5A 1I14A 2OZKA 3IILA 5I9LA 3VR2D 3L05A 3IURA 1B0PA 4RE6A 2C3OA 1QORA 2YVLA 3I34X 3IRUA 1C7EA 1KA9H 3P32A 2I54A 4LTDA 4H1TA 4QYMA 1SXGA 2EBWA 2WDPA 3SNHA 3OU2A 3GEIA 2CDCA 2ERCA 2SBTA 2Q4DA 2P6RA 1V43A 3A1WA 1V4NA 4BFXA 4MYHA 3L0IB 2AJCA 1W5TA 3MTDA 1FTNA 1QPZA 4G0OA 1RMQA 1NJ2A 1J56A 4R69A 1VCIA 4HCJA 3OZGA 5A7GA 1JF8A 2EERA 1XQYA 2VDNB 4K3UA 3EHDA 4AJEA 1N34C 2W37A 3B13B 2Q9AA 1V8PA 3CGGA 3N7AA 4CJXA 4YCMA 1Y8AA 1QVZA 3LDHA 3CQ9A 3NP7A 4Q7QA 4JJ6A 3OTHA 3JWIA 1SB9A 3EXFB 5IPFA 3SR0A 1S2DA 4W8HA 1S7GA 4CLDA 4QM6A 1XK6A 1FFXB 1UEIA 3GPLA 2VSNA 1QHYA 2Q6OA 3N2NA 2A7XA 4OSPA 3ZQKA 3JR3A 3PGMA 1T2DA 3KV1A 1CQWA 1OXTA 5E7JA 2I1LA 3CRRA 4W5RA 1OI2A 4HBGA 4CLEA 4MPJA 3EQ7A 4Q9LA 4A1OA 4DDWA 5K99A 1WSAA 2NYVA 5JD3A 3TMKA 1OZFA 1FP6A 3DYBA 1Y5LA 4G1UC 1YULA 1X1BA 2B1RA 3HDJA 3QOFA 2DTEA 3WWPA 3IDFA 3KYDA 3EZYA 2ZUBA 2P2MA 2P90A 5AVYA 5SV2A 3T5CA 3JQDA 3TW8A 5HFNA 4RTQA 1ZWKA 1NVAA 1EFKA 4IYJA 1JG1A 2XZDA 3BD7A 4QPNA 2ZT8A 2IYPA 1D2HA 3W5VA 4GZLA 5BSHA 3RF7A 3S8EA 3DS8A 2GCIA 2D5BA 3OU7A 4I1RA 5TGTA 3T99A 3TRDA 5HF5A 5JNRA 2ZUDA 1TLTA 5TS2A 3MPOA 3DE3X 4M6WA 3ABOB 4WFIA 1E7RA 5JUWA 4ARCA 3AVWA 3VGPA 4BX2A 4ED9A 1JR3E 3OO1A 4BNMA 5FBRB 2CJWB 1PRYA 1PZXA 5EZYA 2GEFA 5F3RA 3UM9A 2L17A 3NIDB 2EG5A 3ANMA 2RKOA 3F3KA 3THWA 3QUSA 4KODA 1K8RA 5JAPA 5LWHA 1DAMA 3DWFA 3HWRA 4C05A 2ZSDA 1Y8RB 4XGRA 3L4EA 1BVHA 5FUWA 3X2FA 4BVKA 4EHLA 4QM7A 1F60A 4LGYA 4BWGA 2VHZA 4EHBA 3RAEC 2J1LA 1RG9A 1A3CA 1ZOOA 3VV3A 4F06A 3KSRA 1RI5A 3PG5A 1JIKA 2MWMA 1DEHA 1DJLA 1DJNA 3KYCA 3SFTA 1ZMTA 4AJ2A 2OPBA 2BTQA 5C3UA 1ZOLA 5CB4B 1VB5A 2D0PB 1DBPA 2PZJA 2ID7A 1BEUB 3P9RA 1P1RA 5CYOA 5DHRA 2IE8A 2XMDA 4MA5A 2FG7C 1N2XA 1ISHA 2QMUA 3P97A 3R3ZA 2QTVA 1MX9A 4ND6A 4YALA 4F6RB 2FLKA 1RJ9B 5FOWA 1PW7A 2COEA 1MNAA 2XGOA 4QUJA 5JCZA 4QUGA 1WY7A 3IJEB 4Y2SA 3AILA 3RSQA 4CR7A 1EBUA 4BU0A 4CGYA 3GNLA 1U2DA 4ZPJA 3FIUA 1RFGE 3ZCPA 4WESA 1VDZA 3X1ZA 2O3TA 2QQEA 4IIJF 3FX2A 4KMRA 3U2QA 3AR2A 1DWQA 2WTNA 3JSXA 5HJ5A 1HT2E 1G6Q1 2IYNA 3IQZA 4HH0A 2EQBA 3KTAA 2R44A 2BEUB 1RXIA 5D1NA 1G1AA 1GTSA 1CY7A 4W7IA 4L5AA 1KU6A 1PX2A 2VF8A 3DV9A 4Q4HB 4BXOA 1UIRA 2BM0A 3PQ2A 3HKDA 1P0QA 2W00A 1X87A 3ND7A 4Q00A 4BNHA 3I5MA 4ZYWA 1UQRA 2C9OA 3QKUA 4OOFA 4HHEA 3H2BA 1FDIA 3U7IA 3V8MA 1EX7A 1AURA 1LTQA 1N2CA 1X77A 2FEPA 2QG4A 2ARKA 2AQ8A 4FSDA 1Y3FE 1W52X 1Q16A 1PKXA 2H85A 3N2QA 1AQ6A 5DXFA 2EYUA 5F23A 2PUGA 2PX3A 5KSWB 5EHQA 3O8CA 1LB1B 4OHFA 4DQXA 1HR0C 1G21E 4NYIQ 1G7RA 3EGOA 5CK5A 1BDHA 1XU7A 4TSKA 1G3UA 1BWRA 1LV7A 3PYLA 4WECA 2IZ0A 4PZCA 3ZVLA 5BQ3A 2OCAA 1YZUA 2P6OA 4GD3Q 3N2KA 1XMJA 3TPZA 1VFNA 2I4TA 1NLYA 1SOAA 3OD1A 1Q44A 4OREX 1EKXA 3WJ1A 2LR0A 4X66B 1LDYA 4S0ZA 3WLFA 2EW8A 4AF7A 1UMBB 3D6NB 3SSAA 3B2NA 1H93A 4WKOA 3GIWA 3LV8A 5KVQA 4FUQA 2ZVJA 3PJDA 1VJ1A 2DPMA 3AUUA 3O8DA 1T0HB 5AW6A 2FH5B 1O4WA 1KGDA 2WT4A 3ETNA 4IDAA 1UBLS 1XVLA 2I6FA 2NG1A 3ZZ1A 3CQ3A 3NATA 4MGZR 3LVQE 4EW2A 1E1DA 1K6MA 1OTXA 1DZ3A 1YJQA 1ZS9A 2R7AA 2XB9A 3L6DA 3NW9A 3HFJA 1ZK0A 4G8CA 4RVHA 3LPDA 3KK0A 2JIMA 4NESA 2NNWB 4S35A 5GP1A 1QO0A 1FDOA 3JD1A 1Z4PX 2H9YA 3QZUA 1ZD2P 4OQEA 1M76A 2EX4A 2QLLA 3X43A 5BN3A 4MTLA 3BT7A 2NT3A 3QXHA 1XCLA 3KSMA 3NETA 3L4SO 3FMFA 4FQ8A 4KPEC 4B3MB 3S8YA 4AKGA 3UMJA 5IAOA 5FBVB 3FUCA 5DTQA 2WT8A 4DIDA 2PEYA 4OK3A 1OI4A 5TMDA 4K9NA 2A9QA 1ZB8A 1FRQA 1HG1A 4XASA 3TEJA 3VHXA 4ALLA 4CIDA 3IAUA 4TTJA 1R0XA 2POQX 5DHQA 2EAUA 2GAIA 1ZQ9A 2Q7DA 1HDZA 4RL6A 2B98A 5EHNA 4H0FA 4IVRA 2M32A 1XRNA 1ZESA 5D00A 1F6DA 2I8CA 2XITA 1WJGA 3SOPA 1IL0A 2ANCA 2F67A 4MTCA 1ZITA 3TXYA 1FTSA 1E8MA 4V0LA 2EVWX 5E9JA 4ZEWA 1A9XB 1EWKA 4AZ3A 5D51S 3EPPA 3WAJA 3I53A 3RSFA 4IGKA 4RJIA 1Y81A 3CMCO 1CPYA 3ND6A 4BN0A 2AFRA 3BFVA 1CR1A 1J6UA 3OVMA 1CETA 4FYIA 3AP2A 3ZZMA 2HQ1A 1MC4A 1X8KA 2OENG 3BZBA 3G89A 5IVHA 3OZXA 4BEWA 4LVUA 2JNWA 1P4EA 4D9GA 1FP2A 5A9RA 5JZOA 5KX5B 4NDZA 2I1VB 3UHOA 3LTNC 3ZDAA 1UPCA 2R1TA 1JSZA 3OQIA 4IXMA 4F2WA 4D02A 3JQAB 2I2AA 2JJMA 4X7RA 5I4BA 1SB8A 2GEBA 2ODAA 2NZXA 1JI0A 2JAOA 4X7MA 1JALA 3CVVA 1I3CA 4ZOLB 2V6JA 2C7VA 2WJYA 1O94D 3TLGB 1PKEA 1GFWA 5CT6A 3AEQB 3G6KA 3L4BC 1RIFA 4DIMA 4AZSA 4RX1A 3EVEA 1MXBA 1ONNA 2JIPA 1G64A 3CKKA 2VDWB 2B4QA 1LDGA 2H5EA 3ZHOA 1DJMA 2OVFA 1ZJWA 1CUZA 4JKYA 1JLRA 1YZVA 1XKQA 4TT3D 1W85B 3FFTA 3ZY6A 1I6WA 5A7HA 1LRLA 3SQOA 3UB2A 1RACA 3PPVA 2W70A 5MDHA 5AJVB 3EBLA 3PWSA 3MTIA 2FPSA 3M89A 4PX9A 4P58A 3BHNA 3K5PA 2KLBA 1P61B 3KQTA 4GPZA 1GYQA 5LKAA 4L28A 4D3XA 4OY3A 3K9QO 5HQ3B 4CTJA 2VTBA 4S1OA 3RB8A 2OOSA 1QDEA 2IPAB 3WLPA 1BX1A 2ZBRA 1XRJA 3G2QA 3SICE 2IYYA 3UAWA 1I8TA 3QE9Y 5HHTA 5IXYA 1GEGA 4TKLA 5EWLB 2P9ZA 3VBEA 4QGAA 2O1XA 4GRDA 4JT8A 3TW0A 4CLOB 1ZUWA 3KT6A 1NNSA 2CXQA 1OC4A 3CVXA 1VIAA 4MI3A 2DR3A 2HBYA 2Z98A 3BD9A 3KZCA 1TJ3A 1C30A 2WTMA 4L8YA 5I8ZA 5HZKA 3LMKA 1E2GA 1GP2A 2QD5A 4U2BA 3T7RA 2PRIA 3LT2A 3SQNA 3KYJB 2QJWA 2AZTA 3PRKE 3SR3A 4QQRA 4YRIA 3FNIA 5F64A 1EX6A 4UEJA 4EL5A 4AJHA 1WXQA 1J9GA 1S02A 1YRHA 4Z0NA 1J70A 5HSGA 2P69A 4N12A 4E5SA 2OZLA 1GPNA 4GYWA 5LOVF 4IF6A 4EECA 3QVXA 2CLDX 3CH5A 1SHLA 1VLQA 2FFHA 3AHCA 4ZJZA 3KSBC 5C7OO 4N5NA 1CRWG 3CNHA 4W7SA 5LMNC 1P3JA 3MRXA 5E6UA 4TTAA 3MT8A 2MYTA 1XTQA 3FPCA 2XYRA 4K05A 1NG9A 1QZ3A 2CDAA 1GG2A 2Y1KA 5EJ2A 1XTUA 2JHFA 1OY1A 2ZE5A 3IEXA 1MN6A 4TUYF 1HNNA 2WICA 5JPCA 2FPKA 3LZCA 4NXNC 1TQ8A 3PUIA 4RO0A 5B2EA 3WAGA 2HAEA 3EOZA 3W5HA 1TX4B 3CVJA 2R4QA 5TRTA 1RWQA 1V4BA 2IXGA 1O9TA 1R64A 1RHJA 3QEKA 2XSZA 1XWFA 1LLFA 1TCCA 3HUDA 1CZRA 1O5IA 2CL6X 3GK3A 4KLCA 1JPNA 2LW7A 2XMQA 4HDSB 4RA6B 4UVEA 5JQGB 3O3MB 2NO0A 8ABPA 2BGLA 5JQGA 2IYAA 3Q8WA 5FTJA 2V7GA 2BM8A 4N6NA 4H4CA 2ZI6A 4X91A 1YJ7A 1AGNA 4HB2A 2DH6A 4D9BA 3DGEC 3U44A 3H4IA 3ODPA 2FUG1 4R3WA 3TZCA 4YT8A