4GXQA

Crystal structure of atp bound rpmatb-bxbclm chimera b1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
505
structure length
476
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAFVVLREFAPSEILAEELAFVDRLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Substrate Specificity of the Rhodopseudomonas palustris Protein Acetyltransferase RpPat: IDENTIFICATION OF A LOOP CRITICAL FOR RECOGNITION BY RpPat.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
molecule keywords Malonyl CoA synthetase, Benzoate-CoA ligase Chimeric protein
total genus 139
structure length 476
sequence length 505
chains with identical sequence B, C
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gxqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gxqA01
3IPLA 4W8OA 2WD9A 1MDBA 2P2BA 4GXQA 4D56A 3DLPX 3E7XA 2D1RA 3FCCA 4WV3A 5BSTA 1AMUA 3WVNA 2QVXX 4RM2A 3E7WA 4RVNA 1BA3A 2QVZX 2P20A 3G7SA 4ISBA 3GPCA 5BSMA 2V7BA 3E53A 1PG4A 4DG8A 3RG2A 3VNQA 4G37A 3IERA 1MD9A 3LGXA 3EQ6A 4OXIA 3L8CA 4GR5A 3QYAA 4IZ6A 5E7QA 3IEPA 3CW9A 4FUTA 3NI2A 4GS5A 4GR4A 1LCIA 2Y27A 3LNVA 3T5BA 3A9VA 2P2JA 3U17A 4RM3A 2VZEA 4D4GA 4GXRA 2D1SA 2P2MA 4DG9A 4PZPA 5BURA 4OYCA 5K8FA 4M46A 3T5AA 4R1LA 3KXWA 3T5CA 3B7WA 1ULTA 4G36A 3WV5A 2D1TA 4RLFA 3U16A 3WV4A 3CW8X 3O82A 4D4IA 3R44A 1MDFA 4EATA 1T5DX 3ITEA 3ETCA 3PBKA 4IR7A 3RIXA 1V25A 3FCEA 1RY2A 3NYRA 5BUSA 5BUQA 5K85A 3NYQA 2VSQA 4R0MA 2QVYX 2D1QA 5D6NA 1V26A 5DV9A 5BSUA 4RLQA 3IESA 3O84A 3LAXA 1PG3A 3TSYA 4RMNA 3VNSA 5BSRA 5BSVA 5IFIA 1YJ7A 2P2QA 2Y4NA 3DHVA 4E5DA 3IVRA 4D4HA 5JRHA 3O83A 5KYVA 5KYTA 2P2FA 4LGCA 4D57A 2Y4OA 4U5YD 4RVOA 1T5HX 5KEIA 4R1MA 3DAYA 4ZJZA 5DWVA 5BSWA 4FUQA 5GTDA 2QW0X 3A9UA 3C5EA 3VNRA
chains in the Genus database with same CATH superfamily
1KZ4A 4OKIA 2R79A 4E21A 2CLFB 2ALJA 2CXUA 4FGUA 1EA7A 4UMFA 3E9QA 4BFVA 4DLAA 2DTEA 9ATCA 2WF7A 5FWAA 1Q21A 1QLHA 1U1CA 3WK4A 1GQOA 2FMKA 1JZTA 2EL7A 3GP5A 4ZPXA 4DS3A 3QFTA 1XZEA 4KLAA 4PXYA 4UREA 3MJ4A 4GDMA 3I5YA 2WKPA 2JANA 1I2DA 2ZATA 4H1VA 4NI5A 3DAFA 4AJEA 1QYWA 3RG8A 3KE8A 1CUUA 1KP3A 1RAGA 3L18A 4HFJA 5A3QA 2CFOA 2IDKA 4MUBA 1CF4A 4ZYWA 1TUGA 4B8ZA 1LW7A 2AYAA 3K9BA 3JQFA 4ETWA 5K8LA 1DWUA 3DAGA 4Q4HA 3A6HA 2A9RA 1DEAA 3A10A 2PV0A 1E9FA 4UTZA 4CL3A 2H0RA 5CH8A 1QGZA 3EPRA 3KUDA 1GAEO 4OYYA 3FN4A 2Y27A 1RM0A 2ZQZA 2EFCB 1SCBA 3MLBA 5KU1A 2DBRA 1LUAA 1U3VA 1HE5A 1JWAB 1LDGA 1PTJC 2CY0A 2X41A 3HN6A 4DR5C 3NNSA 4IAOA 5ESDA 3TN7A 3BJIC 3WWYA 1U2TA 2AT1A 4JOCA 1I2CA 1P0CA 3EPPA 1JIIA 3FDFA 3MINA 1DIAA 2HQRA 4UUOA 4W9RA 2CLEB 3AU9A 5EMKA 5BOSA 4HATA 1ZESA 2YWBA 2NO4A 3MSXA 3EZFA 3SR3A 2BDTA 1MAAA 2CBZA 4CVNA 4BNVA 4E1BA 4N5MA 1KDPA 5GJVC 3I8SA 3MAJA 2A7QA 4F2GA 4M60A 1O1YA 3D5TA 2PGOA 4HDRB 3ES9A 4U9UA 2QVBA 4BO8A 3N75A 4BBJA 4R2XA 3TEMA 1ZP6A 4JBXA 2G36A 1WXQA 4B3XA 3BHMA 3FLMA 1I0LA 1M2VB 1TQ8A 3HDYA 3L1JA 2GZMA 1IPFA 1C1DA 5BUSA 1YE5A 1ZICA 4TQGA 5EZ5A 5P8WA 3U9TA 3ZZNA 4IOLA 4TM8A 1CQIA 4MHSA 1IZ7A 1EESA 3U44B 2IY8A 4IDQA 1CLEA 1JIUA 4HSGA 1IFXA 2GBFA 4RTQA 3CGWA 1NOIA 3JQ9A 3LUGA 4P86A 3UUGA 2EJUA 5AK3A 3QW2A 3MYYA 3HDHA 4ZCMA 5AW1A 5MFPA 4CMBA 1MG0A 2F90A 2IV2X 3L95X 1F9AA 3LXUX 4NJMA 3RABA 3Q7SA 4HAWA 1LBHA 5BRJA 4ZO6A 4BX3A 4D8UA 4DA9A 2Z2IA 4GZLA 5CD9A 2MSDB 5CT4A 1B00A 4AO7A 2JFOA 3TW8B 1T8WA 4DDKA 2WAMA 2JL1A 4ZAYA 4JVLA 1XU7A 1NBMD 2PCJA 2QXTA 4IXWA 4K7JA 4L3OA 5EIOA 4K6FA 1NLUA 4ZJYA 3BWCA 10MHA 4HDOB 1JKMA 1E3DA 4PO9A 3DAPA 1T5HX 1J2TA 4R71A 3NIGB 3OM9A 5DO9A 3W34A 1S96A 2RARA 4JJIA 4M0EA 3V4ZA 1XCJA 3FW1A 1QTRA 1Z6PA 3W2EA 5F2NA 4WS9A 3LA8A 4RKYA 3P94A 4D3ZA 2HA3A 3E35A 1R12A 5CLHA 2PS3A 2AN9A 5DNDA 3E9RA 2I2CA 3NKLA 5FLXD 2UVQA 1T1EA 4AYTA 2XVXA 1WQ3A 1U4SA 2HQOA 4O4HF 3CZMA 5CM2Z 4FSXA 1VI2A 5IC6A 3U0BA 2ATVA 2PQ6A 5LMCA 3A2MA 3HVIA 1LK7A 5KYWA 3V8RA 1HF3A 1DI0A 4IIJF 5KX5B 1V7QA 3P9KA 3BRSA 1Y9DA 3OIYA 1ZGGA 2HMWA 3MQ2A 3JPWA 1OGYA 1LPMA 1QRDA 4KSYA 2D5LA 4X1OA 2C4TA 5I9BA 4HDNB 1JG7A 3FNHA 4BNMA 4EUEA 4TZ6A 1AK1A 3OLVA 4L5AA 4KRGA 3V3TA 2O8BA 3MTIA 3G8CA 3OEED 5DYYA 1TRKA 5JNVA 4GECA 3CW2A 3EWSA 1L5NA 3Q3EA 2CFRA 3OQHA 1QHGA 2J3JA 3HEBA 1J0EA 3L8MA 3RKUA 1VHWA 4DJDC 1JFSA 3WSVA 4DR2C 1RHQA 2O9JA 4N6GA 1TZ2A 4CKYA 1NDUA 1X7YA 4N03A 4RHFA 5EMLA 3HXTA 3K8QA 1UC4B 3G49A 5A1IA 5JYBA 2J31A 4CQMD 4MH0R 2ZREA 2PWAA 5DZSA 1NQVA 2VWHA 2B30A 5FTWA 3WO0A 1B16A 5LA6A 3V5NA 4KTTA 2CXNA 3I6YA 3PLRA 2NSYA 4I1SA 5HBRA 1CF2O 5HIMA 4FGWA 2HK9A 3U7HB 3H11A 4IH4A 2F17A 4JQCA 1CZOA 1GGEA 4MRMA 1ULTA 2PTHA 4QTUB 3BEDA 5JW6A 3I0MA 1ZUD1 3SU8A 4LOKA 3NAZA 4V0ME 2BR5A 1O5IA 4YP5A 5CW2A 2Z9DA 3BQ9A 1P5FA 4PC7A 3IVMA 5I9LA 1U2SA 2HSZA 3HADA 3PEFA 3VNBA 1KMQA 1E60A 1T9AA 2P7IA 3KQTA 3DQQA 2VZ9A 3N9IA 3P9PA 1LV7A 4MRSA 3FNIA 1V6AA 1KQPA 1UXIA 3P32A 4P32A 4Q1CA 3RUFA 4GZ3A 5AHKA 2VTKA 1E7QA 2WFLB 4MLPA 4L27A 2Q3MA 1XDZA 2X3YA 3GGCA 1SVSA 2JIDA 1LF5A 2OQIA 2G7ZA 1G6OA 2GVZC 5JMTA 2FP4A 4MQUA 3S55A 4OI0A 1H3EA 3GGGA 2RIRA 5E1BA 3NJ8A 1KAEA 4D97A 4PFQA 3VAYA 1XPUA 1MH9A 3L79A 4FFWA 3CUSA 2L42A 1GPNA 2Z43A 3QVTA 4RH1A 1ZAKA 4F5EA 1DIRA 5ELMA 4YAIA 5KSWB 2HBQA 5LQAA 1AUXA 2IHKA 3MBOA 2DXIA 3PXBA 1XZ8A 4JX8A 1QCZA 5CCDA 1CZHA 5ALZA 1FZQA 4BMSA 2BH1X 4P1ZA 5JWOA 1E58A 4P4UA 4CI9A 2OFOA 1KJZA 3ILHA 2DEUA 5IJ9A 3NPDA 5KYVA 3Q3CA 1GNQA 5HEKA 2O7NA 1RXYA 1M2OA 2EFJA 3TZCA 2W2PA 3L0YA 5B2ZA 2PRIA 3CEAA 3DGFC 5M3BA 3R9XA 2QN7A 3EIXA 4B2YA 2I7DA 3ZDCA 2MYUA 3S7ZA 4YB8A 3D4BA 3IX7A 2R1UA 3WGIA 2I6SA 1QQTA 1Z0IA 3EGCA 1EFKA 4W1PA 5KBYA 1EG7A 3NWBA 3ZXYA 3B36A 1L4LA 3CNLA 4OQPA 4HXYA 1T13A 1XOIA 1OKKA 1X6VA 4MNTA 3QQ5A 1F4LA 1OIXA 3MXTA 2QQ0A 3AI1A 3KWJA 3QFHA 4YMIA 5DTMA 5EJ4A 4EY8A 3ZCUA 2EHDA 2J33A 1YQQA 4OOFA 3EIUA 2QGFA 1R0WA 2IL1A 3GMTA 3LKDA 1H8HA 3MGKA 1D2AA 1VHQA 1WWKA 3WGGA 4AQYB 2ZRIA 3UUEA 2APJA 2DKOA 3FTFA 4QUIA 4GYJA 1GL7A 3UH0A 5E3JA 4CHGA 3UN1A 1JPJA 2ZBDA 5EMJA 1XKQA 1GU7A 2Y1EA 2H2GA 3L4KA 2OBNA 1MTOA 2O14A 2YY6A 1XZJA 4LDAA 4NCBA 4DCUA 1PG4A 1P0IA 2DYJA 1ZIPA 2RAUA 2WD7B 4LF8C 1DJQA 3OMXA 1T3TA 4BJ1A 2ZUSA 4U63A 4C4AA 5JXGA 4FKZA 2XXBA 4KYVA 5AJHA 2HTEA 3KKQA 1K4KA 4F3RA 5IKPA 2PZBA 4PWZA 4R0VA 5CYPA 2FSFA 5DGIA 3W4KA 2HDHA 2P40A 4UUBA 3A3PA 3CXRA 5CLJA 3AHGA 5CFNA 4PPGA 5TY0A 3TLXA 1ECCA 2Y1FA 3QKRA 4UUQA 1NQUA 4MKRA 3HR4A 3IAXA 4X71A 4M3NA 1NI4B 1PZHA 2PR7A 3BGVA 3HY3A 4TVOA 4ZXFA 3OIGA 4I50B 3TQRA 3VHQA 1LLQA 3W1VA 1DEKA 3OA0A 1R0YA 4BV3A 3IBTA 1YZVA 1DXOA 4ABTA 5JAOA 3A6LA 4RK4A 3T9CA 4OJTA 2OD9A 5B6PA 3AONB 3L7OA 3E9DA 3KEQA 4O2BB 4X66C 1A7UA 2GBIA 4IP0A 1U8XX 3KL2A 3WZMA 3IE0A 3ZK7A 4QLBA 1OFIA 3M2PA 4DV1B 3I9NA 1O9BA 1ZU4A 2PXXA 1ADGA 3F9IA 3NBXX 1X70A 3HNRA 3BSSA 5CURA 2XRYA 2C2WA 2WKSA 1PQUA 3G0GA 3MMXA 3PUJA 4D8WA 3GRAA 2YZ2A 3JVUA 1WEKA 5EIBD 4Y1EA 2YVKA 1JR3A 2LNDA 3NDIA 3Q9UA 1BMTA 1RP1A 1N5IA 2D62A 2BFEA 4TS1A 4XTCS 5DGTA 2X8JB 4CLOA 2ONKA 2G88A 4GPIB 4JGIA 1QRRA 1CNFA 1RM4A 3DBOB 5DYWA 3U3KA 1ES9A 2WTEA 1LDEA 1E9SA 2GBCA 3GCZA 4UE6A 2YZGA 3WDMA 1KOFA 3CT4A 3DBVO 3MJVA 3AIKA 4YRZA 1K2WA 2WINI 4MWBA 3B1KA 1XYYA 2GEJA 3K35A 3PTLA 2BE9A 2XUDA 1I51A 4MA5A 3N0XA 4ZI5A 3S1AB 3WRYA 4TV8A 5G1NA 5ERXA 4L2ZA 1W30A 4WW0A 2JHFA 2ODPA 5H8WA 3D6VA 3SJCA 3OZUA 3KSDO 2CLHB 4X7PA 1LPOA 1MF7A 1JQLB 1OXSC 5FPYA 2YKGA 2Q21A 1ORTA 3GFFA 3ORSA 5CNMA 4HMOA 4GSKA 2IH4A 3AC0A 3EGDB 4TS4A 2EKBA 1KKUA 5ENVA 5F52A 5NULA 2MR5A 4FWBA 3B5IA 4ZJPA 1V2GA 1G41A 1NE2A 1ATIA 4MULA 1SVWA 3BK1A 3D4PA 1OTYA 1R1DA 4HXFB 1HC7A 2NUPA 4L5CA 4QDUA 3AIOA 3G5MA 4POOA 1U28A 5DYIA 2EJWA 2ZCUA 2ZVQX 3A9RA 4GXNA 5F64A 2WQ6A 4QJ4A 4Q82A 3M6IA 4BKOA 4EUFA 2AQHA 2XUIA 1TCVA 4B2LA 3W8DA 3AYXB 4HGZA 1LB1B 4YS6A 3IV9A 2WVJA 4EFNA 4MUHA 4CXMA 2WD9A 4K0KB 2XI4A 2X0DA 1HX7A 3Q8WA 4WGFA 2FPOA 3CKKA 3OEHA 4GBJA 3UXMA 3KBOA 4ROTA 3INNA 2QRGA 2ONCA 4E7OA 4GLBA 4B3RB 3ZWOA 5H1YA 3DZFA 1IXZA 1TLTA 3Q6MA 4H31A 2ZYWX 3VJKA 3ZNQA 5EXXA 3ONWA 3QE9Y 4UAGA 1H5NA 2FDRA 1Q2XA 5H3CA 2BJOA 3SR0A 2WPDD 2PNFA 2P0YA 3AEKA 3JYPA 1C1XB 3ICCA 3F97A 4ZCPA 1GZ4A 4D9JA 5K6RA 3ZH9B 2OZLB 4GW3A 1I36A 1QZ3A 1SBCA 1YS2X 3N8DA 4US1R 5D1HA 4KPUB 3WFJA 3FAKA 4JJAA 4C4ZA 3K31A 4I0WB 3JQAD 4D3XA 4ZVOA 2FX3A 3FMVA 1U3FA 3CZCA 5CJ2A 5MN4A 3AJ8A 1GA1A 3GOHA 5FA8A 2F8LA 4TTRA 3VDXA 3DEAA 2FMFA 3DV0A 4RA6A 2K7FA 1A8UA 1T25A 3B5JA 4Q1AA 3V55A 4E0BA 1KAQA 2VWQA 1EP2B 2VJOA 1MQ9A 2FW0A 4LNUB 1AN0A 2CXPA 1WMEA 5DEIA 2OHHA 3R7NA 1RRGA 5LCIA 5BURA 1MJGM 2GVDC 3QJGA 3VYRB 2O59A 2TMGA 4FSHA 1OB5A 1BWRA 1TZMA 4AWBA 4MITA 4V0LA 4RELA 1ULZA 3G9UA 1Z4JA 1AB6A 2EATA 4RLFA 1HSOA 1JR6A 2PPVA 3TD6A 1RYYA 3OD1A 4EHHA 2IYFA 2OSVA 3DE0X 3RSZA 4BQPA 1FDWA 5CIYA 3FGZA 2JEYA 3JARA 4MQMA 4DMMA 3PDUA 1ENZA 3NWPA 3FDZB 2EZ4A 4F7DA 2VAVA 4CEHB 1L3IA 2Y2VA 2H52A 3TOZA 2QRPA 3BMOB 1NW4A 1O4VA 3OURA 1GQFA 2FLVA 4POAA 2QZSA 4TMZA 1BXGB 4MVJA 3K71B 5AW9A 1WVIA 2GAIA 4ZOLA 3TNFA 4ZQBA 3SBOA 1I94B 2DFNA 2C4UA 1M1UA 4YAFA 1TU3A 1KSHA 5CFRA 2H63A 3W6UA 3RYCA 1JLLA 2C54A 3TQIA 4NNJA 1E92A 4ND7A 3TSCA 1ZNYA 2HU8A 1FX1A 3SX4A 2DLCX 1MUUA 3NEYA 1ODFA 2IY7A 3JR3A 2GJ9A 4ZU3A 1UR5A 4JL5A 4PF1A 1WF3A 1U6KA 4PIVA 3CJTA 3EMVA 1Y8QB 1UAGA 4PGFA 4PQGA 4WJKB 2VHQA 4BDSA 2QROA 3K05A 4G65A 1Z4MA 1T2DA 3NGXA 1V37A 2DH5A 4EJSC 3BQNB 1L7VC 3D7NA 4DW8A 3GF4A 4FYVA 1TK2A 4BASA 2QB5A 1VMKA 2ECQA 2HF8A 1Q0SA 5HYVA 1U81A 2Z4TA 1G66A 3RWBA 4BAGA 1AJEA 2V8OA 1T2VA 4GQAA 2H4YA 3K2IA 4F4HA 1CXZA 3WWOA 1QIDA 2QTBA 3HQ4O 5G0WA 2A1UB 2GZ1A 3TH5A 4BMZA 1FYFA 3GLIE 4RH3A 1G4HA 2J9YB 3OOEA 3T1TA 3ROXA 2ZGVA 3GRKA 2O8NA 4YQYA 3V1UA 1DG3A 2IXFA 2OBMA 4OBXA 2H5IA 4LY0A 5HHTA 3PNKA 2FDCA 2IS6A 3E4CA 3OJEA 4RIIA 1M2JA 3Q8KA 1D6SA 3FSGA 4L2IB 4CN8A 4HAZA 2PA3A 2E8EA 1Q1NA 5TS2A 1DRKA 2IYZA 4BN5A 4X8MA 3DOIA 2ZM6B 3FSJX 1CW2B 1JRLA 1RBZA 3IODA 4YV2A 3GDGA 5BRAA 3E2MA 4OL9A 5LYJB 1U5BA 4D99A 5KHOC 2R68A 1GAJA 1O7JA 3FPHA 1JTVA 1K92A 1REQB 1ECFA 2ICAA 1H8HD 2EWVA 3IPYA 5L45A 4BAUA 4JQYA 4CPDA 3CVWA 3KR0A 1ZLXA 3GARA 3DYVA 4MR9A 2NAFA 4LE2A 4U7TB 3VPAA 3MCTA 2AH5A 4JBLA 4WA8A 1VFNA 2RKOA 4DV2B 1QG0A 5TEVA 1ML3A 3CF2A 5TRTA 1Y1LA 1KEKA 3EPHA 1F5NA 2NZWA 2YV5A 3MTAA 1XQ9A 4OU4A 3VMFA 4UPVA 3IUJA 5A04A 5JARA 1CLUA 2YS6A 1ZCFA 2OKGA 3AR3A 4HDAA 4AL4A 1DWPA 1T6XA 2G8LA 5I6DA 4TV8F 4YHHB 1XRBA 2J7KA 1M6WA 4URUR 4ASUD 5JAZA 2NTVA 3ZDBA 1LS6A 2GZ2A 3EW7A 4PWYA 1N9GB 1W4RA 3ML1A 3OT4A 1MAUA 1N5MA 1V5WA 5LJLA 4R6XA 3DBRB 5CD1A 3JQAA 2AUTA 4ER5A 3EERA 3D6JA 3MIIA 1YTLA 4M88A 2QQGA 3BK7A 3I76A 3ZHQA 3CW8X 1ULHA 3S1AA 1DC3A 1PJCA 4K46A 4XGNA 1KZ6A 5ICCA 5JATA 3IS3A 1VLMA 2DBVO 3QUAA 1M6VB 5I7WA 5T57A 4KN9S 2PL9A 1Y7LA 4YCJA 2JJ2A 3S7TA 5H68A 3VHRA 2NO0A 4O2AB 1WUJS 4PHTA 5LBTA 5D87A 3IEUA 1IAVA 5CK5A 2CVPA 2H16A 2R47A 3N2QA 1EE1A 2IOHA 2BFWA 3NHYA 4PHFA 3SIPA 3WSTA 2Q27A 1TYEB 3OD5A 2PJRA 5DV9A 3G79A 3ZV4A 1WOYA 3OZXA 1G6HA 3AZQA 2R8BA 2FSPA 5JNTA 1N36C 2GF2A 2CF5A 1PQYA 1LBIA 1SG9A 2GLTA 2H92A 1CRWG 4OI1A 1Y1TA 4IUCS 5J5VA 3UGQA 3ZR4B 1SKBA 2FZLA 3ZTWA 5HP4A 1VL0A 2ZJBA 3CLTC 5EESA 1E64A 3BX1A 4FYHA 4GC9A 4WHMA 5ADZA 4ZCLA 5C32A 1ONOA 1IY2A 1DARA 1SVMA 3PGXA 1U4OA 3KU1A 4JL8A 2CDNA 1P19A 4OQLA 3EWAA 2H59A 3DKRA 5H4HA 3LYHA 3HCWA 1SCUA 1Z7YA 2QTLA 3OE4A 1L4MA 1J7KA 4P35A 4LGCA 1CY0A 1R3UA 3PGKA 4D57A 2P91A 4HH0A 3PC4A 1R9JA 4LFAB 3O8DA 2R8YA 3L6RA 3OJXA 1ZGZA 3VVLA 5BSEA 1HLDA 1EA5A 2DBZA 4X6UA 1L4GA 3LUPA 4A15A 1KSJA 4R1MA 4ZT2A 4ENQA 1FB5A 4QJIA 1NU6A 3KUXA 2CUZA 2QLBA 5K51A 2C99A 2YHAA 3I34X 3ZVLA 4JT8A 2GKOA 2UUAB 3ZZ0A 1NN0A 2F3TA 3QV1A 3WQBA 4DNOA 2X4DA 5AH0A 5FORA 2XNKA 1B74A 4IF6A 2D6FA 1F2TB 4EZIA 4H35A 1XKTA 3ZDRA 2HIGA 3H0EA 5B36A 2IPMA 4AG6A 3S2UA 1A8HA 2D5CA 1GDHA 3DZHA 4LK3A 3PB3A 3WYCA 4AURA 4OJMX 4BNNA 3R5HA 1Z8FA 2P6PA 3N5KA 4FBMA 1XPRA 3EIEA 2WAAA 1ZUIA 4YRPA 5GONB 4KODA 2YN2A 1QS0B 2X0EA 1PG0A 4EG3A 1N9KA 5TGDA 4DG8A 3EDMA 1Y80A 4G37A 3T1YC 1F0PA 2VJNA 1ZSVA 4BLSA 1E2DA 4OSEA 5CIQA 4BOYA 1UKCA 1UBUS 1XDUA 2IIBA 1L6IA 3L8HA 3L01A 3SVTA 1NLZA 5A0VA 1NV8A 3H5WA 3DF7A 4M76B 4Z0HO 5LQCA 2JHPA 3FVTA 1CDDA 1C8BA 3FZYA 3RD5A 2FLWA 2Q6LA 4TN5A 3ZY4A 2VNJA 5DRTA 1V4NA 1PR3A 2WDPA 5KVAA 1NXSA 1X14A 2BFDB 4ZI7A 1RHJA 4JJ8A 2P27A 4DUZC 2XZDA 1YJBA 4ZDWA 1EP1B 1AC5A 5HJ7A 4TLBA 2DWUA 3BA6A 3HM9A 4L28A 2RGEA 4ACBA 1F1JA 5AVKA 521PA 4TVSA 2W2LA 3MK31 3CH4B 5BR8B 7ADHA 5C1DA 2KQUA 3EUWA 2UVPA 1Q95A 2Q3BA 1A9QA 1L3CA 3LBFA 3O21A 4PXAA 3IMLA 4TTJA 3RGGA 1FRFS 3INGA 4HB0A 1N25A 3TZLA 1ECLA 5LDHA 4WN3A 3LKBA 3OLCX 2PMFA 4ETNA 1VHLA 2C4KA 5E4TA 1NA5A 1PO7A 2WSLA 3GCXA 4W1RA 3HP7A 3LTEA 1KYQA 2PAFA 2REQA 2WIGA 1EVKA 1Z37A 1XK6A 3AX6A 1CR0A 3S5JA 1Y6FA 3ANSA 4LA4A 3TCKA 3ZEIA 3UGTA 2P69A 1GDDA 4OY3A 5BYAA 3KV1A 4MWCA 3CEPB 5JCPA 1E4OA 5ALDA 1SD5A 3ZKWB 2Q9AA 2W6IA 1V7ZA 5DGXA 1I4TD 4Y0VA 2B21A 5SY9A 3U1TA 2COEA 3DD1A 3PT9A 4LHEA 5DTJA 1XTTA 2JIPA 3KCQA 5FBRB 1ML8A 4DLUA 3DDUA 2J4DA 2CHGA 2AC7A 2JAQA 3IAM6 4MDHA 1C7IA 5A05A 1JNYA 3BMQB 2FN3A 4KMSA 2PRSA 3OE7D 3ZCRA 2HK7A 3HB9A 4EYKA 2W2TA 4UVHA 1BWSA 3MTJA 4QOEA 2CW5A 3ENZA 2X9QA 3IDZA 5AOCA 3VJLA 2YJTD 2PT6A 3NV7A 3WKDA 1X8KA 2W6ID 4LJ8A 4FI3F 1IY9A 2NUTB 5L7TA 2HR1A 1JLSA 1DNPA 3TQHA 2AMJA 5CVCA 4QXPA 1WDLA 2FGKA 4JGBA 3RB8A 3A9WA 4D9BA 1EWYA 3ESZA 2C4MA 3X2FA 5WRFA 3FHTA 4XI9A 1WDMA 3WLSA 3RIGA 1L4EA 1V1MA 4GOXA 3RUHA 3BDVA 1DIBA 5HM6A 3IAFA 1Y4SA 1KJIA 3IMEA 1S5PA 3COPA 4K28A 3UCFA 4NXMB 1XR3A 1ZIYA 3INRA 1XU9A 5ALTA 4RXTA 3DFUA 3F5DA 4K0KC 2PUTA 3SSAA 3W6NA 4BFWA 5TB5A 4JUIA 4E6PA 4KWCA 3GPLA 1N92A 1CHDA 2A9PA 5IM4A 2R4UA 4C0KA 2QVGA 3RJMA 1OX5A 2Q3HA 3C1UA 4KE7A 2Y9MB 3I5MA 1JDUA 4M9CA 3VTAA 4F3YA 4NCXA 4QX6A 3W9BA 1SWWA 1P2UA 2G9ZA 2ZI6A 3BVPA 3P96A 4LMAA 4QNNA 2VSNA 4D0NA 5CDYA 1FYEA 2P20A 4JKYA 3BAZA 1TO2E 3VKGA 1ISMA 4A5SA 4JR2A 2Q2VA 3BCRA 5DBIA 5JBQA 1SBQA 4P4TA 4H6XA 1WE2A 4ZVSA 3D6MA 3QYFA 1WU8A 1FP7A 2JA2A 1JAHA 2V7QA 3BK2A 4MV3A 3MTQA 5JSZB 1FSPA 1KYZA 1EUDA 2GPJA 3IPCA 1ZM4A 5I45A 5LMUB 4PZZA 1QTIA 1NM5A 2FWIA 3UC9A 5CP8A 1F3OA 3TFWA 2UYGA 3SK0A 2QN6A 2Q1SA 3DOHA 1Y3DE 2QMOA 3B6IA 4MINA 4MUEA 4PINA 2P5YA 3PPYA 4LRXA 3ELBA 5HS6A 1FLAA 4HWKA 4XQ9A 4IHAA 2BY4A 3RTCA 1BWQA 1NTOA 3W5JA 1R6AA 2YV2A 3JYHA 1SUEA 4ZICA 2XB4A 5CX4A 3ZXXA 1NJ8A 2OGUA 3Q3JB 4S1NA 3WFIA 5DGHA 5AVRA 3R0JA 4EBBA 4C7OB 2VJYA 1H9AA 3NM4A 3R0ZA 4E2XA 2GO1A 1KI3A 3EF0A 2YZ7A 1JS1X 1SZCA 1MJFA 1VB5A 2YOHA 3L0ZA 2AYXA 3V8MA 3V8NA 4AYXA 5D8DA 1VFPA 3WHLA 4Z99A 4LSGA 4ASUA 3GT4A 1GSOA 2EKDA 4FHCA 3ZE2B 5DM60 3DLAA 5C4IA 3OCWA 3AEQB 5H7XA 2PLFA 1NR1A 2Q29A 3S0JA 3DD5A 1SK8A 1RHRA 4QLAA 2MM9A 2QTWB 2B1IA 4LBWA 4ZQFA 1E1YA 4TLCA 4ZVPA 5L3RA 3C70A 2NU8B 1E3WB 1QIIA 3KAJA 4KI7A 1AA6A 1ZK0A 2XH8A 1PUIA 3K9QO 1H42A 2AJBA 2VWPA 1OYYA 2R8RA 2Z58A 2Z8YM 4DB4A 3QE2A 3PNSA 3ROKA 1QU2A 3R4CA 1RI2A 3U09A 1QVAA 3NOOA 3V8QA 1DO8A 4YXWD 4M8NE 4X00A 1U0FA 3TD9A 2A3NA 3W4JA 4GOND 3HB0A 1WD7A 1O6CA 1T4GA 4AQ7A 1FJXA 4LIPD 1KFCB 1CX9B 1S7GA 3JD0A 5C8YB 3SHWA 1QO0A 1THZA 1W6RA 3RSLA 3RVNA 5AFSA 4CCWA 3QW4B 4HNUA 4G01B 2ZKLA 3A7DA 3B6KA 1MGOA 4Q3CA 4MGHA 3ZXIA 5JCXA 2DHMA 1WMFA 1YBMA 2FFJA 2QJTA 1CUVA 3CJQA 3FZQA 5ENDA 1MN6A 4PC6A 3MWGA 3RHFA 3UMJA 3KQHA 2H9IA 4BTVA 3RW9A 1N32B 5PNTA 2JS7A 3PUIA 1IUKA 3BL8A 1EP9A 1U5CA 5CDSA 1MHPA 1PGPA 2VRCA 2ZIXB 2DC1A 3FWNA 3LDFA 4R9SA 1CS0B 1M1YB 2I03A 5E38A 1J23A 1JKJA 3U4DA 3VO8A 4A0HA 2HMSA 1JA1A 1P31A 3NO4A 1P3DA 1QWSA 3NQ41 2LPMA 4FUQA 2ZPTX 4LXXA 1KIMA 5HMMA 2PEZA 3EVZA 3KWMA 4BEBA 1XD9A 3V7UA 1BVUA 4F12A 4DV2C 2DJ5A 2CNNA 3KTAB 3DTTA 3UFXA 1L5QA 2I4RA 3B3AA 4BNXA 3P2JA 5AM4A 4D43A 4EPXA 1MEJA 2IS1A 1H8EA 4B3MB 4FOOA 3OE5A 4CEJB 3DWIA 4JLAA 3K8ZA 4INAA 3QA3E 4KBGA 3EVTA 2L18A 4IDPA 3QEKA 4X0EA 1UKBA 3QPVA 4WZBB 1HSZA 3Q3HA 2JFNA 3DTVB 3ND8A 5IS2A 1AQIA 2DULA 2P11A 3C16C 3L1VA 1J8MF 2HPHA 4LXYA 4UE2A 1UKVY 5A4KA 1M6HA 2WE7A 3LX6A 3O8QB 5AKHA 1Q16A 2XCQA 3RT9A 5CLQA 2YQZA 1T34A 1H1TA 1UBSB 3WMEA 4O59O 5C1OA 4AJIA 4MVJM 1LPNA 3NM5A 2O7SA 4OAOA 1KYTA 1XPOA 2AFVA 4U0KA 5K0JA 3GA5A 4CJXA 1GL6A 2J45A 4YV0A 1XCOA 3VZPA 4FZJA 3UBTA 2KYRA 4GX0A 5JYEA 4EMTA 4Q4AA 2JCVA 3PCRB 1XHEA 2GA8A 3WZ2A 1AK2A 2JJ1D 4MW5A 3MWFA 4ZT5A 5TE9A 1DDOA 4EPVA 1WVGA 3IDOA 4TSFD 4ZYZA 4LV5B 2GS9A 1PJTA 4NCNA 4ZDKA 1X7XB 5DX8A 2FZVA 2EGUA 2NCLA 2QTZA 2ZVPX 2EFGA 1KYYA 4QXAA 1C30A 2QE6A 2PLNA 2IUYA 4EBFA 3RAFC 2F8TA 2XGMA 3ER6A 3L5OA 4V02A 1LA2A 4HNAB 1RTTA 3FA2A 4FGSA 2ID8A 4I36A 2E0IA 3K4HA 3MCUA 4JX9A 5AHOA 1GDTA 1O77A 2QLFA 4BB9A 1IJBA 1FXWF 3L7YA 1PJZA 4GUDA 1XD8A 4BE7B 3FMPB 4Z8YA 1RXCA 3HFRA 2DY1A 1EGQA 3CQ9A 4XUDA 1WNTA 3DMGA 1NN3A 4R9RA 2A35A 1XV5A 1THTA 3P9QA 3SHQA 1M9NA 4G5OA 1GTJ1 4H16A 4KRYA 3KZXA 3T7DA 3BMQA 1ZVJA 4IIBA 4BVLA 3JWEA 4FS3A 1NQOA 1AGRA 2FMUA 2MMCA 2ODAA 2QJWA 4ITUA 2BI7A 3LUCA 1OE0A 2I67A 3N2NA 4NX2A 4EATA 1SULA 5K8JB 1OIWA 1E6UA 1YDHA 3UTDA 2H3EA 2QLMA 2FWRA 2CFIA 4FXOA 1LV8A 1P0FA 3IIJA 4L15A 4LVUA 4AN4A 3OPYA 1PGOA 1WETA 3UMCA 4PY2A 4YRDA 1CS0A 1FFHA 2NQTA 2V0CA 1PWEA 1VYHA 1NVAA 4OFBA 1E5LA 1VSQA 3H8SA 5AXBA 5J4HA 3DHNA 1XL0A 4EKDA 1B1AA 1F14A 2MSEB 4RCVA 1ULUA 2DUUA 2ZJ1A 3EDCA 1U3DA 1SD1A 4J1NA 4KIJA 3INTA 4XYGA 4DWVA 1ZC3A 2REBA 4KN5A 1Z75A 4DV6C 1WH9A 1V43A 3GRCA 3NDJA 3JTMA 3M70A 5EGNA 5KAPA 5A4DA 2YZKA 5A62A 5JRHA 3WICA 1UQUA 2QJFA 3LY7A 4KGVA 5KSZA 4R7TA 3H1GA 2PTGA 3OP1A 4PX5A 4XB2A 2CVHA 3TL6A 1DTEA 1RR6A 2CZCA 2NPOA 3R8XA 3TR5A 1OLXA 1V48A 3STWA 4JP2A 5TMDA 2RHJA 3OFSA 1R7RA 2D5IA 4CLDA 1SC3A 1EJ2A 3DEHA 4C5BA 4LRYA 1W87A 2P77A 5C18A 4LFBC 2VOJA 4LC1A 1JAXA 1E66A 4J6FA 3GNLA 3IA7A 2JGMA 3QE3A 1KVTA 1P73A 4QUAA 2R44A 5DCUA 1UXHA 2EU8A 3L77A 2P3QA 1HEUA 1P7YA 2XMZA 4NENA 1OC2A 4QQKA 1IHXA 3QLEA 4L8YA 3LHDA 1SHLA 1T10A 1UBHS 1NUPA 1KZYC 1SRQA 1F1BA 1NNLA 1R8XA 3BKXA 4O63O 1POWA 1SQGA 2OLEA 2AUNA 2ROQA 3JATA 4K9SA 4Q3OA 3WIDA 3D5QA 1T36A 4L78A 4CCAA 4Q7LA 1X77A 1CUEA 2NV6A 4Q66C 2ZBVA 4CKCA 2OCAA 1T5OA 4QUDA 4NBSA 2BCGY 4WZAE 3C3XA 2UDPA 4CM4B 4EGCB 1GRNA 3K9GA 2ZSIA 3NDRA 2ZUBA 4M38A 5HXAA 3OETA 3HM2A 5A9SB 3OQNA 3VKUA 4FINA 3I28A 4RXMA 3VYUB 1WUYA 1Z5UA 3H05A 4LGMA 3A1NA 2UZ1A 2EZUA 3O8QA 3SIXA 4C7MA 3DE6X 3FZEA 2B37A 4RY2A 4QASA 5AI4A 3RBAA 4ES6A 4FFVA 5BN4A 3I39X 2AQKA 4Q02A 3WK7A 4CDGA 3TTSA 4ON9A 1JBEA 3KT0A 3THSA 2EEZA 2P62A 3PNPA 2D2EA 1PZGA 3EG5A 4TL8A 1M7HA 3N2GA 4GL2A 3WBJA 1UOQA 1PL0A 3SYKA 1Q7BA 2GEKA 2PX6A 2I3ZA 1OCEA 3GB9A 4D4KA 3U61B 4RK0A 3PJRA 4ETMA 1Z74A 3K70B 3EAFA 4X1IB 1XNRC 1Y63A 4Y2GA 1NXVA 4LE5A 1YHNA 3WL7A 4H59A 1YQDA 3W1EA 4M7WA 2E8CA 4MYTA 1XUOA 2I76A 3ONFA 4LE0A 5IZ4A 2F8SA 1JDBC 3OIDA 4N0DA 3NYRA 3RTAA 4B17A 1OF1A 1XQXA 2H7VA 3MCZA 1AV7A 3PYLA 1S3FA 2VSQA 1KKMA 1EJ6A 1PS0A 4QELA 4CR8A 4Z4FA 4UCXA 1PZXA 1VDZA 4UEWA 3TQCA 1JA9A 4UEOA 4EYEA 1NXOA 1UANA 2QJOA 4IVNA 2XQKA 5LUAA 4LOLA 5F51A 3W2IA 1M2FA 4UVGA 1W47A 2J5XA 1HKHA 2XQIA 2Q6OA 3M49A 3E27A 2Z8XA 3UK7A 4MVJD 4EJ2A 2BVNA 2SCUB 1C0PA 4CQMB 3SBEA 4IG4A 4YX9A 2R751 1KK2A 1MX1A 3PPIA 4L9SA 3B3JA 4IIJA 3V6LA 3WBFA 4G9GA 4HWTA 1OZFA 1Q57A 3D3WA 3LQFA 4JP3A 4ZO9A 4OX9B 4WZBA 2AOVA 5DOVA 4OLHA 5EKUA 4O0LA 5JYCA 5KIAA 4W5TA 2Q4RA 5KTYA 3LF2A 1YA6A 4XJSA 1YK1A 2BZSA 3C3JA 1Q11A 5J2TA 4ITRC 4PHGA 1HR0B 2KW5A 1F38A 5LP6F 5MFZA 3BL5A 1N7GA 5BSFA 1UK7A 4W5WA 5FOVA 1EXDA 4IMJB 4BKRA 4ZZ1A 5DHTA 2GZRA 2E89A 4TT3D 2XITA 5G4LA 1U0NA 3Q87B 4YRIA 4EI7A 1PI3A 2CUTA 3SAJA 5L6LB 1N0HA 5JO0A 3EGXB 1ZUHA 4GI2A 3DXXA 4QYMA 1GGJA 1P7VA 4TS3A 4WCDA 1H4VB 1YZLA 2G67A 1QK3A 2ZP1A 4IUYA 4BL5A 4DGSA 4MUAA 1E2MA 5C5EA 4FP9A 1PR5A 4DJ5X 1XN1A 4OM8A 3RVKA 4JNCA 4JC5A 3U7FB 4FX5A 3T15A 1WPXA 2NLOA 1OLXB 1MXBA 4R68A 2RCNA 5DNWA 1J5PA 3NGMA 4K6OA 4K9KA 2W6QA 4IEEA 3OP4A 2LE0A 3N2EA 4L74A 4RADA 4Q7QA 4BRUA 1LDMA 1JAIA 1QVVA 2FSHA 3D0QA 1GAXA 1QCCA 4QC2A 4TROA 1A2OA 2QD5A 1MO4A 1K3UB 2R5NA 4LI0A 4QTYA 1JLLB 3M0EA 3OESA 3EARA 4NNOA 2PX2A 4JI4B 2P4SA 4NWIA 2I80A 2RJ3A 5SZHB 2PL3A 4EUNA 3UAGA 1PBNA 5ERGB 3BREA 2HMVA 2QMUA 3BA1A 3LDGA 5HGJA 3ZDDA 1YULA 1LC3A 3H1FA 3OZ7A 2FSIA 5LP6B 4E70A 2FOLA 3JATB 4IYRA 4RM3A 4LJAA 1W19A 1KYIA 1M74A 3VR5D 1F8YA 2BBWA 4CLXA 3AFMA 3TTWA 4AQDA 3M9LA 2XB6A 4C4RA 4YRAA 1SOVA 5BT8A 4O3MA 5ALYA 2PQ2A 5CEJA 1U31A 1RC1A 1RIIA 1Y4UA 4IWYA 2CHFA 1NR5A 4FFMA 1PT9A 2X7HA 4Y1FA 3PITA 4KZKA 1AUPA 2HZ7A 2ZVJA 1P74A 1HZZA 5JCOC 2Q5LA 5AE3A 4I9HA 5EY5B 3WV4A 1QIKA 5FAKA 5HSGA 4RTMA 1IAQA 2EGTA 3PNOA 3NLLA 4D74A 2VP6A 3FGNA 4BJ6A 4XJXA 1N34C 1CZNA 4S1WA 3EWNA 4R69A 1QH8B 3CKMA 1L5RA 5JCZA 1YA8A 2NVUA 3P1JA 3LA6A 1PT6A 3O4GA 2B7LA 3EXIB 4OGKA 4WLFA 4YO8A 3U37A 5EI5A 4JYAB 821PA 1M2NA 1P2SA 3STTA 4DQXA 2H7CA 5T3YA 1Z82A 2BZ0A 3JQ8B 5CK4A 3NTRA 4EA9A 5KYYB 1E5XA 4KWEA 1NQTA 3RYFA 1H5UA 1QNLA 1TTHA 1W34A 2HGZA 3HBJA 1FFYA 2HV9A 3GLRA 3F3YA 4C22A 5JXWA 1C80A 1KOJA 1I7PA 4ME6A 4RIFA 5T4HA 1AOXA 5AVYA 2C1XA 1IVYA 2V4UA 2YBDA 3PQEA 3TFQA 2IOYA 4UU0A 6ABPA 3R5KA 4AQYC 1YNOA 1NMSA 3OM1A 2NACA 2PKQP 4DR7B 1P2DA 2P3LA 1V45E 1WMSA 3E5MA 4BUCA 1JH8A 3W5CA 2XWQA 3N2YA 2CLDX 1ML4A 3HEAA 4NENB 2B61A 2FUNB 2O2HA 3MS4A 1P2GA 4X62C 1HYEA 1MO6A 2Q4TA 1YBAA 4MVYA 4TVBA 1LI5A 3CCBA 2ZI5A 5EJFA 3TUIC 4XUCA 2QPLA 1B8NA 1RT9A 1RXEA 1AGNA 4C2AA 4JXZA 2JI9A 4OP3A 4OQMA 4BZZA 4AMYA 2PS0A 5JD4A 4HPWA 2IRWA 3KSZO 5B3JA 3U4HA 4LF9B 3K5WA 4U5YD 2PGLA 2PJZA 4FMDF 3E8SA 1A04A 3I04A 2EW8A 3H2BA 1YRHA 4F9TA 4ID3A 5E2AA 1SA0B 4NOMA 3UQZA 5GJCA 1NLFA 4UHEA 4OQFA 3MG9A 4JR0A 2FSVA 1Z36A 4L0QA 3AHFA 1LS1A 3WXBA 1XRCA 3MJCA 1QORA 3CQ1A 1C3EA 5ELLA 1OWLA 4EY6A 2IOQA 1UWLA 1U63A 4FN4A 1NVTA 4X84A 1GCIA 5AP9A 3UFXB 4BLTA 4OPMA 1KEPA 4IO0A 1H6CA 2DHEA 2VPZA 4P3KA 1J0BA 2GYYA 1ACJA 1DBRA 1SZJG 3A3OA 3GRUA 1KJWA 1JR3E 3GJTA 3IV6A 1NJGA 5F7ZA 4ZYXA 4HUQB 4X95A 1BNCA 2IV3A 4MW9A 3IB3A 3KJQA 2XB2A 1IIRA 3QVLA 4U7GA 5L95A 2F00A 2VKQA 5ADVA 1UZNA 2ECKA 4V2IA 5EWJB 3ZHOA 3L1UA 2V98A 3FHJA 4FIZA 3FB1A 4PZDA 2G76A 3RM3A 3HFGA 3RODA 1PCXA 4Z4EA 3M4NA 1RCUA 3H1BA 2WMDA 3PHGA 1TK9A 3D7KA 3ADPA 2G70A 2P2LA 4D6PA 1NSYA 4ZYYA 3HUUA 4IRMA 1M6NA 1G59A 2JAWA 3EUAA 1TO1E 4HB2A 4CTKA 1U8ZA 4LDPA 5K99A 3F7NA 1NW3A 3ASZA 3MQFA 3OO0A 5DNVA 4YRFA 4YR9A 1JQBA 3FCXA 5EPOA 2YQ5A 4BWVA 1NUAA 3ETEA 1SKMA 1RKBA 4KQ9A 4EH1A 1FU7A 3F90A 3T34A 1JPVA 4PZPA 4H1UA 2BCEA 5T41A 2NXJA 1FYXA 5M5BA 2E7GA 4G8BA 4Y2TA 3FDIA 1PFWA 3ADKA 3LUJA 3MZ0A 5TJHA 4YJ3B 4BO9A 4K3UA 1Z47A 3A8TA 4FFRA 1II8A 1W4CA 2QSZA 4PZ9A 1TTTA 2XVZA 1HMYA 4H6WA 4CFSA 3TGLA 4YECA 2G0TA 1SHJA 2IW3A 1K8QA 1E3JA 2NZJA 2E82A 4IS2A 1AKNA 5DVZA 2A67A 1C9EA 3I5XA 1IB0A 2HFJA 3F2IA 2AC4A 1H69A 4RK5A 3RC3A 1M1YE 1WCIA 4Q7KA 4ZD6A 2RH5A 1XLTC 2Z5GA 3E15A 1R00A 3GEHA 4HQKA 5I5GA 2ZETA 1Y33E 3JQAB 3UMSA 2JD2A 1NFFA 3AVQA 4YDSA 5ES3A 3WNBA 3B82A 4DLLA 5IH7A 5EKXA 4S0ZA 2EBUA 1H3NA 4LYFA 5D6NA 1BOOA 1Q5PA 2BMAA 4DL9A 1WKVA 4G4SO 5EIHA 3HCNA 2L82A 4U5QA 1EVQA 2D3WA 3B3QA 4W1QA 2VJLA 2FSGA 3RVJA 2PYZA 3RARA 5CA1A 2GBPA 1C0IA 4K6HA 4MWDA 1BQ4A 3GNSA 3KFVA 4Q9IA 2DLDA 4XQ0A 5K8CA 4OMCA 4IDOA 4RMNA 4NK5A 4QBGB 3EXG1 1Y8RA 3N8GA 2PY6A 1ODJA 1YZTA 3OQIA 3Q4GA 4H17A 4NABA 1BRMA 3C8DA 4TKMA 4KO4S 2JK0A 2QIOA 4EHBA 4UEQA 4KWTA 4PLFA 1NVBA 3MINB 2JGNA 4Z1OA 1E8MA 1R6XA 3GPIA 3PUXA 4I5IA 2NNLD 3T4PA 4F2DA 1EFDN 2CMHA 2YWXA 4ND2A 4PO8A 1D1TA 4NSNA 1JSZA 1AG9A 4I1IA 3VR3D 1EDBA 1FYVA 3FROA 4NARA 5I7RA 4DKXA 1E98A 1G60A 2HHCA 2PH3A 4NVRA 4AJJA 3RVRA 3PS9A 4ZJZA 4YY3C 4KE6A 4J0GA 1U8UA 3QNUA 4NOLA 3HPQA 3KDAA 3TLBA 4YCMA 3A4NA 1D9XA 3D8BA 4U7DA 3QVJA 1JIQA 4RKRA 5IAOA 2QTNA 2Q5IA 3DL2A 3U6KA 2V4ZA 5D3ZA 1PZNA 3FVRA 2IF0A 3PD0A 1U80A 1DT5A 3BWVA 5G3ZA 4EHLA 1H66A 3E5HA 1GAQA 1QNFA 3GFGA 5EUBA 1A72A 3WRWA 3E3MA 2XNDD 2IHBA 2TYSB 4QPNA 3RNOA 3LQYA 1N2IA 3OKAA 1YZGA 1ZH0A 3EVDA 2QUIA 3H5RA 2JCGA 1ZDMA 4KH1A 4Q1VA 5EQJB 3PRJA 2YHBA 1DAKA 3L93A 3ICQB 3PUVA 1CR4A 2JKVA 2WQZA 4HDNA 3WI7A 1LNQA 2RAPA 4G85A 2M5OA 2PX5A 4AT1A 2XQFA 1W59A 2O4UX 1NRWA 1BMQA 4Q16A 2TMDA 4JUCA 1CVRA 1BGWA 2HSEA 3C7TA 4ISCA 4UJ5A 5KC9A 1CEYA 1VYUA 4IILA 1P9WA 3AG5A 2X5JO 3PQ5A 4BLUA 5CH5A 7MDHA 3I1IA 2ZR7A 4WLOA 5DXAA 5FPHA 2P9BA 4JLDA 2VDUE 2WJHA 3FWKA 1ZHHA 3X3HA 4JP5A 4JY7A 4H7JA 1SY7A 1JDBB 2O06A 4HUQA 2O8DB 4O4IB 2NWQA 2X5NA 3V3KA 2NO9A 1IEVA 1RADA 2E49A 3UC5A 3FTDA 4NATA 4TLAA 2UZ1B 3VU3A 4BJ3A 4DF3A 5MGNA 3PVSA 1W46A 2AN1A 3PHIA 1RI3A 4EHNA 4EKGA 4MRMB 1K7EB 1JHMA 5IT5A 3MRTA 1YJCA 2R87A 5FHRA 2PUJA 3ZK9A 5JH7B 4HPVA 1KBQA 1W8IA 2EJBA 1RXVA 1BE8A 1TVKA 5C5DA 4DG5A 4DM3A 5KNBA 1Z2DA 3I3OA 1XA4A 3KZMA 1QYXA 3U16A 5JT1A 2W2LD 2WJ4A 2WSMA 1J97A 2V55B 3NG1A 4OJNA 5A03A 2HREA 1G64A 2XZTA 3C4QA 1T15A 4ZCQA 3SHTA 1RWMA 4XCQA 3VO1A 1BSVA 4MUNA 4CLRA 1OXUA 5JXJA 4LMBA 1N3BA 1QVWA 2HIAA 4V3BA 3KT8A 3FCEA 4GMXA 5BQXA 1CQWA 1VB3A 4M55A 1R0KA 1K6JA 2X7XA 3AFNA 4YAOA 4FEAA 4P6VF 4QPZA 4E22A 4DE5A 4B6GA 3KPYA 1NNUA 4ESVA 5SV2A 3L7DA 2JLXA 1SCNE 1Z35A 2R3SA 5KJ6A 4F38A 3LK6A 3TX6A 2OOKA 3WMRA 1II8B 5KQPA 2QTCA 5HRCA 2YMMA 5J5AA 1RYBA 4EO4A 2EEPA 3UK6A 3N0WA 2NAPA 2Q1WA 1S4QA 3AVPA 4QYSA 4RGVA 1J9GA 4WNAB 5T4BA 3ZBTA 1TQ2A 4JBYA 3PEYA 4TMVA 5CGQB 2Z56A 2W37A 3GR6A 4G5FA 1JAYA 4TXMA 3WMWA 1C0EA 3RYHB 1DL5A 4I3FA 2GM4A 1UOOA 3TCNA 5HUHA 3QWAA 4XVCA 2HA6A 3C8UA 4PSKA 1AZLA 1PBTA 2YWFA 3HYRA 3JX9A 4L0CA 1KI7A 5CG2A 1DELA 1LQUA 2FA9A 4RU1A 5BV7A 4DQLA 3QBTA 1OI4A 4QRDA 1I14A 2XUHA 3TOVA 4E1VA 4V1CA 2BGWA 1O57A 1NFQA 2GD6A 1JQAA 3VZCA 5I7VA 3R6DA 1EZ1A 2R7MA 1AKYA 2ZBGA 1CSEE 4J16A 1SQSA 4AJ2A 3COZA 1NASA 1XZPA 2Q6TA 2VSOA 1GN8A 3M6WA 3T35A 2CLMB 3M2TA 4MQEB 1RFLA 3QWIA 5AK5A 3IPLA 1CY8A 4R1SA 4YI3A 3VC1A 3UT6A 3K5HA 4HS9A 2HF7A 2YQ4A 1X3LA 2HSJA 4EB3A 4DMGA 4QG3A 4LJ6A 4YAEA 5L6MB 1NVDA 2PBRA 2Q99A 3VM6A 3FDJA 5KNCA 1L9KA 2KPOA 4MVJH 1T1GA 2CV2A 4IDNA 2C82A 2Q0HA 2EWWA 1SCKA 4F4IA 5D3MA 4RMGA 3SN6A 4NJEB 4OHMA 3UHOA 2HLPA 1QYCA 3MPUA 2MINA 3FKQA 1PFVA 2YJ3A 4JT9A 1K7YA 3MGAA 5DT2A 3RIHA 3VR5A 2XRZA 2IY9A 4UMDA 1AF7A 1JFFB 1T2NA 5DBGA 1M66A 2OFFA 3VZBA 4CQJA 1GPKA 2Q07A 4HLCA 4JP8A 5IF9A 1J20A 1E7SA 1Z63A 3FHCB 3RANA 3UWOA 1YE8A 4Q4JB 4RETA 1XEXB 4JI4C 2DBQA 2WU3A 1EFRD 3QTBA 1M2OB 1QWOA 4V1CI 5DYNA 4D96A 4YPVA 4RNCA 3SI7A 1PSZA 4L3VA 2X15A 2GEVA 1B2RA 3Q2KA 4YXFA 4Z4CA 5CA1F 5KTSA 4II3A 3KYDA 1QB8A 1OU0A 2HW8A 2YOGA 2FKAA 3DMFA 3IKVA 3N87A 3QG5A 2CLIB 3DOOA 4JITA 3RYIA 2XBUA 4NE9A 2XA1A 3R7WA 4M46A 1FJHA 4BV8A 1NX6A 1M1NB 1RWOA 5EHGA 4PTLA 2JG3A 4P2GA 2JAPA 3ZQ6A 3UMMA 3S28A 1PWHA 2ZSJA 3QX7A 1D6JA 1F0YA 3ABRB 4M2LA 4DLRA 5JFGA 1O9TA 4U3JA 1G7SA 3BTUA 1IOWA 2WU0A 3HP1A 2JNVA 1IBKB 3W90A 3GGDA 2ZXFA 1BCSB 2O52A 3CVJA 3TBFA 4WOJA 5AXDA 4ZC1A 1EHIA 1ZOPA 4XR9A 2XWSA 2PFSA 4Y6SA 3EBLA 2G28A 4UXJA 2GAJA 5FUWA 1L7XA 4B3JA 2UUCC 1C3XA 2DPGA 1JHRA 3RTBA 2C2MA 1W85B 3CX4A 4HRVA 1T6YA 2Z2ZA 2DPMA 1M33A 3NVAA 1P7ZA 5T5QA 4CN9A 4LYYA 4JENA 1J49A 1TJ5A 4OKSA 4CR7A 3AMVA 4Q34A 4U9HS 4M9SA 2A5FA 5A5VA 5JIBA 4YHHC 4LJ5A 5I8ZA 1UWKA 1P62B 2IYQA 3SJBA 1ZSYA 1HDCA 4NZYA 5CA0F 2JLQA 4L76A 3HBAA 4ZGBA 5INTA 1SG0A 4LMRA 1K88A 2XOKD 5AKIA 1QTQA 3PENA 2W2XA 3WDLA 1E59A 1ZR2A 1ONSA 1QIMA 4NH4A 3TNLA 1DTWB 5FYDA 4UQPA 3OCYA 3DFZA 3CCFA 2X8WA 1W6UA 4IYJA 3UJ3X 1WKBA 4Q1EA 3CLUD 2Y6UA 1UJNA 3HACA 2WF6A 1ZOSA 1SELA 2HGSA 1T9BA 2EW2A 2GYWA 3E7FA 3HRHA 4KR9A 4Q4JA 3PX3A 4NJOA 5JO9A 1XEFA 1TH5A 3V46A 4JI2B 1C1XA 1E2UA 1F9EA 3ZWKA 2VF5X 1U8FO 2AV6A 3K20A 3W5VA 5GQSA 3PNLA 3RGWS 4BIIA 1JL3A 1IJKA 3N74A 4FNMA 1JGTA 3GEEA 2O3JA 3U3JA 4I50F 3G1TA 1YAHA 3GFRA 3I6MA 1DE0A 3IMGA 2OPLB 2QG4A 1F60A 3QNMA 3QPDA 4X9XA 1JMVA 4LHXA 2GHRA 4QT0A 4ZU1X 4TN1A 5I51A 2ZZMA 2FXVA 1Z83A 4ZEWA 1TCCA 1GIAA 2WHEA 4H4DA 1B1CA 1EPUA 2DGDA 3KVRA 1SJ9A 1P1IA 4NMXB 4LF7C 1FP6A 3T1QA 8MHTA 5FTJA 3CWZA 4KXYA 3N54B 2IUEA 2FZ5A 3NVDA 1I80A 2P5SA 3OPMA 1G21E 3PJFA 3F5MA 4D98A 3DULA 2C1EA 3F3KA 4MP3A 5FLYA 3SSMA 5AIBA 5C8DA 2COKA 3ZJVA 1P17A 2YC4C 4QAJA 1PKXA 3H4MA 1V0JA 4US0R 2ID4A 4FFOA 3TIGA 4Y0AA 4OXIA 1G7TA 3DT9A 3PNQA 1CVLA 1ZH2A 1ATZA 1S3GA 5EWJA 1XSEA 4AMVA 1BEUB 1M73E 3VU0A 5LOVB 3VSCA 4OBBA 1EB8A 4I5FA 1GRVA 5TLSA 1J0AA 1EK0A 2KHZA 4HEJA 4X93A 3OZTA 4RMJA 4YMLA 1JTEA 1PHRA 2AJTA 4PAOA 2BUCA 3IKJA 4X8OA 1XXHE 3ABQB 2FE1A 1W85A 3R75A 4NXNB 2FFAA 1DAPA 2R4QA 3O31A 1DQZA 3GA7A 3EBPA 1OBFO 1Z8NA 4WWHA 2C61A 4DMFA 3DHYA 1IN5A 2D13A 1I5EA 3EPJA 4WBNB 2YFQA 1Z12A 3WWDA 3QQPA 3KZNA 3AEUA 1U7DA 3SXJA 3IDFA 2DPLA 4GKKC 3T7JA 3ZV3A 5KYKA 1DKPA 3A1EA 1E2NA 2HWXA 3BMOA 1W2HA 2MHCA 1TYZA 1Y9ZA 1N57A 3WKCA 4RKQA 5EMHA 3K0CA 3LW7A 1JAZA 4FCVA 4PSCA 2OLJA 1X19A 3AI2A 3BF8A 1GKUB 1X1DA 2CJXA 2ORIA 1MB4A 2ANCA 4I55B 3UWSA 2RGNA 5I47A 4OEHA 5K85A 4LSMA 3V4LA 2C57A 3OFKA 3GLFE 1FZTA 1ORVA 3N28A 3PIIA 2JZNA 3JRXA 5JOQA 2ZT7A 1P7LA 4JWKA 4UBMA 3CIFA 2EXXA 4J1SA 1GFSA 3DP9A 1Y8QA 3T52A 2VT6A 4ZHSA 3L92A 4XUGB 1SVUA 2G17A 5L3QA 3Q0IA 1TMOA 1BTOA 1MVOA 1QKKA 2QAIA 3A1VA 5FUXA 3F71A 1U9CA 5REQB 3NIBA 3WRXA 2UXCC 2B94A 3N7AA 1NDQA 3GELA 5B3AA 5HRAA 1LXCA 2ZYVX 3AETA 3PUWA 1HA3A 1KAMA 3CTPA 4MO9A 2W9XA 5JEEA 1V71A 4OX9Y 3ZE6A 4AK9A 4ZV9A 3HRKA 1KQFA 1YF3A 5HKLA 3PE6A 3DYIA 4I2NA 3ND9A 3OY2A 1U3CA 4PX2A 4XIFA 2ZANA 5D3MB 2YX1A 4D9FA 2EIHA 2NZYA 4URXR 1Y1PA 2IZZA 2OVBA 2Q6KA 3HYLA 5IM5A 3CUTA 4L2IA 4C4TA 4DYHA 1YZNA 4GR9A 3KO8A 5FNVB 3RIYA 5H3HA 1HZZC 1P18A 5JCOA 1QG6A 3ROGA 1GO2A 1R9MA 2IZOA 2TSYB 3WLHA 3THWA 3CY6A 4KYUA 5T4FA 2B7CA 3PFCA 4LOIA 2DQZA 4KXVA 4MVJP 3Q7IA 4NDNE 4TTTS 2OXRA 2OCIA 3VR6A 1QAOA 5FDFA 3F1LA 1U6IA 2JCBA 4FN5A 3GWGA 1RKQA 2W6PA 3A4IA 4DV5C 3L7MA 4HH4A 4MWEA 5FFMA 5KQGA 3P2EA 2XVAA 3CF4A 3RS4A 1KQGA 2PAAA 1QXSA 3NFYA 3M3PA 4I7EA 1G20A 4MKZA 4KK3A 3VISA 1ODLA 4AIIA 4DLKA 3H99A 3DDWA 4KNYA 1L5ZA 1YSCA 2JFZA 5LZ5A 3R7WB 4LMPA 2AI1A 4P54A 4QYTA 4RCYA 4UHHA 3FWYA 3WYGA 1HXHA 1S01A 1YB7A 4MV0A 3WGKA 3WGVA 4EDFA 1EM8B 2ERCA 4UBIA 1ZH6A 2CLLB 4M0MA 4QDZA 4X3PA 2HT6A 2YJ4A 3PFNA 4QGGA 1I94C 4CQLA 5MN5A 5CR9A 3R5FA 3OF2A 2ZJAA 4L73A 4Y7DA 4HAVA 1YBHA 2OMEA 4B80A 3G85A 2VDWB 2D0OB 1POXA 3CO0S 1TCUA 1JR3D 2OQ2A 4KPFC 1L1FA 6Q21A 1VEHA 4ALNA 3A9VA 1KU0A 3QEBZ 1KVSA 4DV0B 3ZHUA 1ZNZA 1EHCA 3ORHA 1T6BY 1IPHA 1Q3HA 2JLBA 5LVAA 1MPTA 1EFRA 1UC5B 3BCSA 3GCGA 5AI8A 3W2GA 3VGPA 1J4AA 2OGZA 4MVJF 4Y6LA 4D92A 4YUAA 1KTVA 1UWCA 3HCEA 2I1LA 3HPRA 5DP1A 5E8RA 4DIOA 3SXUA 1KY5A 4H0NA 4E2YA 4ANFA 1YB6A 1ID1A 3PK0A 1T9ZA 2LCFA 5T8KC 1Z15A 4LTNA 4LTDA 1DKUA 4MICA 4N3AA 4FGZA 2NU6A 1J99A 2H7XA 3G02A 2ZUDA 4MKXA 1A50B 4KDRA 2BKVA 4DEXA 1Y5MA 2HBYA 3NORA 4W63A 4BX9A 4QZVA 4RTPA 3PQ3A 4B3SB 2YXNA 5AVUA 5EHZA 5ULLA 1F2VA 3OWHA 4M7OA 1EWQA 4PTYA 4U8HA 4EB6B 2QX4A 4EJMA 2ORWA 2IXTA 3LP6A 5D7BA 3JZIA 1FMFA 5K2MA 5IEJA 1I30A 3WJ2A 4XWYA 3O6VA 3VI3B 4FMBB 3WGHA 3G0IA 5AW2A 3X1JA 2J7PA 1T2FA 2FUEA 4I50A 4XA8A 4H7FA 4IQ0A 1JF8A 2AEFA 3RIMA 3RTGA 3UKDA 4HZGA 4NICA 1LJLA 3ZWPA 4DBLE 4B85A 4U39A 5AE1A 4W7IA 5K2OA 2ZBEA 1VBFA 3A06A 5L3VA 1CFZA 4WK2B 1TUIA 1L7MA 1USGA 3NHRA 3RPEA 3TS1A 3T0GA 1RYDA 1FFEA 1E8DA 1ND5A 2CNWD 1RQRA 1VMIA 3LYAA 2PGXA 2VS1A 1I4EB 1RLMA 4UW9A 3MB5A 1RPZA 1F17A 1YI8A 3IP6A 1I7DA 4PICA 2DLNA 2F3QA 1N2XA 3BTSA 2JIBA 1U1GA 4DEYA 1U8EA 1CBUA 3WTCA 4LZPA 1VP3A 1U7PA 2AVDA 3B2QA 2ZFUA 5ICFA 3ZXUB 1CYDA 4BZQA 1H1LA 1C41A 1F2TA 2H7YA 1HBJA 4OYLA 2X19A 4NCKA 2W4QA 3SIRA 3ZGLA 1W0JD 4L8VA 4M9UA 4NBUA 4CIBA 1CG6A 1E61A 2RCYA 5EL0A 1XNQB 3WADA 3OJWA 3SG0A 5LZ9A 3TUZC 1MZVA 5LC1A 2JB9A 3ST7A 3ZS9A 5HIKA 4U7FA 4EGSA 2DYKA 1B0UA 2P5TB 4LYHA 4QRHA 3C5EA 2I55A 4MUIA 3KM0A 1CQZA 1S8NA 5FL7D 1W44A 2OVFA 5JD5A 1BZYA 3WWZA 3BH6A 3VAAA 4EW2A 2WIFA 2OB1A 2B6HA 1VGRA 1XCGB 1IDN1 2G0NA 2WZQA 1LDNA 3DDHA 3I01A 4TTIA 4UFNA 5EE5B 5B7GA 1J9EA 4FMCF 2E48A 2A1TR 4DCSA 4X41A 2IPXA 2QTVA 3GHYA 3I53A 3P0JA 4LBYA 3KKOA 3M6FA 1WCWA 1HL7A 3DGEC 2XOEA 3MHPA 5LD2B 2QL7A 1RRPA 4IFIA 5DYGA 1GXSA 2BWJA 1SHTX 4WXHA 3WDSA 1T5LA 3VKWA 3KHTA 2QD4A 2OZVA 1P5ZB 3LWBA 1Z7EA 1SIOA 2ZWOA 3CLUC 3A58B 3RVMA 3W2FA 4AUKA 3JALA 3LNOA 3D7RA 4J0DA 3VSAA 3U4AA 1S7CA 2W2QA 3B70A 3U13A 1VLAA 3U17A 4TSKA 2OK7A 3BE8A 2DFTA 2PPLA 3UK0A 4JIMA 4BZWA 3GOQA 2ON6A 1NM5C 1RM3A 2VT7A 4P80A 1T2CA 1IN1A 2P9HA 1QSGA 3TI9A 4E30A 1HEYA 4DLNA 2QI9F 5DHSA 1JXQA 3Q2OA 3UT5A 5B2FA 4XDYA 3T4XA 1WM1A 1FUUA 2WJVA 1HDIA 3WTBA 3T0FA 4HKTA 4REMA 1EX7A 4B8YA 2BM0A 5GOTA 5EAIA 4S04A 2VSFA 3LNTA 1J21A 4Z3KA 1EGVB 2OO4A 1LBSA 1YKGA 2WHPA 4QAQA 3U7EB 3HC7A 3RIXA 1N2BA 3AWIA 2HQBA 3LT4A 2BELA 1L5YA 2XEXA 3ONEA 2ZJYA 4QUGA 4X8LA 4KOEC 2MSLA 3RUDA 3SHOA 3TLEA 4PO1A 3U56A 2GZHA 1D1PA 1L7PA 3WLQA 4YREA 3KKMA 3UEOA 3KKEA 4KDCA 4ARIA 1ZIXA 2PE5A 1QZXA 5IW8A 1PSDA 1P5JA 2Q45A 1BJKA 3UY4A 3FYSA 4OHRA 2P6UA 4PFJA 5LR6A 1EUCA 2UZ0A 1KZ9A 1VPDA 2W93A 3PXGA 4CM4A 2OGSA 4GKBA 4X63A 3ZGVA 1NRJB 2SBTA 1QYIA 3EFBA 3STXA 4KQWA 5M04A 1VDMA 3MD0A 1C7JA 5FFNA 4WN9A 4EMSA 4TRJA 2XEDA 1YDMA 3IH5A 2X5KO 3T7SA 3FY4A 3DMTC 1OXBB 2MYTA 5LDGA 1CVIA 2Y99A 1QC5A 1TM5E 3JVIA 2B4KA 4KV7A 4CRWB 3ITNA 1AS3A 2AX4A 1ULBA 2CJYA 2R66A 4FKMA 1YMVA 3D1LA 3RQIA 3SR4A 3U49A 4J03A 3V2IA 4GGOA 1G7RA 2FN4A 3GLSA 2Y3IA 2AW5A 1YK0A 3HNOA 2ZITA 4S1OA 1TTQB 1K3FA 4FWTA 5DMXA 1FQOA 1MTZA 5GM2A 1ABBA 4URZR 4C78A 3LW8A 1UPCA 4GO1A 4KTTE 4TWAA 4ZCTA 3UPTA 1YFZA 3GO4A 3WYFA 2CJWB 3ZCQA 1VL1A 1NXWA 1XEWX 4LJ7A 3OTOB 4X7RA 5IWAC 2VNHA 3K1AA 2FE4A 2FJ0A 3UG6A 3CZ5A 3I1JA 1TI7A 3EW9A 4L22A 4RZHA 2V7PA 3W4IA 4ALLA 4UUPA 4IEFB 1MRNA 1W4LA 4EG0A 3BD8A 1YR7A 3LC0A 4BTLA 1KJ9A 2V6IA 5ALLA 3ZJYA 3H9QA 2IDJA 2B35A 4ZAZA 4MAAA 2QSUA 1V4BA 2NGRA 1U0SY 3ABZA 3ZIAD 4D02A 5FWXA 3EYAA 2Q50A 4OL0A 5K3SA 2PX3A 3E84A 4MKFA 3TZKA 2WSBA 1O90A 2F9MA 3NTUA 2QLLA 1XMIA 4JSRA 4NCIA 1ILWA 5DLDA 4XYMA 1QHXA 4J0QA 5CT5A 3VDMA 3KU4A 1KDRA 3MWDB 4OXXA 2HO5A 5EE0A 4RJTA 3AO0B 4BGDA 1ICIA 4G5YA 4LNHA 3GLIB 1FIUA 3ASVA 3LRXA 1JXOA 2FEAA 4P4NA 5CYFA 2B4YA 1Q1BA 4ZAWA 3UCXA 1Z2EA 2DTXA 3L0BA 3QP9A 3WYBA 4E4TA 1QP0A 1BS9A 4G9BA 1E4EB 1UXKA 4RFSB 2ZPAA 3HFSA 4JYCA 3PXUA 4HZUB 5JI2E 1RC8A 2H0AA 2E5LC 5H9VA 3E3LA 4NZOA 4BKMA 1THGA 4BU0A 4BNKA 3KLNA 1YWGO 2P67A 3SZOA 4BNGA 4DADA 1W36C 4BMOB 1E5VA 5DSZA 2WLSA 1BJTA 1JQJC 1DQYA 3BC1A 4NH0A 2I3BA 4TXJA 1D5WA 1Z5VA 3GRVA 1FSSA 4TT3A 4ZEVA 2PMEA 1JP7A 2IYLD 1CZUA 1UJMA 3G13A 4RMIA 2QD2A 1USPA 4C0BA 4NBRA 5FJIA 1A4RA 1Q6ZA 3V97A 2Y68A 3VDRA 5DM2A 3AG6A 1H2FA 2YWRA 4QU9A 2B36A 4TYQA 3MTEA 5BNFA 1QK4A 3DYBA 5I4KA 4HUTA 2YNMA 1NJ2A 4HVCA 3JD1A 1RHKA 4B7ZA 4ZKDA 1H2ZA 4G0XA 1JEDA 3HV2A 5IVPA 4P7GA 3KVVA 2WYOA 2QV7A 2P41A 1E6CA 1P9RA 4QHYA 3CNBA 3DCJA 1VKNA 3AEXA 4LRTB 2FRDC 2C94A 2ZW9A 3PFIA 2HM7A 5B57C 2X8LA 1P1JA 5CXSA 5AI5A 4YP1A 3JWGA 5JAIA 1CY6A 2A59A 2HSGA 3SDBA 2WI8A 2H4WA 1QIEA 1OLUB 2Q4DA 3I4FA 1ONPA 5BPFA 4IJMA 3U4MA 3JWHA 3NDPA 4PNPA 4E5NA 1E2FA 1U2RA 3SFZA 8OHMA 5J2UA 4FFNA 1T9GS 1UJCA 3IO5A 3OHPA 5F73A 4RQTA 5JNRA 3O84A 4HQFA 3MERA 1ST3A 1FDUA 1NT2A 1V11B 3H9UA 4OSOA 3THRA 1YFJA 5TX7A 5BSRA 5EIAA 1J8VA 1V5GA 1VLLA 4BB6A 3E6AA 5IT0A 1LFDB 3FHLA 1CEEA 4ZT4A 1E6LA 2W11A 3GLQA 2HRQA 3GJ5A 4IQ8A 2ZQ5A 2EC5A 4H3KB 4BECA 5KYTA 4EG1A 1D1SA 3S1LA 3ZN2A 1N9ZA 4PYJA 5GZ3A 1I9GA 2J9ZB 3KOYA 1JJFA 1CETA 4AMZA 1YR3A 4QDTA 4RA9A 2HBZA 5JQGF 2A1TS 2XUQA 2NYAA 1TQHA 4U9IS 1WIWA 3ZCXA 1G38A 1X87A 2H2AA 4NECA 3JQRA 3JYQA 1RMQA 3T1HB 2GK3A 2IS4A 1UEXC 3I61A 2EKLA 2O4CA 5F9HA 4GRIA 3P45A 4ZAVA 1Q7EA 5JZSA 1VIYA 2BGLA 3Q98A 2C5LA 4WT7A 1ZK1A 3NHAA 1TJ3A 3CLHA 3HUTA 721PA 1IZZA 1XTQA 1NHGA 3AUUA 2XTNA 3S2GA 4C89A 5LMZA 3I2KA 3IKMB 1IQUA 2P6OA 5IWAB 3AHCA 4MYCA 3ZDZB 4EJSB 4XWOA 3OECA 2H4JA 1TVMA 2QXUA 4RK6A 4X91A 2VQ6A 1W5EA 5EKDA 1AHHA 5B7NA 3OFVA 1XFAA 4R9NA 3HSKA 2KSQA 1HFWA 4U2KA 2P1RA 1RBMA 3CNOA 2FW6A 1J7JA 2HRCA 3DNFA 4V03A 3Q3IA 4XIYA 4YT5A 5AOVA 3UV3A 5LLSA 4CM8A 3N8KA 4UTPA 2NZUG 4WACA 2ZAYA 1SOWA 1CT9A 4MMZB 3PVZA 2NXEA 4WCFA 3IKLA 2EP5A 1IBSA 2UUBC 5BUZA 2GETA 3IEPA 3PWSA 4FUTA 3TFOA 5E6UB 1TUBB 4QUBA 1S89A 2EFHB 4FOSA 3ZWMA 3PC3A 1RWVA 1C4WA 4QEZA 4CQLB 1VXRA 2XHEA 3LC1O 2FR8A 5CM8B 3NH6A 5JQGB 1C5KA 1DDIA 5J1TB 3VC3A 1O96B 1TVEA 3PNYA 1KVUA 4I9FA 4JV5B 1NKSA 3A28A 4NESA 2BGMA 3RF7A 1DCFA 1ZL0A 2JIRA 5DCWA 1RKUA 4BNTA 1KKGA 1SBNE 4I6GA 1AQJA 4PXSA 4DR6C 2QRNA 4BNDB 3R9WA 4CV2A 5K45A 1N2CA 4LVCA 1Y5NA 3PC2A 4RFSA 4B3IA 3L0PA 4C04A 4MAFA 3EUFA 2JGRA 1W36D 4O4HB 1ZKMA 1ZJ6A 2V6GA 3TTVA 5DE3A 1E2QA 3BWMA 4B3DA 2W7TA 1SXGA 3EGXA 3PNMA 1WMDA 4LISA 2B4RO 1OXKB 4HSEA 1ZW1A 4B6OA 1E77A 4R2WA 3BM5A 2FWPA 2HRRA 2FQYA 3BD7A 5DRYA 3U80A 3WBKA 2F4VC 4OD0A 8AT1A 1CUWA 1BD4A 3FNQA 5M2QA 1ZAYA 1UBEA 3NBAA 3PHLA 4Q3LA 3C3AA 2BDUA 1DUSA 1X1TA 4FYPA 4R05A 3U4GA 3BB1A 1QJ4A 1O5TA 1K0FA 1K66A 5CCEA 1PFYA 2XUKA 1NOKA 1PZEA 3DXZA 3KYIB 5H80A 4AJ1A 1W75A 2LV8A 2YJZA 3HI4A 3IESA 4XRGA 2PWPA 5GONF 4KIGA 4HEA6 1EFPB 4Y2XA 2C5HA 2FPUA 7REQB 1BW9B 1VTKA 2I7XA 2A8YA 3DW3X 1DV1A 3WLJA 1X0XA 2D27A 1U7ZA 2JIQA 1TT7A 4IJQA 4NTZA 3REFA 3U3RA 1T6ZA 5AWFC 4P3NA 5ER6A 4YRCA 2YC2C 3ZPXA 3OJFA 5U4QA 1ONNA 1NI5A 1NQXA 2QS9A 3KJFA 1EXVA 5CZVA 1L4KA 2WB4A 4REQA 1NXPA 1U1DA 3TQQA 4LHVA 2NTEA 3V9PA 4AY2A 5CVTA 5KPDA 3M1LA 4F5YA 2R11A 3GVIA 1JU3A 5FA5A 2GBLC 2P9ZA 5LLDA 3GLIA 5F7XA 3AKDA 4K9RA 4IBOA 1F2DA 1QE0A 2XYQA 2ZT6A 4QDJA 4PN7A 4XIJA 3TL2A 5KHLB 1T24A 3TNDA 2HADA 2Y6VA 2MSWA 5A6VA 4DAEA 2HYIC 3H9GA 4QUEA 1N5JA 2HMUA 4NU6A 2O8EB 2BDEA 1YB2A 1N6PA 3ANTA 2A14A 4MWOA 3IKTA 3F6YA 1L5SA 3DL4A 4EL0A 4QKQA 2VH5R 4MQ5A 1GUDA 1GPLA 2CL6X 1E9EA 2HWUA 2Z1DA 3GL9A 4W5RA 5FT9A 1R74A 2VF7A 1X2BA 1RE1A 4GBED 5JE8A 1TEXA 4GX2A 4LXQA 4OJYA 5DLEA 1XTVA 1JHQA 1MABA 3HJHA 4MQ4A 2CNOA 4TKVB 5J40A 4KQXA 2NUAB 5JS7A 1RI1A 2I6FA 2C2XA 2O2XA 4JI3B 2AR9A 2C2HA 1OYOA 3OPVA 4OAQA 4RABA 3SLRA 3T6KA 4A8JA 1GA4A 5K0CA 3F0TA 1XRNA 4OXYA 1B23P 2QW1A 4IVPA 3HBMA 1JPNA 3ESYA 3HZHA 1FXWA 3PFBA 1D5CA 4MUGA 3O2SB 3CQ3A 4FPXA 3LUHA 4QIHA 1M6YA 3M89A 5AKYA 5LYJA 2AIRA 2OXIA 3I09A 2BKLA 3VTFA 3SQOA 5JDIA 5LWHA 1C30B 2P90A 4PLGA 3IAHA 3ZCVA 4EYOA 1P5HA 4QATA 1DOZA 5J2UF 3OQ6A 4QDKA 3GA0A 1A98A 5BWOA 3T7RA 2GD0A 3DEKA 3EDRA 1X8LA 2ILVA 3HKDB 1R8SA 2GEUA 3KQSA 3QKTA 4GC5A 5DBFA 4F91B 1ODCA 4B81A 5BO5A 4EP1A 3Q7QA 4MDFA 4YEDA 3SNHA 3ZHYA 3S5UA 3OHSX 1OLSB 1L8LA 3ABSB 4FKBA 4HDKA 4PX3A 3STVA 2ZCVA 2ZB2A 3GN2A 3KHSA 5BW8A 4Y1RB 5JDIC 4KXQA 5IYZA 4JKIA 2OHIA 5CXUA 4DIDA 3FWPA 2Z6QA 4WXEA 2ORYA 1QP4A 2GXQA 4ENTA 5H59A 5JQGA 3X1DA 3VZSA 4TXNA 5A9RA 1U2GA 2NV0A 2XE4A 4Q3EA 1Z6TA 4Z86A 1FFXA 4W9NC 5FUVA 3GJXC 3OQJA 4OJKA 1RJGA 1UEIA 1CE8A 2FF5A 3O0TA 3P27A 5TV2A 4CM5A 2V7UA 4FR0A 4BP8A 2PG3A 3H04A 3J7TA 3R09A 4XDGA 4JYMA 1RXUA 3OY7A 4RVGA 3HLKA 4Q19A 3VHXB 1NWCA 2QX7A 2WMOB 2D74A 3GJZA 4D8YA 4EA6A 2DP4E 4W82A 4Y6PA 5DHFA 1UZLA 4XXHA 3VPHA 2E8FA 1WEHA 1QOZA 3AJEA 5B2EA 1Z6AA 1P1BA 3I5AA 2H17A 3LO8A 4KBFA 4R54A 1VSVA 3DFIA 1JDSA 4TL9A 1F7UA 5IWCA 4OI4A 1A0OA 1I1NA 3K73O 1L5LA 2OXEA 1CUGA 1JDPA 4LAFA 3TZHA 2ZUCA 1M2EA 3BJEA 2IYPA 4YJ3F 1FNSA 5BR4A 2V58A 3CGGA 2G3YA 1P2FA 2GK6A 2WF8A 4DLTA 4MW4A 2O5EA 4H6VA 2IZ0A 3O8OB 3SVZA 5F35A 3J81k 1NPDA 1RBYA 3B13B 4KQ6A 4LQLA 3NHFA 1Z2PX 4XSHA 1G4UR 1GUAA 2QRVA 5KOIA 4UZSA 1R3DA 2AR7A 2R86A 3SQLA 2ZR0A 3PPVA 3NWJA 4GLOA 5JH7A 4Z3OA 5KEIA 1XQVA 2PU7A 4Q01A 4RZQA 4O25A 2VR1A 2NO1A 5A5FA 5KOJB 1P0PA 5AR1A 1TD1A 2REXB 4FEEA 1XZLA 1KZGB 3CNNA 4TYMA 4F4JA 3AVTA 2ZM6C 1F48A 2VHEA 4DJJA 3HCRA 3SC6A 2NPIA 3DW1X 2OXFA 4X3CA 3K2BA 2C5FA 3I9FA 2VDMB 4X61A 2C1ZA 1SUCA 4MUYA 1NNSA 3SSNA 1A3CA 2ZSKA 2QL9A 1YVDA 5K7SA 1YXMA 4LF4C 3LBHA 1G42A 4LZLA 1NSTA 1BH6A 1TB4A 2I99A 2D54A 3F46A 1YQWA 2XJ4A 2Q8QA 3A6EA 3F5SA 5KSPA 2O3TA 3S3TA 4WEOA 3QIVA 3WLAA 1T8UA 3NRCA 5KC8A 2NMVA 1IQRA 3DVLA 1OX4A 3UMYA 3EDOA 2XMBA 1MOPA 2W2MA 4EFDA 3MUNA 4AP5A 5F5XA 3P9IA 2QPAA 1SUSA 1NGSA 3D0RA 4NMMA 5H02A 5K0NA 1CY1A 3EVNA 4HMPA 3SCZA 3V48A 1OBOA 3WLTA 2H8GA 1I32A 4BNHA 3LFTA 2PUDA 2DVMA 5AUNB 1XMJA 1TAQA 4ND4A 3HWSA 1XK7A 1ZNQO 1CJCA 2J3EA 3HVUA 4WNIA 4YY3B 1UJ5A 4LF8B 3EA4A 1CDZA 2IYUA 3DV2A 4RPGA 2VJAA 5JADA 1W36B 1WS6A 1Y5IA 2VPQA 1MC4A 5EJ6A 3NT2A 3F6EX 1C3OB 3LG2A 3TZQA 5ECWA 2DCUA 2XIQA 2ZRDA 1QGUA 3HEMA 2FWMX 5IN4A 1FDSA 3UFBA 4I1YA 5BV0A 1ZPDA 2YW9A 5ALFA 3TQTA 2GASA 5HOEA 1J90A 1JIXA 3LPDA 1QP8A 1FDIA 1QH1A 4Q4LA 3GROA 3WY9A 5LLTA 2OT3B 2BUAA 2ZB8A 4ZYUA 2HWWA 1EFPA 2GZ3A 3TLYA 4UKDA 5BV8A 4KFCA 3BBPA 3HA2A 1NXQA 3BORA 4PC2A 4GLLA 2ZPUA 1D07A 2I3AA 3SHFA 4JYAC 2ETVA 1ZUNA 1Q1GA 3MBKA 1BC5A 1P39A 3HVHA 4EI9A 1Y7IA 2V45A 2BKXA 4WBSA 5H83A 5C31A 3A9CA 4KO2S 1OLSA 2M2IA 3DA8A 4MEAA 4NJEA 1CNEA 1Z5GA 3KOXA 1A2KC 2W8BA 1B76A 3MLAA 1VP9A 5BR1A 4AKGA 1SU4A 2DWQA 1SUPA 1SK9A 4L5YA 2PSDA 4YPFA 3CC8A 1T4MA 2PM8A 4F6CA 2E4YA 3EQ9A 2QUZA 3WKBA 4CF5A 2D06A 5TQVA 3FPEA 5JPDA 1E1DA 4MKGA 4QRIA 4Q4CA 2B6NA 1NZDA 2JFFA 2ODWA 3KKKA 3OO1A 1TQ6A 1NUQA 1Z8DA 5BW6B 2IIQA 4IIVA 3ONVA 2PSHA 3AINA 4JJGA 1M76A 3W9UA 1KDOA 4AAYA 2HHJA 1OB2A 3D7LA 1PR6A 4D4LA 2B4AA 3QVSA 1Y6RA 2PBZA 4CDMA 1OFGA 2CXQA 4M86A 5D6OA 3I04M 2C31A 4OTZA 1H4TA 3E82A 4ILKA 3HY6A 3HCOA 1E2LA 2HCFA 1W29A 3QFSA 4WBXC 4GP6A 1JLKA 1DEHA 5LYJF 4DZTA 4I1RA 3WGYA 1KK0A 2IEYA 4EARA 2X8JA 4FS8A 2V1UA 3SYLA 3IEIA 5REQA 4KUHA 4PNHA 3JQBC 1RRCA 2W4MA 1K98A 2BBSA 4BFXA 3PUZA 2RHMA 1QO0D 1XDSA 5F23A 4XX0B 2AF4C 4TZTA 2ZROA 1PFUA 3H83A 3QHPA 2VATA 4HWGA 2XYRA 4DSAA 2VFAA 2XA9A 2ZIFA 1GVHA 1O87A 1WB6A 3KTFA 3H87A 2IZ1A 4J7AA 1GN9A 2V7EA 4BMDA 1Z7GA 2ZIWB 4US2R 2RHHA 1CQPA 4A0RA 3E7XA 1XZMA 4FEGA 2WZDA 1RZVA 2J8ZA 3M5DA 5I7FA 4MP8A 4MIKA 2QYSA 3R3XA 3I6ZA 3ILXA 3Q9NA 4FCWA 4FVTA 3VC2A 7AT1A 3IQGX 5HRUA 1XHFA 2O2EA 3ADOA 5CDFE 3NEAA 4M0KA 2ZRLA 3TR6A 1D2RA 1PR4A 4EHAA 3Q1LA 1XJQA 2AFRA 3OCCA 3PICA 1R6DA 3QLVA 4X1YB 5A3VA 4XYBA 1Y48E 4L9RA 4W6QA 1EWRA 5TJ9A 3ZWDA 1PW7A 4I19A