4GXQA

Crystal structure of atp bound rpmatb-bxbclm chimera b1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
505
structure length
476
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAFVVLREFAPSEILAEELAFVDRLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Malonyl CoA synthetase, Benzoate-CoA ligase Chimeric protein
publication title Structural Insights into the Substrate Specificity of the Rhodopseudomonas palustris Protein Acetyltransferase RpPat: IDENTIFICATION OF A LOOP CRITICAL FOR RECOGNITION BY RpPat.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
total genus 139
structure length 476
sequence length 505
chains with identical sequence B, C
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gxqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gxqA01
4OYCA 3NYRA 4D56A 4LGCA 5IFIA 3NI2A 3WV4A 3U16A 3T5BA 1V25A 1T5HX 3O84A 5BURA 3T5CA 2D1QA 4RM3A 4RM2A 5BSVA 3DLPX 4W8OA 2P2QA 4M46A 5E7QA 2D1SA 5JRHA 5GTDA 2WD9A 3CW9A 4ZJZA 5BSRA 3IEPA 2Y4NA 4OXIA 2QVYX 2VZEA 2Y4OA 4ISBA 5D6NA 3RIXA 2D1TA 4U5YD 3WV5A 4EATA 3U17A 5KYTA 3IPLA 4GS5A 3GPCA 3IESA 3A9UA 1MD9A 4D4HA 3TSYA 4RLQA 5K85A 2V7BA 3T5AA 3RG2A 3E7WA 3R44A 3VNSA 4D4GA 3E53A 1MDBA 1AMUA 4IR7A 5K8FA 3ITEA 4GXRA 4FUQA 3KXWA 3IVRA 4GXQA 3LAXA 1MDFA 4D57A 3IERA 1LCIA 5KEIA 4WV3A 5BSTA 3EQ6A 3E7XA 5BSMA 4DG9A 4D4IA 5DWVA 2P20A 4R0MA 3O82A 3LNVA 3FCCA 1PG3A 4RVNA 4G37A 3PBKA 2P2JA 2QW0X 3VNQA 4DG8A 4R1MA 1PG4A 2QVXX 5BUQA 3C5EA 3DHVA 3CW8X 2Y27A 5BUSA 2VSQA 3NYQA 5DV9A 3A9VA 5BSUA 1V26A 1ULTA 3WVNA 4GR5A 3G7SA 4G36A 5KYVA 1RY2A 4RVOA 4E5DA 3LGXA 3O83A 4RMNA 5BSWA 3ETCA 4R1LA 2P2MA 3VNRA 3QYAA 1BA3A 4FUTA 2QVZX 4IZ6A 2P2FA 2D1RA 4GR4A 3B7WA 4PZPA 1T5DX 2P2BA 1YJ7A 3DAYA 4RLFA 3L8CA 3FCEA
chains in the Genus database with same CATH superfamily
4NAHA 4QQRA 3B12A 4DRYA 2QDXA 4AZVA 5BWNA 4BKOA 4QWMA 1CJUC 2C2HA 2SKCA 1ZD4A 4YUXA 2VSOA 3A4YA 1ZH2A 3H4IA 3U16A 1OX5A 2RFLA 3AINA 3FW1A 2GN2A 5G41A 3EWNA 4R9VA 3W90A 3GLGB 3LXRA 4OSOA 4KRYA 1M75A 4TYYA 5CXQA 5G1NA 2H5LA 1IHOA 1WP9A 1E2PA 2FP4B 3ZWCA 4INJA 2HT1A 4Q1BA 1NW5A 2LGJA 3A6FA 2P75A 3FTPA 5IP5A 1T3LA 5F1PA 4QE3A 3BHNA 2WWWA 3OX2A 1K1EA 4PLZA 5CLGA 2MR5A 1GZHB 4WS9A 1UM8A 3AY3A 5A0VA 1XK6A 1HSOA 3CT4A 1P2TA 3L6BA 1QH8A 2W4QA 4K87A 1Y98A 3V80A 1DAEA 5KYWA 5ALKA 1OBFO 2PS3A 2QNBA 1K0FA 1N0HA 2BHLA 2ZROA 4XM0A 2VYND 4TVOA 3NVMB 4D4HA 1R50A 3QKTA 4KRXA 4OX9B 1A82A 1Z63A 1ZMTA 1P72A 4PROC 1HTWA 3ZDFA 3SYTA 5JZOA 1A8HA 2ZYRA 3DZGA 2R60A 1EVYA 3ZZNA 4WNIA 1P74A 4LDAA 3WGQA 3OKAA 1LZLA 4G85A 3GVHA 4F4IA 2F3PA 4MR8A 2IHKA 4OHOA 3BFKA 3DZ8A 2WWXA 3RYFB 4CMBA 5I8PA 4OU4A 3X1XA 5AVRA 1IBLB 3LHKA 2NCLA 4H77A 4AG5A 3D0KA 1DHRA 4AKSA 3EGIA 4XLZA 2JJ2D 1PBTA 4LJ7A 4Z5XA 3DOOA 1PS9A 2GLUA 1TGVA 3HKDB 4AZ0A 1BQ4A 2Z9CA 4I1OA 3EEOA 3I08A 2B7BA 3Q7EA 1TCAA 2CZGA 4IIEA 4RK7A 5E7MA 5SY6A 1MQAA 1O89A 2A5YB 3GFSA 2FN3A 5EIFA 3FGPA 2IHYA 5EZ5A 1HG0A 5CCBA 1VJGA 2HYDA 3WJ7A 4NXMC 2QLLA 1ZNYA 3W6ZA 3DFMA 2IEGA 2QPOA 4KTVE 3E9NA 1UPAA 2C9ZA 2ZJ3A 3F1LA 4I55A 1CIJA 1VJCA 1KYTA 2BZSA 2ZBFA 4L7VA 3WB9A 3T12A 1V9CA 1S2DA 3WLQA 4B3GA 3K5WA 2C4WA 5IJ9B 1OAOA 2QSYA 2I4TA 1EK5A 2I3BA 2Y1CA 3FPAA 4R54A 4Z7QB 5GZ3A 5KDOA 3TRFA 3BERA 3LF2A 1XCOA 2V7TA 3JWEA 3C8HA 4B32A 1N33C 1H8EA 1Y4UA 3CO0S 3W2GA 3THWA 1GQFA 1G60A 1QPGA 4Y67A 3MQ2A 1RYFA 4DJ5X 3AF6A 4UFPA 2V1XA 1P0MA 3P71T 4X95A 4ZYWA 3RWOA 3AERA 3L6UA 3RARA 3O4GA 4JJGA 2LUOA 3CKLA 5G1PA 1KDVA 3OWHA 2ZG6A 5LMUC 4UE2A 1B0UA 5BN3A 1LX6A 2A3RA 2RHJA 4URWR 4XIIA 5ALTA 4HQLA 4D9JA 3WMEA 1KI8A 4GR4A 4GZ5A 3OZIA 2RHLA 4MX8A 4QULA 1NR1A 4R84A 4ZREA 3ROXA 2E85A 5JXIA 4M3NA 4PBSA 2GJAA 2PUHA 2V0CA 2J09A 2W71A 3ROZA 1DBPA 1XHEA 1KVUA 4AYXA 2RCYA 4UHHA 5I3ZA 1T43A 5JS8A 2ZJZA 4ZRNA 2JLYA 3BSSA 3NETA 4LYDA 4ZQFA 1FUEA 2OK8A 4Q3DA 4ZZ3A 1NI3A 4L8WB 1W87A 4UEWA 1ORVA 4LMAA 1EBUA 4L8FA 1TJPB 3HACA 2V3WA 5J43A 1ZVKA 2ZJYA 4M86A 4RM3A 2IIBA 4CU5A 3U7HB 2FR0A 2VF5X 3LS2A 4ZDJA 5EJGA 2OM6A 4QBKA 4B74A 4BRZA 4CM8B 2D1SA 1J0DA 1U65A 2CCJA 4GLLA 3AB3A 4RVFA 2PXHA 5AVJA 4E2YA 2GWRA 5I9NA 2HHJA 2W2PA 1ECPA 4QBHA 2AMYA 3ST7A 1Z12A 5DTQA 1FZTA 4ZYVA 3ANTA 3WRXA 3WGNA 3H6HA 4FCVA 1UBFA 2W9XA 4F3RA 3F8TA 1WBDA 2RB4A 4FX5A 1YHYA 3QX3A 1MRNA 3JRNA 4QT0A 5C37A 1EB9A 3MTEA 3R41A 2OV3A 3R7AA 1DXYA 3IUYA 4KPEC 4KXNA 2PU5A 4FFRA 1QYXA 2XD4A 1XQ6A 3SEZA 3WS7A 3CEHA 1QVAA 4KKXB 4PIMA 3WGTA 1Z2DA 2QN3A 2OC4A 1Y3BE 1NQ5A 1RJWA 2VR1A 3CLUD 2Y1OA 3G2NA 3F5MA 4Y6RA 3H5NA 2ZBRA 3CX3A 4F4DA 1EIWA 2NO0A 2E9SA 2BJWA 5CAEA 3O9MA 1Y8RA 5HTKA 4B3IA 3U13A 4D44A 5BR1A 2GZ2A 1SC9A 1SHLA 4G5FA 1DJOA 4KBYA 2RJ3A 1SXJB 2WFAA 4OF4A 1EI9A 4C7KA 4YV1A 1WIWA 3W79A 3AILA 5LQMA 1VJ0A 1MIOA 3S70A 2CY0A 1N33B 2UVPA 3R9KA 1WBJB 4MK4A 1EMDA 3GFPA 4RJ2A 2XLCA 3UENA 3GJ8A 2IP1A 3MGBA 4M55A 1BDIA 4G5HA 1M2VB 1DI0A 3WKCA 1S1MA 2WHRA 3LJKA 1SIOA 4B7UA 4QEDA 3D3NA 3SIRA 2H31A 2PTGA 1ZL2A 3CLTD 3DAOA 4JK3A 3FOEC 1UDAA 3DEJA 3C6YA 3RH0A 1DX9A 4HQRA 4Z99A 4I1YA 2GM3A 1SVOA 4FIDA 5B55A 4MKIA 5FBWB 2IY8A 3TEJA 2TMDA 2PVSA 1ZLYA 3BRWA 3CN7A 3HEAA 3SY8A 2J59A 2QX7A 3KZCA 3FSEA 1QO0D 3LNCA 4OJMX 4Y2QA 2WM3A 4TT3D 3LZDA 4MVJD 4JGGA 5EZYB 3WTCA 1SPBS 2J07A 1MXFA 1IZ9A 2VK2A 4JSYA 1JHMA 4F2DA 3QU4A 5B6JA 5JZMA 3U44A 3A4NA 4WINA 2CBGA 1NVVR 3GLUA 1RLJA 1K75A 3DV0B 1A69A 1VCMA 3PPXA 3OZXA 3O3MB 2X22A 3V8BA 3ZWYA 4KV9A 4PRKA 1VL1A 2OFWA 1J2RA 1NWHA 2FSHA 4FYWA 1LBSA 4URZR 5FTLA 3FCSB 1C9KA 4LTMA 1FXWA 2O2ZA 2QAGB 3PGMA 4C04A 1GNRA 2WFZA 3MWEA 4ZO8A 4BP9A 4WGFA 3T4UA 3TJMA 4CGYA 3I2IA 3ZHRA 1TM3E 1F6BA 2FG7C 2QRHA 4D8UA 2HMYB 5E8JA 1U2QA 3KUKA 2ZIXB 1TJ4A 1Z25A 2REOA 2ZB2A 5D84A 3ZVKA 2AFHA 4U7TB 1UMCB 2XYHA 1Y7IA 2VJAA 4KXUA 5E9AA 3P2EA 5HDBB 1NRXA 1AMNA 4IDGA 1FFXB 2X3UA 2ZXFA 5ES3A 5JD6A 1PO7A 1GM5A 4MYDA 2Q1UA 1SC3A 3T7IA 1F38A 1YONA 3WL6A 4RCVA 2GBPA 4LY6A 3P19A 1UEIA 4RX1A 4ER7A 5A3RA 2OD2A 2OGSA 4W8OA 2OBNA 3NXKA 2RKBA 4DOMA 1N5RA 2FQXA 1DRVA 2XYQA 1GWNA 4HFRA 4QASA 3K1AA 4J03A 4FNAA 1N6HA 1YB7A 4YH1A 4BB6A 3N74A 5I5EA 5JCJA 3E7DA 4HNSA 4DCTA 5F21A 3EIHA 2C5FA 2IUSA 2BMJA 3QUSA 4I5DA 4W82A 5JAIA 3ICQB 2NXEA 4XQ9A 3PEVA 1M6XA 3RWBA 3CIOA 4DPMA 4KIGA 1WG8A 3COYA 4BYGA 4MLCA 4BXOB 1TM2A 4LSZA 1MHTA 4DLKA 4XUGB 1D2RA 2FFAA 1ULUA 3ESDA 1RZVA 4DMKA 5HKOA 1OGYA 2ZBGA 3G5UA 5JWHA 4BGDA 4GLFA 5ALLA 3M5PA 4EENA 1Z4NA 3B51X 5A6SB 4NICA 1QGUA 5LZ7A 3G2PA 1XXHB 5KQLA 4M53A 1QJCA 4KH0A 3DCIA 3WRYC 2O2CA 5EIHA 2QB5A 5J5VA 5FJIA 1MDBA 1KMMA 3NC0C 2B37A 1OLUB 4ER3A 2HR1A 3R3SA 2CFRA 2XDQB 4FK8A 3CPEA 3GH3A 3QRWA 3WGHA 5LCIA 5EUBA 1A9YA 1W4RA 3OZDA 1BSVA 2FPXA 3AR7A 3GT3A 5AK3A 1HE1C 2HDWA 2VA8A 5AHRA 4CG0A 3O03A 4YMGA 1XKQA 1DMRA 2HJGA 2LNDA 4G24A 4NZNA 3PTAA 1OH5A 1U9YA 3MVEA 2YZNA 1GAEO 2GA9A 4Z4FA 1P9NA 1ODKA 1Z5ZA 3NHFA 4CR6A 2W2KB 4AVYA 1SUWA 2PX6A 3TTXA 4AZWA 1POXA 1YJQA 2GVZC 4HUQB 4JB8A 2Y1EA 3JQDA 3W6NA 5HBRA 5LN1A 1VSTA 2Q5CA 3GJTA 1EM8B 4X7MA 1KYXA 4PN3A 1A2OA 1R7RA 3B6IA 4LWQA 3NO4A 3QUAA 3FYUB 2HMVA 3LQKA 4ZVUA 4ZDIA 3VPXA 1AXEA 3FYHA 3L18A 2D54A 3SMVA 4NTZA 3DVQX 3QBVA 4ATNA 5KNBA 4RHYA 1CDDA 4KQHA 1M8GA 4LZZA 4AURA 4DV1B 2HT6A 1SCKA 4MGIR 1IVYA 4GXTA 1G3UA 1A9OA 3NZEA 3CE9A 4Y0VA 3ZW8A 3O83A 4U2FA 1NU6A 3JQ8B 4XYBA 5JAHA 2DJIA 5ALEA 2ZDHA 1WPRA 4DCUA 1EQ2A 1RWPA 1R2QA 1HXHA 2VHVA 3L0IB 3RTDA 3S40A 5K09A 2D00A 2G4VA 2ZCUA 3HR7A 4FUTA 1OLSA 2DPGA 1B0AA 3C87A 4NMHA 1O92A 3QWBA 4XWOA 3ABOB 3KQHA 4CL2A 1UFOA 4BVLA 4K28A 1E3WB 3CZ9A 5JIBA 2VPWA 1TAHA 2BTQA 2CLLB 2WZQA 3TD9A 4HWSA 3A1NA 5JSFA 1M2EA 4KMSA 4BRSA 1JXMA 5DBGA 2WKRA 4KC0A 1HDXA 1XFDA 2OQVA 4B3FX 2B36A 1HL3A 2OWDA 2PGAA 2RHRA 3HY6A 4UHCA 1TVEA 3FNGA 4ZU6X 1HNWB 5IM4A 5LZ5A 4RJTA 1WSAA 2C3YA 4M89A 2VP3A 4DV5B 2VPZA 1EWVA 2X40A 3QPBA 4FGKA 5IDXA 4JC0A 1EXWA 2GS9A 2JH8A 2OPLA 3F7NA 2I1LA 1N3YA 1VJ1A 1T3TA 2OV4A 5B7PA 3OEHD 5IYZF 3K9GA 1BCSA 3W7BA 4F6LA 3D6UA 3USCS 3UH1A 3HHEA 4HSGA 2CJXA 4JBXA 1JILA 2WICA 1SC4A 4IH4A 1EZ1A 1ZJZA 4FINA 1SKAA 1IZ8A 4R0VA 1A76A 1Z8DA 1MPTA 1U31A 4TQAA 4EZIA 4JELA 3T99A 3TI7A 1TT5B 5C8XA 4IOLA 3UPTA 4CM9A 5AJXA 3ZJYA 3TQTA 1OFHA 2L0XA 3K15A 4PNZA 1CXZA 2VUTA 3DUWA 4GWLA 4RHFA 3CZ5A 2G9QA 4B3MB 2GAFA 2O3QA 2H65A 3EODA 2OR3A 2B98A 1RC1A 3TGLA 4YP7A 4CLXA 3UXYA 1UMDA 4CFSA 3T5AA 1RYMA 5EIBD 5JSZB 2BWJA 2QRPA 3K6SB 2XYRA 5IDQA 2V98A 5T57A 3KR0A 1XDZA 3AR2A 5DGXA 1HLDA 4JLMA 3COSA 2JAUA 3JW8A 5E6UA 2XXAA 4JX9A 5J63A 2RGNA 3GEHA 5F1OA 4B79A 4BIMA 1UKKA 1YCFA 5HQ3A 4ZMSA 2DKFA 1Q50A 2YIJA 3H04A 2YVUA 2OT3B 1I5RA 4BNYA 2CYBA 2BGKA 4TYWA 3ZHUA 2O57A 4ARVA 3IGFA 4FEEA 1VSUA 1ICEA 1CU1A 1L7DA 1RCUA 2OBLA 1JDZA 2JFFA 1UBNA 2VO1A 3C15C 1WHTB 4IM7A 1P0QA 5AQEA 2BVNA 1EFRD 2VK8A 4H27A 1HRKA 1A4IA 1W76A 2WTMA 1LVGA 3K92A 5ALYA 2ZRIA 3UMGA 5FADA 1Q92A 3ETDA 4HWPA 5AMXA 4AROA 4TPSB 2VT2A 3ZWNA 1INLA 1UBHS 4HN4B 4LJSA 2C4HA 4O2RA 1SKQA 1AM4D 2H92A 4IV5A 4DKXA 3CW8X 1A9ZA 1OHHA 1RYZA 1JT2A 2WYOA 1G291 1ULSA 2JRCA 2GZRA 3CLUC 4JT8A 3H2YA 4P3NA 5BUSA 4Y2YA 3TJRA 4F92B 2EVWX 4S04A 2QLBA 4GGOA 4PINA 5C8DA 1DC3A 1V16A 2IXAA 2UKDA 3N59A 2J3EA 4LXUA 3N6RA 3PC8C 2M2IA 4MDHA 5ULLA 3ZVLA 1ZH6A 1C3OA 4EK9A 1C80A 2D3TA 2IX3A 5JJIA 2DERA 3VYUB 2FW6A 1X8XA 1E79D 1GFSA 1JS1X 1N7HA 1WVIA 2FWMX 2QMHA 3ADKA 1MC8A 3AFHA 3NKFA 4FMCF 4HQFA 1GTG1 2O14A 3DZFA 3MN1A 1JIJA 1H1TA 1I6KA 2F6RA 4OYHA 2ID4A 5EQFA 2NP7A 3IAFA 1R5OA 1EWKA 4FXPA 2OGUA 2EC5A 2JDIA 5J9FA 3HSKA 2FMXA 2IE0A 1XPJA 1LEHA 1YTLA 1MABB 3CLTC 2ZRBA 3HADA 1E2QA 1DBQA 1JI3A 1DDOA 3R0IA 3ZWWA 4WH0A 4TS9A 4YMVA 1ZBDA 5K0LA 3LLUA 3OEEA 2G83A 1V6SA 3CVYA 2B1QA 1IATA 2WJJA 4LGCA 3DL7A 1QWOA 4H08A 1V96A 1HT3A 1NVDA 2PGOA 4MVJH 2QEQA 2WQZA 2W0MA 3W8RA 3QLVA 4KVAA 1G20A 3DGEC 2FPMA 2V6MA 3TEFA 4U2BA 1SG0A 1S89A 1M76A 3V2HA 2BUBA 2C7GA 1T4BA 2P2YA 4BP3A 3KZKA 3NAZA 4U2EA 3L0YA 3NP9A 5HIKA 2CHVA 2B6NA 3DMGA 4MVWA 4ZKEA 2E5WA 3WOVA 4AF8A 3OHMA 3IHKA 3LW7A 1XEWX 4RBNA 5B3LA 4UPDA 1G21A 2QVBA 2ZFUA 2BI7A 1FTYA 4H6PA 5KPDA 3I52A 4FHZA 1FYDA 1V45E 3IP7A 3EC1A 2H17A 4XPIA 1YZQA 2G5CA 1LDYA 1JIUA 1STOA 3LECA 2M1XA 1K6MA 3VDRA 5DRYA 3GELA 3JQAA 5CJPA 4KAFA 1G4UR 5HIIA 1Y34E 3DE3X 5HKKD 4KDFA 3K9HA 4WVFA 4Q4JA 5ITZA 1UF9A 2P6OA 3V7YA 2AXEA 5KCZA 3PLRA 4TYPA 5JROA 1XVTA 3PXUA 1C3EA 2GAJA 5BT8A 1KFEB 1KU6A 2NNWB 5FLXD 3OT5A 3G0DA 4XSGA 1X87A 2OA0A 4JXJA 2Y99A 4XUDA 1JQAA 2O2JA 2JA2A 3KTAB 3MJTA 4QU5A 3RFVA 2V3CC 2HU2A 1QX4A 5DF1A 4IR7A 2NV2B 1VHJA 2GZMA 1WKBA 1BWSA 2GHTA 4YRMA 1U1EA 5K0TA 4Y30A 2GLTA 5LIPA 1WDLA 4Y2VA 1JV2B 1N2CA 4BHTA 3B85A 1NP6A 4LE1A 2JNWA 4DUYB 2JGLA 2JAQA 4EJFA 4LQDA 4U8HA 3WGGA 1KSJA 1E4OA 2M6RA 4NFHA 4RD0A 3SF8A 1AK1A 4I99A 4ARSA 1YK0A 3NHPA 2G09A 3AF4A 2B4YA 5DW0A 4BZWA 4BEVA 1A7KA 5FWNA 5HQJA 4E51A 2JHGA 4LBVA 1BQEA 5EMHA 3T34A 3S1AB 4TM7A 2PRYA 3RS2A 4GOND 4P0TA 1R64A 1SELA 1U8TA 2WQ7A 4DUZB 4BWFB 4KHPC 1D6NA 3HB0A 4WMLA 4KE9A 1C30A 2CUZA 1A0OA 2IEBA 3AWIA 4OYLA 4KTTE 5I7RA 1VC2A 1YR7A 4QOIA 5HZMA 2VPYA 4X93A 4MAMA 3FTDA 1OPRA 2EKQA 2D2VA 2HF7A 2WHPB 2XTZA 3M6XA 3LQFA 4OQMA 4Y7DA 1NVKA 3ESYA 4QTZA 4AO6A 5L6MB 1RZUA 2BC9A 3W5HA 3PRHA 1U7HA 1N6IA 3DBLB 3BB4A 2IZ0A 1KETA 4GR5A 4B85A 1EINA 3PHCA 3MJVA 4EW1A 3PXXA 5HJ5A 2WEKA 1QS0A 1VBFA 2FW8A 3M1AA 4CCYA 5JECA 4B3CA 1USIA 2NT4A 1MG5A 3G85A 3SQMA 2M32A 3RSHA 1M54A 3U0BA 2D5AA 1XNJA 4OTZA 2MWMA 3G2OA 1YDWA 2W48A 2Q1SA 4Q7KA 3K2QA 1CYEA 2XUPA 4O2BB 1TLTA 3I2KA 2F2TA 4O8ZA 3B1YA 1V3TA 4HXFB 3UMYA 3E9DA 3URMA 2KE5A 5GZ6A 3LPMA 4OJKA 5ERGB 4EARA 2B0JA 3R6DA 4ND6A 4RFSA 2P67A 4OYCA 4ZU3A 1C3XA 3L8ZA 4KFUA 2PMCA 2QRZA 2Y0DA 1VFPA 3QFRA 4FDAA 4IKOA 4HX9A 4MZDA 4ND8A 5G4KB 5IAGA 5CLJA 2PO5A 3BZBA 4NBLA 2COUA 4EJ0A 3Q6IA 1D2CA 4DABA 4PCVA 1ZC4A 3EF3A 3GHHA 2P27A 1L5QA 4H7PA 1ISMA 1EDBA 1MAUA 1XHFA 2XODA 1GAQA 3NBAA 3MS2A 4IS3A 2R4QA 4JZYA 2AWNA 3KWFA 5TC4A 1O9TA 4BGEA 3F73A 2O19A 3B13B 4IIUA 4EVIA 4DA4A 1P9WA 2UZ1B 1WCIA 2W6CX 2YBEA 1YQUA 4HB4A 4TWZA 5BQ5A 4ZI5A 4EKIA 2D27A 2F17A 1REQA 4BLVA 1VFNA 4ZJZA 1BFDA 2CHQA 2EIHA 2R11A 2Z9DA 2ZSBA 2EEPA 1BXGB 5AJYA 1IY1A 2IITA 3CJQA 2A0YA 3IC5A 3K7EA 5LOVA 4NCBA 4LRQA 4HYQA 3A70A 3WLNA 1H3EA 3TEMA 4Z9AA 1J24A 3CBGA 3SSOA 4YCLA 1YE5A 2QAIA 2TMKA 1BH6A 1L7PA 1SXGA 1M7HA 1PQYA 3F0TA 1Q14A 4LZJA 2PFKA 3LPCA 4HVLA 5DDIP 1YJ8A 2X5NA 1TCVA 1QOPB 1JFFB 3I9FA 3E3LA 4D9MA 2WABA 1HFEL 4DEVA 1CUGA 1ST3A 1AG9A 5JI2E 1NFQA 5EKUA 3Q5DA 4YAKA 4XRRA 2MSEB 4MLDA 3H2IA 2CYCA 2HHHC 5JNWA 4RTQA 4TKLA 1DG3A 1FJHA 5FKJA 1Z4KA 3LF1A 1QHIA 2OE2A 3GFGA 3DP7A 2EFYA 2PUDA 1GUBA 2XVYA 3FFXA 1GD1O 4RMJA 4DJFC 1TYEB 3LG2A 1V7ZA 1I4OA 1NFFA 2YFKA 3BPSA 4C01A 2A86A 1EESA 2F1RA 2B82A 3NHYA 1AKYA 1YNOA 2CFIA 4KSCA 4PZCA 4D5EA 3UIEA 2OBVA 4DIKA 3DCYA 3PDHA 3H16A 5I4CA 5JW6A 2OOKA 3RJTA 3R3ZA 3NMUF 3R9XB 4AWXA 2HMAA 2EZ4A 3DKVA 3MILA 4HYTA 4JLNA 5EESA 4DVGA 1X39A 1H8ED 3QXXA 4L5CA 4YVFA 4BMPB 4MI1A 4JQCA 3NEAA 2Q4RA 1FVFA 4CQMD 2P3SA 2QBYB 3KWMA 1J9EA 3SP1A 5HF6A 3VGPA 1A98A 1WTAA 3OPMA 5EIBC 5GONB 3V1YA 1KI1A 3KOUA 4Z2AA 3DEIA 2XRFA 1HRDA 3WWZA 1DX6A 1Q21A 4NESA 4OJTA 5T3UA 3RYHB 1YQWA 1ZIXA 1JHZA 3CH5A 5CM8B 5FTWA 4CLEA 3E0QA 3L0DA 1T5BA 4L4SA 4AM8A 1JJVA 1F6WA 3ETCA 1ZR2A 3PJGA 1IMJA 2BFFA 4R2IA 1NRJB 4PQEA 2JLCA 5EP2A 1Y7PA 3SEFA 2OCYC 3EARA 2YJZA 1FIUA 3RRZA 4AF6A 4W5OA 3IQEA 4UD6A 3BMQB 3SQLA 3WK8A 2I66A 4G56A 2Y71A 3E5MA 2P9QA 4MRSA 2V6IA 5GJWC 1T6BY 1CUJA 1H2RS 2BFMA 2FPKA 2Q21A 4II7A 3PFWO 5F3RA 5KVQA 5JJ5A 4BPBA 3EASA 1VM6A 1LJLA 1RWXA 1J6UA 2ZT8A 3P2YA 1M0TA 1QQAA 4GPTA 4S35A 2QAJA 3PXDA 1W2HA 3AR3A 4GNRA 4WBXC 1YT5A 2HGSA 1FDIA 4YK7A 3M3DA 3U4CA 4H7HA 3ZXIA 4ZVPA 2VTBA 3H05A 2X8JA 1EWRA 1DJMA 1DEOA 2HREA 2PMKA 1XFAA 3W5JA 2HHHB 1QYIA 1XQ9A 1JG4A 3G82C 3N2GB 1HFJA 3ERCA 3OAAA 1CP3A 4HPVA 3SJBA 3ZNQA 3U09A 5F52A 3UH0A 2Y0CA 2UU9B 3IOCA 4WOPA 1GUZA 2JGIA 4JB2A 4ZVTA 3DWIA 1X14A 1ILEA 5C52B 1VSVA 1ZOPA 4AZSA 2DFTA 4K05A 4LHYA 1P7VA 3HU1A 4MDYA 2E4UA 2AG5A 1MF7A 3K0AA 1BXZA 2Y1FA 1USPA 1YZ3A 2WYIA 2V74B 4H60A 2YWBA 1E6EA 2CVOA 4AO8A 5K7SA 3USES 1L4LA 3I76A 1E2NA 4OFZA 2AL7A 1HZJA 2FZGA 2CDBA 2HA6A 4JJAA 3HJRA 1JVNA 2DBVO 1WB4A 1E7MA 2WYUA 3OZVA 4UTZA 2MYPA 1ISFA 2XUIA 1CVRA 3R4VA 2JLBA 2GTIA 3H75A 3X2FA 1PV1A 3F96A 3IESA 3N3BC 4MGZR 1NJ5A 4QOFA 4JP1A 3QM1A 3PS9A 4Q21A 1I7NA 1X15A 2GHQA 2JIRA 1Q1BA 3NH6A 4CV1A 2JI7A 5DH9A 4QGFA 4BX0A 4D8WA 4LF8C 4E2ZA 1NQXA 4C08A 4JYAC 3HKBA 1DAMA 3UAGA 1VXOA 4EDFA 2DWOA 4JC8A 3PJDA 2JPDA 2XBLA 5ABPA 3ZDXB 2O8FB 4RZSA 1ZHHA 2VN8A 4IS2A 3V7WA 3ZHCA 1PX0A 2ZYHA 1NW7A 1CNFA 1Y8QA 5LDHA 2FFQA 1CSEE 1UWCA 4RNDB 3GLGE 4KR3A 3VH2A 5SV2A 2VXBA 2A57A 1J22A 2HCJB 3LOQA 2XLBA 1IVSA 3RYIB 1HL7A 1N36C 2FUKA 1GDHA 1OPXA 3DHWC 5I9LA 4BZQA 4J49A 4FDTA 4CI9A 4RMHA 3IKTA 3PHLA 1DG9A 2R8PA 3NNDA 3R9WA 1BN6A 3QE4A 4MV7A 4AQ7A 4G0UA 1LQUA 4P5EA 1MB0A 2Q62A 4ZT3A 2ZAYA 1UK9A 4E88A 2BF7A 3H5AA 3ETLA 2VP2A 2UUCC 2X5XA 3DO6A 3OKFA 1R8XA 4URUR 3H2KA 4Y9TA 3UTDA 1N8NA 2XQFA 3I05A 1XHJA 1CE8B 1L3BA 1P5RA 1FC0A 1Q7CA 3HLKA 3PUYA 4QPDA 5F7OA 3FNFA 4JLUA 1NLMA 2KBFA 4I1IA 1GTVA 4AN4A 4RLHA 2XOEA 2PSFA 3MD0A 5DRTA 4E21A 3B38A 4ECAA 3GEIA 1RYDA 4RXUA 5ALFA 4M8LA 3ZHSA 2REQB 2BKEA 3CMMA 3NM4A 3T7CA 2QXUA 4IILA 4LHXA 2C20A 4GD3Q 3AESB 4AY2A 2I78A 1D6JA 1UL1X 3D4LA 4D0GA 3Q7PA 4HTFA 4DMCA 4HR7A 3SXUA 3OTOC 1I2AA 3DFZA 4DCJA 3K9QO 3KB1A 4FYKA 3D9QX 4DMUB 5F76A 3PC2A 1I4DD 1YJ7A 3MCUA 4TM8A 3SD7A 3U3MA 3WL5A 2B5OA 3E0XA 2CLSA 5DNUA 2RONA 1WVMA 1XZDA 3NNNA 1GG2A 4WKGA 4HZUB 1W49A 5LBUA 1SOVA 2ZYUX 2XWPA 4HB2A 5KYUB 3HUDA 1FVOA 1CZUA 3H9JA 4XYGA 1WDWB 4DXHA 1ZVMA 1JPVA 3N2ZB 4LF8B 4QICA 1HDYA 1DJPA 3DDCA 2FY8A 4Q1DA 4URVR 5DX1A 3QI7A 1IQRA 4TUYB 2V8OA 4RYDA 4TTPA 4D4MA 4M1ZA 4J3NA 1SRQA 4LK3A 4S1TA 4EG4A 3QPAA 1K3UB 1T9CA 2OVFA 5BNWA 1TLLA 3DBOB 3K73O 1U9IC 4AN0A 1I3MA 1RHUA 4UFOA 4ZEMA 2NT3A 1P2VA 2C7BA 3DDSA 2FUG6 3RNLA 3BS4A 2PUVA 4ZD6A 2BTEA 1H2EA 3RF7A 4MQBA 3WLKX 3B20A 4F91B 1I4TD 1X1QA 2H0AA 5LZ9A 3P26A 2VWPA 3F49S 1PEDA 1F4PA 1G18A 2G9ZA 4E0BA 1F7UA 3M89A 2KMLA 1EB8A 3QU5A 4IIGA 4RACA 2XMPA 4KBFA 3AIIA 3E3AA 5DTJA 3A7DA 2XJ4A 1XRRA 3KPVA 3MUOA 1T29A 4C0XA 5TPZA 1TT7A 1FTSA 5BXQC 4YDQA 4KVGA 2BUCA 1ZGAA 3QYJA 4X97A 1XP8A 2LR0A 5F3WB 5B7GA 4AJPA 4NMWA 1T1EA 4NP6A 2GF2A 1NJ8A 2QY9A 2AN1A 4O5OA 2BGJA 3D1VA 4RPCA 2P6RA 4IMIB 1N25A 1F51E 1VXRA 4V1CB 4WKCA 2I2WA 4DMGA 4XB2A 2JLWA 1PS0A 2JGAA 2W37A 5BSTA 1NVTA 2AYZA 4C3VA 2VJDA 4EPYA 3H13A 5ENDA 1IG0A 4CMIA 1V8FA 4BTLA 3V8QA 2X3FA 5HM6A 1G0NA 3NBKA 4NMMA 2ZU0C 2ZSHA 1Y3CE 2H63A 5ERYA 2D2FA 1FDVA 1HT0A 3A1CA 3GCZA 1UOOA 4GYWA 4XJXA 4F2PA 2P40A 4LGVA 2E37A 2VDNB 4M0EA 4N40A 5KNBD 4R1MA 4L9AA 2IYZA 1NUTA 2I6XA 3K09C 1Y8ZA 2BJOA 2DTXA 1GG5A 5KI6A 4DLTA 4KX5A 1LBTA 4BNHA 3HYNA 4ZO9A 1Y9DA 4K9MA 1XG5A 4D3XA 4YALA 3NV7A 4PZUA 3H5RA 3L6RA 5TMDA 3REQB 1Z7EA 3TKYA 4U7DA 2AD5A 4RMIA 2VQEB 1SUFA 5JTUA 2YHBA 3CJTA 4ZPJA 3CINA 5F9MA 3UKDA 3ZGYA 1XB2A 1OWMA 1W0JD 1JG6A 2XF8A 3AU9A 4IQ0A 3X1KA 4P54A 1E2IA 3N8IA 3T7SA 1NKVA 3I5MA 5KWSA 4LXQA 4OHZA 2RSLA 3ILYA 4JVLA 1DQYA 3P0IA 1AZTA 3WLJA 4DXDA 1HK7A 1VYTA 3T9BA 3VJKA 5AW1A 2O8BB 3IQXA 2IYFA 1PI3A 2BEUA 2EKZA 2HNKA 1U99A 1I1HA 3UCXA 3A1EA 3WHLA 4CODB 3ZHZA 3VKHA 2UUPA 1ZCAA 1UBCA 4JKYA 3PP8A 2CSXA 3MRXA 2ZUTA 4GWKA 1RAHA 1F7VA 1U8ZA 2CU6A 3HQ4O 1OV4A 1VG8A 3ICWA 2VH2A 3ABRB 1C9YA 4LSWA 2NTYC 3UATA 1DLIA 4RLFA 2DPYA 2QMUA 4CW7A 2F43A 1SKYB 2VUSA 2Z8XA 3TM4A 3HXQA 1EK0A 1JQKA 1JP7A 1KY3A 3DKRA 2CK3D 3ZGOA 1CZHA 1E3QA 1I9GA 5LR6A 3FHTA 4L0DA 1JH9A 2GZDA 2WMNB 4QJIA 3BXEA 4J4TA 3F4KA 2UXDC 3L95X 1YGYA 3A1WA 1T34A 3GDFA 3ZOZA 4CLHA 1SRRA 4Q9JA 2AJCA 4TS3A 3W05A 5T4EA 4G4SP 1D6MA 3EAGA 4RH0A 5GWXA 1DTWA 3HABA 4MIKA 3DJYA 3R4CA 4RELA 2OQRA 1S4QA 4RQBA 1CR1A 5TJHA 3CZAA 4KE6A 1J09A 3HXTA 4OLBA 2FHSA 1ETUA 3OOHA 2D74A 5A1TA 8ADHA 4FONA 3SFZA 1OXKB 1ZRNA 5IEJA 1QH8B 1JEEA 1W6UA 3N9IA 2WM8A 3UWDA 1NN1A 5KYWB 2X0JA 5TMEA 721PA 4NFSA 1JF8A 2FH5B 2YZMA 4FQ8A 4QZVA 3QWIA 4HFNA 4KEAA 3HH8A 4INZA 5EUCA 1GR1A 2JGMA 3R3WA 5HKAA 4US2R 1RQGA 1S9HA 1RAIA 1M6WA 1PL7A 1WKCA 2CL5A 2OMKA 1RWVA 3F9CA 3HO8A 3QHAA 821PA 1WB9A 2GBFA 3L84A 2M9MA 1M8FA 2XVAA 1JDSA 1FW6A 4Q3EA 4MR8B 1PIWA 3OOYA 2P1ZA 4WOJA 4UUQA 3OEYA 3AVPA 2C04A 3FSRA 2SNIE 2I7TA 5JYBA 3O8DA 3L1HA 1RKVA 2EP8A 3E53A 1L7QA 3WRXC 1QM4A 4UVDA 1WNTA 4ZK6A 2VXOA 5CLIA 4AZ0B 5F2NA 2Q5IA 2C83A 2IYQA 2DGDA 3GEGA 2C59A 3R7NA 4BAZA 2G0AA 3ADPA 1ADGA 2BE9A 4HDCA 4R3WA 4CG3A 4A23A 2YDXA 3TDMA 3L6DA 6ADHA 3TB6A 1OHHD 5HJEA 5MHTA 1ULAA 3RSLA 2G8LA 3CKMA 3FBWA 3OWOA 4I55B 2WU3A 5F78A 1G5PA 3FR7A 1RKQA 1BGXT 1PG3A 3RU7A 1H1DA 1KK1A 2DAPA 4RJIA 3EDOA 2V54A 1UPUA 2D4HA 2ZSAA 5CT6A 4Q4LA 4ZPXA 4P6VF 4A2CA 3CUWA 4G1IA 4N49A 2D5LA 4BNTA 2J5XA 1HDGO 3LHSA 1IQPA 2QTBA 1G5IA 3THWB 1QK3A 1QRAA 1YB4A 2QV7A 1B8VA 4ZAWA 4P80A 3KR1A 2QMEA 2ZIEA 3EEQA 2UXDB 2OAQ1 2QA5A 4J1QA 3AERB 5EFZA 5ESDA 3H9UA 1SWVA 5A0FA 2J3DA 1B8OA 5K3DA 1O5TA 2H2IA 2HPHA 4OKNA 5BN3B 3UG6A 3GPLA 1M2NA 4DSZA 5BN1A 1NHGA 5LMNB 1GJRA 4REMA 1M7GA 3IHWA 3OEED 4JHXA 4YTEA 4CDRA 2Z4RA 2WR8A 4RCZA 1RS0A 3V7UA 1Z26A 4UJ5A 4EA7A 5FBHA 3RIYA 1FTNA 2JHPA 4MGYR 2XVMA 4N03A 3BKXA 3WL8A 4ENRA 5B64A 2BDUA 5CB8A 1TYBE 2QTZA 4NWIA 1BW9A 2YUIA 1KQFA 1KFKB 3TOXA 1WL8A 2DG2A 1J0XO 3HS3A 2VATA 4E3WA 2NU7A 2JGRA 5AW7A 1NM5A 2OL4A 4N12A 1Z5PA 4PUHA 1ZHFA 3ZLJA 4YJKA 3HKCA 5AW2A 1EEXB 5K0FA 2C8JA 4M9XA 4KR7A 4BSZA 3R3HA 1U2RA 2C7OA 4GMGA 1POWA 1XWFA 2HSGA 2XNHA 1XRNA 4HH4A 4W1RA 1JNYA 1KC3A 2AEJA 1DLJA 1QFSA 4OG2A 3WV5A 3CVUA 1DXHA 2QVCA 1NE2A 4F5WA 4QYIA 1TNDA 2AJLI 1COZA 3N0TA 4NCIA 4CJXA 2ZKIA 2F8TA 2D8AA 2H29A 3SJUA 3EY9A 3QI2A 1O5OA 1E5DA 3PU6A 4MR9A 3TZBA 4NDNA 2ZIAA 3KUCA 4NBWA 4KNYA 4LSGA 3DYBA 2GZHA 1CUBA 5E4YA 3AETA 1GGJA 1QZXA 3KP1A 3U7GA 1FQWA 5DISB 2X5KO 3N7TA 2ANCA 4JMLA 3FSJX 2D1FA 3HL0A 1GCGA 3PL5A 4ZQEA 2ABWA 1Y8RB 3MCAA 2FJPA 3OE7D 5CAEB 2D1TA 4IJUA 1OZAA 4Z4GA 1K3FA 1WXFA 4H7DA 1C8LA 4Z4CA 1KKMA 4TV8F 4HGOA 4HX5A 1ORIA 1MIOB 2GHIA 1I8TA 4KDCA 5E4JA 2KJQA 4HDSA 5K85A 2UVPB 3T9AA 1RZRA 4FEGA 1PCXA 3R7BA 3P9IA 1XDWA 2GARA 3SDSA 3SXJA 5FIUA 2OHHA 4RZ3A 4KE8A 1XRPA 2ODBA 4ZAXA 4G26A 5BV1A 2AR9A 3CRMA 3FMOB 3UK7A 4LBYA 4X20A 3J80A 1MNQA 4HNQA 1LY1A 2WUDA 1K7FB 5F35A 2OD9A 4DTCA 5L3VA 3ELDA 1YE8A 2C2XA 1ZMBA 3JVUA 2J9RA 4JP3A 3AONB 4JUCA 1ESEA 5IF9A 2YWFA 4DG9A 2R84A 3KQNA 1QPZA 2QRJA 1S6YA 2NYRA 5DMHA 1H69A 1UP6A 4UHKA 2R7AA 4CKEA 2EBUA 2GN8A 3G8YA 1T1SA 3ORSA 2IUUA 4WXMA 4MPDA 2PHZA 3DSRA 1I0IA 1IAQA 1Q91A 2AX4A 2Z51A 2E6UX 2JAOA 2Z56A 4J2HA 1EAMA 1ECJA 3A2MA 4FPXA 3OQVA 4QHTA 1XVVA 1XP5A 3EPLA 4WNCA 1XMJA 3U4QA 5TR9A 3U44B 1BE6A 2LE0A 2P4EA 2W58A 3CQ9A 5FI3A 4CIAA 1EVLA 3GQBA 2I1QA 2IDZA 4K1LA 1W5SA 1QOQB 1VGVA 4OK6A 4HLCA 5CT8A 1V26A 2FMIA 4DEXA 2VQ3A 1MJNA 3LX8A 1QG0A 3FAZA 2DX7A 4Q1FA 3JZDA 1XNGA 4Y7CA 3M33A 4Z9YA 1O6BA 1ZN7A 2XF2A 3OZRA 4I19A 3TB4A 3C3DA 5JS7A 1P31A 3MWEB 4WQMA 4CEHA 4MA4A 4C7MA 1KTIA 5EYPA 3K9NA 3QVWA 2X9QA 3TFQA 3UMFA 1Y80A 1FFAA 4DIUA 2WUGA 4L28A 2GOYA 3VV2A 3S2EA 3RTAA 2D7JA 2ZRCA 4FILA 1N4AA 3PDIA 5I7AA 3MFYA 2BYTA 3H1TA 3PNBA 2AFHB 1IDN1 5CYOA 2CVHA 4ZZ1A 4H3KB 4YV7A 2AKAB 4KBGA 5FPQA 4IGEA 3RT7A 5KNBH 1GPH1 1P0CA 4IJQA 4BVFA 2O7NA 1JHAA 2H5JA 1ZOOA 3KEMA 1YJCA 3AFIA 2GKGA 4BFTA 3DVAA 2QI9F 1XTBA 5K51A 1RRGA 1YS4A 4ZQCB 1FFWA 1ZNXA 3QG5A 1JIIA 4FSDA 1PT6A 3BN3A 4PNHA 4ZODA 4JKOA 4XUEA 4EPRA 1BXKA 3K1AB 3G5LA 3TIVA 3KSAC 4DC1A 1VB3A 2WAAA 2F48A 5F9FA 2FMFA 4F9GA 4CG1A 4HOYA 4DQXA 3O6VA 4EPWA 5MFPA 3RFFA 2VT6A 1DC6A 4MJXA 1R27A 1YWGO 2GZ1A 4M49A 2ZIZA 1QP8A 4BCBA 1QK5A 3OE5A 1ZGCA 4IV8A 5L6LB 1FYVA 5CDFA 2OCPA 3MPUA 4QGHA 1USUA 1V5GA 1AHHA 1N0VC 3GMDA 4R2JA 1P5FA 3IHTA 3QELA 1QNLA 1Y1TA 4GM1A 4TQGA 1DG1G 3VAYA 5LQUA 2GX6A 2CXPA 3JX9A 3ZDBA 5LFAA 5CITA 4MTCA 3HV0A 3GB9A 2B4RO 3S0JA 4XTCS 5LYJA 4FJ0A 4UNPA 1IHUA 3HXLA 5JYEA 3ASZA 2C3MA 4H18A 2BIFA 3P2OA 4YRJA 3OICA 1TIBA 3Q85A 3WLHA 5B6IA 4RADA 3MMPA 4M1OA 4KOEC 4Z8YA 3WLLA 1NATA 4AJ1A 4E4RA 1AKNA 3W1WA 1GXSA 3R24A 4Z49A 1T6ZA 5K8FA 4AWAA 3ZV5A 3WXBA 2VZLA 2BHTA 2FN7A 5JXGA 3MHTA 3LRPA 4MKFA 4DL9A 1R37A 5F2KA 4ARBA 2H1HA 3KEFA 5IYZA 2ZZMA 4WK2B 5DE3A 4G2TA 1UBOS 3BRCA 1PW5A 1Z33A 2OAGA 4R6WA 5EJ2A 4ZZIA 3KM0A 4KAXA 4PLGA 4CM6A 1Y1SA 1R3UA 1EGQA 3R20A 4NK4A 5G0SA 1CHDA 2CHFA 2DBRA 5AKXA 1U9ZA 3W77A 3WFZA 1QYRA 5MN5A 2GXAA 3OQBA 1PJBA 1GUDA 3I5UA 3IL2A 4K6OA 2CF5A 3P9XA 4D25A 2JAWA 3B1VA 1KJJA 4GLJA 5CM9C 2GAIA 1MVLA 4NQZA 3J7AC 2AZTA 3D8BA 2A78A 1QF9A 2NO6A 2QMQA 4FOSA 3TR0A 2CMDA 3KQYA 4KLAA 4OXYA 4AMZA 4I5IA 4NJMA 3IIKA 2RGNC 1TRHA 1KFCB 5L7YA 4IMRA 5EMJA 3RHZA 4RTSA 1KVTA 2FWBA 4IFBA 3ZR4B 1U8FO 3IV6A 2Q2NA 2Q3JA 4LZPA 4DW8A 2C4UA 3I1YA 1W29A 4XVUA 2WVJA 1I7PA 1LTHR 2NVUA 3HKEA 4PSCA 4GPD1 5H0IA 2JEYA 2B25A 2JS7A 4FXOA 4HS9A 5JC8A 3FLBA 5AKYA 1RG9A 2BMVA 1OLSB 2F8MA 2QXTA 2V6BA 1FNMA 2JEOA 2E4YA 2WA2A 3R5SA 3CR8A 4I5GA 4IUBS 1HNXB 1JDTA 2B4AA 2BTOA 3CKKA 3N0RA 4CN8A 2M6LA 3HBFA 2P2MA 5A1GA 5A5VA 1O94D 2BTQB 3PHJA 4RHUA 2RGAA 4P3KA 1AO0A 2BD0A 2CEAA 4LF9B 2V96A 2O3RA 3C3WA 3E4DA 4Y6OA 1TH5A 2C3PA 1TW3A 3MUFA 4UATA 2IH5A 1KYYA 1L4KA 3RVQA 3B3GA 4F3KA 4M87A 3PIDA 1JKJA 5C9ZA 1Q22A 1USGA 2QZ4A 4QUKA 2XNJA 2QENA 3MTQA 1U8XX 2YZGA 3NHMA 2L18A 3LDHA 3OAAD 4G01B 2F1KA 3L1VA 2D7VA 4G5GA 2C1EA 4EHJA 2YKGA 2OPLB 4L73A 5CGQB 3SSNA 2P1RA 1JJIA 1UINA 2PX8A 3IBSA 3EQ9A 2R8OA 4AUNA 1BCSB 1YAJA 1PT5A 2AXPA 4QQ8A 2ZUCA 4TV9B 5K3EA 4MUIA 1P7LA 1AURA 1U1CA 1PUJA 4UXIA 3UPDA 3WX0A 3V48A 4PFSA 3ZQUA 1PW7A 1X1CA 1T8RA 2I9PA 3FDIA 3V1KA 4C07A 2XCLA 1OUMA 3U4HA 2DCUA 5A6VA 3QE3A 4ZOAA 1F2VA 2BMAA 1P29A 2K4MA 1CRZA 2KHZA 1MOZA 2ZP1A 3K8YA 4MTLA 5DX8A 2ZVDA 4KYUA 4MVJE 5IW8A 2BGIA 3IDSA 3L9XA 2R7MA 4MKHA 1AHPA 3OFVA 1M8JA 4QXAA 4I1RA 2AS0A 3WDKA 2RE8A 1SK8A 1ADFA 1M0WA 5C2JB 3BHIA 4IDPA 1U0JA 3FWHA 4N39A 1P1FA 1UMDB 3CLKA 2WUFA 4IIBA 4UU7A 5PGMA 1UWLA 3S2FA 4BB9A 3KPUA 1NQVA 1T24A 4EA8A 4E15A 3GCXA 2OXIA 4DTIA 4EGSA 2VAVA 3E7FA 4JXKA 2QMYA 3QE0A 4M8NE 4Y6GB 5E6UB 3MLEA 3DMTA 2K2WA 5AM1A 2XXAB 1M2WA 1QORA 1NNUA 1CEYA 4C4RA 3CF6R 3CZMA 2WWGA 4FD3A 4OAOA 3D8RA 3EWIA 1TI7A 3KZVA 4H7FA 2WA1A 1IEXA 3WLIA 5I01A 3MG9A 3O8NA 1T10A 4J0GA 1G5TA 3H8JA 2LIVA 5HQ3B 3R7DA 5J4HA 5C8VA 2GI4A 2XOKD 3L8DA 3HU2A 4P7KA 1P4AA 2CXSA 2JVKA 3M5CA 3TIFA 3H8VA 1KDRA 1LLDA 2AHRA 4PS0A 1XS3A 3UXEA 6Q21A 1Z83A 3QVTA 1R6VA 4M8KA 1PTJA 2HDNB 3QITA 4HDOB 3LAWA 1U4NA 3I3SR 3PFFA 5BQOA 4Q3OA 4EGFA 4ZHQF 5JCZA 1SC6A 3QNMA 4P3XA 5KOHA 2AOTA 3ZHBA 4ED9A 3GA5A 4R0MA 3AFOA 4FNMA 4MQUA 5E38A 4HBGA 1P1HA 5C53B 5F12A 3AV3A 2D5CA 1YQ9A 5B12A 4W9RA 2ZKLA 3LNTA 2XV1A 1VTKA 1P61B 4KWCA 4IRMA 4OUDB 3TW0A 2VRCA 3HG7A 2PDAA 1W8DA 3KTOA 3PC7A 4QL3A 3V8RA 2Q2OA 3IQGX 2R25B 1V16B 1YZTA 3QPCA 4FX2A 4MQ6A 5IBQA 3U9SA 4AS3A 5LLDA 3Q11A 3I9OA 1N9GA 1C3OB 1HYBA 3GLIE 4LXYA 4JI6C 1QH9A 3P9YA 1ZB8A 3IS3A 1EU1A 3FFTA 1KP9A 4EH1A 2C00A 1GKUB 1XMXA 1WABA 4FHGA 2G9VA 1M2HA 4QYXA 5AW8A 2XCQA 4MYRA 4XLTA 4WZBB 1A3CA 2WG1A 1LF0A 5GJBA 5GPBA 2VNIA 3OFJA 2QRLA 3D02A 4I4TB 3NNSA 1XMSA 3JAMA 2DWPA 5AW5A 1SMKA 2XIQA 3ZQKA 3GRZA 3IAM1 3N2QA 4GX5A 2PRZA 4PG8A 5IJXA 1EFAA 3BBLA 1TQ6A 2G1PA 2A84A 3DE1X 5E7JA 2VF4X 2VZ9A 1UADA 4LVOA 5E9JA 4G65A 5E3JA 1F6DA 1T9AA 3SHVA 1NUPA 2IYNA 4WKBA 1GDDA 1HYEA 5JADA 4EMSA 3JQCA 4F2HA 1XZFA 4L74A 4UOZA 2OZLA 1B3RA 1II8A 2XHEA 4MR7A 4Q47A 5ALGA 5EHGA 3SBOA 3TXYA 3VUEA 1G20B 2CJYA 3B6JA 1IK4A 3KOMA 1YB6A 2O2HA 4GVXA 3ZWMA 2HNBA 4QU8A 2IXTA 1KEEA 4OB7A 1BJKA 4EI9A 2VHQA 5EMLA 2C92A 2HSJA 3HBAA 3HRKA 4BQFA 1Z22A 4OGLA 1JDBC 1QHFA 3BX1A 1NFRA 1NSFA 3S29A 1DEHA 4LJ8A 1G21B 2QZ9A 3TM5A 2C9YA 5H83A 3PNSA 4Q7EA 5TEWA 1KMCA 1Z62A 2O7SA 1D2NA 2VPTA 4KDRA 4XPIB 4X8LA 4TS4A 2Q3MA 3T8YA 2IQIA 3JQAB 4Q6WA 4OJQA 4BRUA 3OFNA 4LSMA 4Q3KA 1IEVA 4PY2A 2XEDA 1N1EA 2AXQA 2O0LA 4Q4JB 5LUBA 5ITZB 1VYHA 4UDXX 1DMSA 1IK6A 2NZWA 2PGDA 2VP5A 1P19A 3LQYA 5AICA 4Z8XA 4ZCRA 1B4DA 5TPZD 1E60A 3EUFA 3HP4A 3Q8MA 1UJ5A 4YV0A 1D9ZA 3M3PA 4F3CA 1AC5A 2IDJA 3KVYA 4TXJA 3RIEA 4C0QC 5BYKA 3EIEA 1T15A 2B4QA 5AM0A 1FK8A 1G66A 2HZ7A 5AKIA 1JSZA 3PKZA 1RBZA 3UOGA 4EF6A 4UBMA 2WNSA 2CUKA 2ENUA 3MTIA 2V7BA 4JI6B 2VDMB 5FOTA 5JASA 1N2CB 4V39A 3LH5A 2AT1A 4J29A 2GEVA 2BFOA 2H5EA 3SF8B 5IVKA 4BTVA 3HA7A 3GW8A 3IVRA 1JPJA 3KKOA 1EEHA 5I7VA 3UJ8A 1TMKA 2FUEA 4IJWA 2GBLA 3Q8KA 2Y92A 3UYLA 4CMHA 2F8LA 4YECA 1JVSA 1Z47A 3FWKA 2B2NA 4S1WA 3GCDA 1CKEA 3VR5A 2GCPA 4UOEA 3VSDA 3G2LA 1YQGA 1BKSB 3ANLA 5CNMA 3TRJA 1C30B 2PYIA 5DCYA 6AT1A 2HPZA 1KO1A 1GZ5A 3K0KA 3K2IA 3NC4A 4YAEA 5HOQA 5BMOA 4B3SC 3L0OA 1XU9A 4BC7A 1JLRA 3C3PA 4KUEA 4ND4A 4Q9HA 4I1UA 3DT6A 4K8OA 4OATA 4LYFA 1CLEA 2WIBA 5ALMA 1PGPA 1SU7A 1QS0B 1NURA 1KY2A 4BASA 4RDIA 2M5OA 4E1VA 4ES6A 5J58A 4U6SA 4CCYB 3CXUA 4ZARA 5AW0A 2P9GA 1KBQA 3PQ3A 3EVZA 3U4QB 1PZMA 2XUZA 1QBGA 3FUVA 1E2EA 3WO0A 3SQNA 3SC3A 4L0CA 1WCJA 2QLNA 2CXQA 2E1RA 4ERXA 3C8ZA 4C0SA 4RMNA 5FRDA 4JQOA 4Q9IA 1X7HA 5FLYA 1AJEA 4LY3A 2IIVA 2A0XA 3M82A 5D5PA 4CTJA 3EZ9A 4RU1A 1HFKA 2Q6LA 4IQ8A 2J3LA 1CRLA 4RFSB 3PR2B 3H2GA 4IZ6A 4CIWA 4ND8B 3QMPA 3DPSA 4KWEA 5KC8A 1B8NA 4N7RA 3Q3GE 3ZV4A 2Q0HA 6YASA 3SYLA 2ZDGA 3GJ0A 2IW1A 2ZT7A 3QKSA 4RIHA 4ERNA 2B9EA 3CGWA 1LDBA 1CJSA 2HADA 3CGGA 4MIEA 4U1RA 5DOZA 1UBJS 3AUAA 3RT1A 1N1MA 4YPVA 1QP4A 2FZKA 3K72B 3EPPA 1LSUA 1N5KA 1Z34A 1ZMXA 2EL9A 2OZEA 2W2NA 2QVLA 3H84A 3Q12A 4MB6A 3RB8A 1WCIB 1L5HB 3GEDA 2YFYA 4RTNA 3WNCA 5SYNA 2VEDA 1REQB 1A4XA 1HC7A 1ADJA 3KYDA 4HN2A 3U6KA 2AFVA 2ON6A 1GFIA 4U9HS 3V2GA 2O5CA 1RXSA 4M8IA 5LOVB 4OHWA 1JQ3A 1V7QA 3QLUC 3CSDA 4DY6A 2QTHA 3TZCA 4TMZA 1RWBA 2XKBA 3K2EA 4KIFA 3W8EA 1G1AA 2HIMA 5H3CA 2BGWA 3FE2A 2TYSB 3GRAA 5EP1A 2R79A 1DKMA 3N3AC 1O94C 3QUQA 1VIAA 3UFBA 3LC1O 1L7NA 4R5HA 3WMGA 3WSTA 5LD2B 2QTTA 4OV6B 1RMYA 1LI4A 3UUFA 3AHDA 2UYQA 4B6SA 2OCBA 3V4VB 7AT1A 3RRYA 3K70D 2DBQA 2VCEA 2WVHA 2AEMA 2JFHA 4LF5B 1EHYA 2XA1A 1R9NA 1J2UA 3KPJA 4MPTA 4FJ1A 4B3SB 3HFRA 3KHSA 3H7IA 5K05A 5FTJA 5FYQA 2E87A 4NPHA 4Z1MA 4BV9A 1OFVA 3EAFA 2VUHB 2DR3A 4JFRA 3O7MA 1B74A 4ARZA 2V9PA 3OKCA 2VUUA 1SCDA 5JAPA 3SBDA 1X7WA 4KAJA 3GUHA 1I94C 4A8JA 1OBHA 3LLCA 3N0XA 3WQHA 2IXDA 3I1JA 5HRAA 4DEYA 3H9CA 3K8ZA 1VPLA 2FZEA 3DO5A 3KFVA 3O1JC 2WI8A 4TL9A 4GL4A 3K0CC 1XLTA 3KR2A 1PU2A 4HQNA 4YT4A 1DC5A 1XA0A 5K3SA 1TQ2A 3WMRA 5J2UF 3FGNA 2PUEA 3MGCA 2RAFA 3M9XA 1JX6A 2I3ZA 1DFIA 1Q1AA 4NV1A 3HO1A 4MKGA 3AP3A 1XAHA 3C70A 3EA5A 3QLTA 1FB5A 1F14A 2LV8A 2QMOA 3SZRA 1NQUA 3GEBA 3B7GA 4DLXA 5A1JA 5BQFA 3NGLA 5LIRA 4BGUA 5LZ2A 2A3NA 2ZSIA 1JEAA 1XCGB 2C03A 2H3HA 2RHBA 3A06A 3GLVA 3HXPA 3JQPA 3NKVA 4M36A 1ZUIA 4BJ3A 2IUFA 1T5OA 5A19A 4E6PA 3CQ3A 1T0HB 1BE1A 1NUSA 2JKZA 3M5WA 1Y1QA 5ILGA 2DECA 4S1PA 2BGUA 4LBWA 3KNZA 4AJHA 4BFWA 5K0EA 4LDJA 3U48A 2W22A 2XCSB 2R62A 2BFFB 1N2SA 3UJ7A 4ID9A 4JLDA 4AY5A 4LJKA 4XI9A 3IAXA 5E2IA 2CV0A 2VNHA 1AGRA 4DNXA 1RRKA 4ZOBA 4E5DA 3L8YA 1GCIA 3IP8A 1NNSA 2J9XB 2WAYA 3VU8A 2HA7A 4M0KA 3EZ2A 4OQZA 1K86A 4XWKA 4X90A 5FL3A 1OVMA 3G2MA 4ZYXA 2MCQA 5AYVA 4KXWA 5AI4A 1FDSA 2FUNB 2GESA 1BA3A 3N6VA 5REQA 1PR9A 1DXOA 3PV0A 4MUEA 4UVHA 3PXAA 3BSWA 2JIQA 3HJAA 3UICA 3B7WA 4FHFA 2G76A 1X92A 2WWYA 3DAYA 1T9HA 3CURA 2VTBB 1ZKMA 2X8JB 4F0JA 2PUJA 4CLRA 1OFUX 2GERA 1GU1A 1SKBA 2HK6A 4D9NA 4DJTA 4ZV4A 1KR5A 3SQDA 1RXWA 4JEIA 3WNDA 1GNSA 1MH9A 4XWTA 1J56A 5IXJA 4RKQA 1NC1A 5AH0A 1AS0A 4MMYB 4V0SA 3WV4A 4EAQA 4A15A 2PX2A 2YRXA 3DZCA 2HWWA 1XQWA 3AF0A 4O63O 2QD2A 2WUEA 4QEKA 1L4NA 4BMCA 2FRDC 1P7CA 4L57A 4QFMA 2ZTUA 3K0AB 2OVBA 3P8ZA 1USPB 5IS2A 4IZHA 3JPYA 5K3OA 1V4BA 3BWXA 2H2FA 3R0ZA 4X60A 4BKQA 3VX4A 1TEZA 4S1NA 3RABA 1LRJA 4ZAGA 3RU2A 3E9RA 1MEJA 5EKDA 1IBKB 1GUAA 2Z09A 1VHLA 1WEHA 1QFJA 1MX3A 3I6ZA 4NZYA 2A33A 4EO9A 1H9AA 1RZRD 2D13A 5AXBA 2PMWB 3BK2A 3IDFA 4RC9A 5IJZA 2DR0A 3JVDA 4YP9A 3I61A 3HWX1 4I6GA 4YY3C 4HRVA 2X9LA 4IMPA 1BJTA 4M98A 5CIQA 5AIAA 3J80D 3T7DA 5EMNA 1D1PA 2HRQA 3HKBB 1FFHA 4LHZA 4LOLA 4XCXA 4Z7JA 2JFNA 1CIPA 1XEWY 4LF6C 1BC5A 4JGBA 4UM9D 4K5QA 3K16A 2FR8A 1XYVA 2JFWA 1QCYA 5BSEA 1Y3IA 1DELA 4F6RB 5FI5A 5DCLA 1Y8QB 2FG5A 2GEUA 2R96A 1E9RA 3SPXA 1YD7A 1NZDA 1JR3A 4D9CA 1KZHA 4F85A 4OBBA 2FGJA 3R09A 2UUOA 4FUQA 2QN2A 3K20A 3U1VA 1QQTA 1SXHA 4V0ME 1DOHA 4OGKA 4B4WA 3EIUA 1IXYA 1G9SA 2R751 3G49A 1QIIA 1W35A 5J4VA 3DKPA 5GVSA 1WXIA 1ZCFA 4DQLA 1KJNA 2FEMA 1NA5A 2OB2A 3DO8A 3C7KA 4FMDB 2BFEA 2H52A 3BSFA 3K4QA 3R5XA 3R5HA 5EJAA 1QG4A 1QIMA 3AOEC 1C4XA 1PFQA 2BKAA 1CQPA 2Q1WA 1NXPA 2QYSA 3CWZA 4ETNA 1RMTA 4MPJA 4CZ2A 3UJBA 2GCOA 4K6HA 3IJPA 3AKCA 3JWPA 5EE1A 3E03A 1WM1A 3A6EA 4G23A 3FG9A 5LDGA 1G63A 2DKNA 1MAVA 3JALA 3SE7A 2Z2ZA 3T7KA 2EV9A 3OOEA 1W48A 2FGKA 2IU4A 4UNIA 3S5JA 3TRDA 3BH6A 1EUCA 3TDEA 3M70A 4MV1A 4IXWA 5AK0A 3KZXA 1ZN2A 1P91A 3OZUA 3ILHA 1NW3A 3PLAE 1KS2A 1U2DA 4BBJA 4OAPA 5SYAA 1A5BB 2ZCVA 3ABIA 3PWSA 4JYMA 3W5UA 3LD9A 5KSOA 1F12A 1XTSA 4HTFB 4QEZA 4KPUA 3SXUB 4BN0A 1ZN9A 3R1IA 5T4FA 4ADSG 4B6OA 1FMLA 2Z2IA 3VSCA 4NATA 3EPHA 1GGHA 4X3PA 3IOYA 4IIHA 4EG6A 2LDXA 2PSSA 3N8NA 1E7WA 1ZM2A 2Y68A 3Q3EA 4RTKA 2E4WA 3CZQA 3NUGA 1IOWA 1VJDA 4A3SA 2ZEJA 1LDGA 4FZVA 3EB9A 4YY3B 1SD1A 1UZMA 2ONZA 2VHTA 1L0BA 1HE2A 3UJNA 4QUHA 5BV2P 4N5LA 2LZ0A 4HRYA 1C0EA 3ZCRA 4LF6B 1AKWA 3QFFA 1RXUA 3AFGA 3T7RA 4NG5A 1BGVA 4N9WA 2BBSA 2DY0A 3DONA 4GBMA 1GLVA 3WJ1A 4HLQB 3LYUA 2XQVA 2ZRHA 3H4TA 3CZ4A 1MO6A 4LXGA 2PGNA 1TDJA 2WJ4A 5AVYA 5FUVA 4EECA 3DAPA 3A1SA 2W83A 4H6XA 2I03A 4MUYA 1QDUA 3H3FA 4Q3NA 2W6OA 1JHVA 3IE0A 2AQHA 3B6MA 4CHTA 2NTNA 5HRCA 4INAA 1B26A 1FMTA 3IPRA 4ZQGA 4QPZA 2ZRDA 5P21A 3I2YX 4TTRA 1D7AA 5BRAA 4QC2A 1ZYUA 4BVAA 1RQLA 2P9JA 2G04A 4OI0A 3RSSA 1RCTE 4IUYA 4NYMR 3P2IA 2CLOB 4UULA 2XB8A 2Z2KA 1HYGA 3ROMA 2CXOA 4B8ZA 1PJ4A 1ELOA 4RY8A 4TSKA 3DYIA 3UYKA 1ZRSA 5FR2A 4LV8B 1W36B 2SBTA 3Q5GA 2JAHA 3GFFA 5ALHA 4RHCA 4NBKA 4XQ0A 3D43A 3KLMX 2KDNA 1LBHA 3DT8A 4CMIB 3BK7A 4BDTA 3VMMA 4YJ2F 2EFDB 1EBFA 4FTFA 1KZ6A 2BHSA 1KEPA 1F3LA 3ZI0A 3M6IA 4EJSC 2PGIA 3E1GA 4BQSA 3R8FA 2VUIB 1XZEA 3GVIA 1FQKA 4RE5A 4O33A 3PSHA 2R6R1 2HMUA 3EIWA 3HBLA 3TW8A 4Q9NA 4LC9A 3UX2A 2Z57A 4Y2PA 4OHKA 1TAUA 1X9IA 2WE8A 1RM0A 4MIYA 2MSNA 4UEKA 2CHEA 2HNAA 4P7GA 2XCRB 3G0OA 1FSFA 3BMOA 3H1PA 4KUHA 3K9FC 1XJQA 2O2DA 4G1VA 2VP0A 3N1UA 5T5QA 2PT5A 3ZK9A 2DP4E 3GNTA 1Z5OA 4P86A 1K4MA 1R4AA 3K70C 1VKJA 1JWLA 3OCZA 2WT8A 1EFLA 5AVQA 1YR2A 1IJFA 4YACA 5A7FA 3ZX4A 3UGKA 2Y27A 1FRNA 1TO1E 3TZLA 1JSLA 1SOWA 2O23A 2QLMA 2M6SA 5B1SA 3VI3B 3HB1A 2I7VA 2RAPA 1HI9A 2ZYWX 5K8TA 2W6MA 2X2EA 3LHIA 2Q1TA 1YH3A 3LO8A 4INOA 1DTSA 4IYRA 2AJDA 4QU0A 3TFOA 3MERA 1KP3A 3QTLA 4LVCA 2BEUB 3HVKA 2J48A 5A4KA 1TZKA 2VHZA 4OHCA 4Q3CA 3I4LA 2X7HA 2OCDA 3AZPA 3LPLA 4MI6A 1QG6A 2PSEA 3ZZ1A 2E5LC 3BGSA 4R1LA 3OY7A 1VSBA 1P7ZA 1OIWA 1RRPA 1U1GA 3GBVA 2ILTA 2ZRGA 2IGTA 2F3QA 3PQ8A 1OV6A 2F43B 1OXSC 3W5SA 3MJ4A 5HSGA 4RULA 5BR8C 2P9EA 4ZMRA 3VBEA 1S2IA 2B7LA 3RTCA 1VP3A 3RS7A 4PG5A 2WPDA 4P36A 4RPIA 4ARCA 1XKTA 3KLPX 3NT2A 3TMYA 2RHGB 2XGGA 5CD1A 1YFLA 4U5XA 4D3SA 1DTWB 4DMRA 1OJ7A 4EP1A 4XJSA 4CF5A 3UHFA 1IBSA 1SVUA 1T2NA 1X7GA 2BEWA 3EW9A 3BF8A 3HCWA 2ZRPA 1JXOA 1R16A 3GRRA 3TQHA 4E30A 1LC0A 1M2KA 5KPJA 2A7XA 2VFAA 2EHJA 3PHHA 4KE7A 1NE7A 3L1KA 3LKDA 3JD3A 2JLAA 4PWZA 1YC5A 1WF3A 1GPAA 3CRW1 3DEZA 1JZQA 3T5CA 3WWEA 4C0LA 2ZJ5A 4OMUA 5T64A 2GO1A 3PVSA 1AK9A 3UWSA 4QT4A 2BUAA 3SBEA 6REQA 3MW8A 5LB2A 3NVKI 3OE4A 4P98A 4RV9A 1JHPA 3SQOA 4IHJF 4DSNA 1BRMA 5KDDA 2PUGA 5AVUA 1YU6A 2C4KA 2DHDA 4DG5A 1ZLXA 3R3UA 3K05A 1RLUA 4R8LA 3MUNA 4DMHA 1ONOA 4GSYA 2YN2A 4DUPA 2WKSA 5EE5B 5K03A 4BN4A 1FOEB 5JCXA 3K70B 3WFIA 4BBAA 2XT0A 4D9IA 2GTHA 5HIMA 5GV8A 4CT4B 3H18A 4H4CA 4EUKA 2DULA 1CR6A 2V6JA 3A0UA 4Z3DA 1N3IA 4R1OA 4C6RA 5JVDF 4CM4A 1K9SA 1PL8A 4MW5A 5EGNA 4F1KA 1E7SA 3QXGA 1DKNA 2SCUA 1D04A 1RI5A 1SBNE 2VRCD 4BAGA 2DH6A 5KEIA 1RT9A 5E1MA 4BMZA 2PZ8A 4EVQA 1VKOA 2PFSA 3L7OA 3E5RA 5FX2A 3FNBA 2AFRA 2PIDA 5AHOA 1X7XA 1Y63A 3EYAA 2YQ5A 1ENPA 2D0IA 2DT5A 3MJHA 2JFGA 3QMVA 1H0RA 2PWYA 3LBAA 1R9GA 3AJRA 3PXEA 3G89A 3PT9A 3QGMA 5E1DA 3VYWA 4C2TA 4HH1A 4PFJA 1RJDA 1USWA 5BR8B 4BNVA 2PRIA 5TS2A 4UU8A 2ACVA 3TW4A 1IOVA 5DLYA 5DLPA 4LDNA 4QYWA 2E8CA 3EVDA 4O4HA 4AJOA 4WCFA 3UGTA 1SKMA 1YOBA 5HS6A 1J25A 3JAMD 4TV8A 3REGA 1J1UA 1NW9B 2E0IA 5CEFA 1UWVA 1FUUA 1NQAO 1YL6A 5CPBA 4B3TC 2J0VA 2OZPA 3FMIA 4HKTA 2O0KA 4HXGA 4QDXA 2BFCA 3T15A 2QD5A 3UAOA 4QM6A 5ENVA 1MO5A 3GUVA 4YXWD 3KR9A 4C5AA 2O59A 3AIKA 1A7UA 4ZJPA 2VYQA 1BW9B 2IH4A 3QYPA 2O3SA 2CW5A 3H1EA 1H5UA 4JC5A 2EATA 4EO4A 4EHBA 1D4AA 2BGGA 4IO1A 4TVKA 2NU7B 3H4MA 1VLLA 3EZXA 2DMRA 5AKEA 5H82A 1QFYA 1T5TA 4ZRMA 1PJZA 3HKCB 3HYRA 4AJ2A 1OI4A 3G0HA 4CLOA 4JC4A 5TNXA 1UOPA 3A10A 3SC2A 4B75A 4ISCA 4OSPA 3FNHA 1SIBE 3DVSX 4R8RA 2C2OA 4PHGA 4QYIB 2V5UA 4IW3B 2OFFA 2NNLD 9MHTA 4DCMA 1AU9A 3DDNA 4DLSA 4X24A 1W94A 2EFCB 3FB4A 1QHYA 2VZ8A 4MR9B 5M29A 2N0SA 4TSFD 3K8OE 4UBNA 3O21A 3I6IA 4V03A 3WMFA 3AETB 3C1OA 4QPPA 1WZNA 4FW8A 1I3NA 4NBRA 3IP1A 1U2GC 1FYXA 3KL4A 1ZD5A 2C57A 1ZISA 3T4XA 7GPBA 2H0RA 3W5CA 1N7IA 4LZOA 1WUJS 4NBSA 1H1LA 3X44A 4JJ7A 2WJIA 3SI7A 2YWXA 3COVA 2AZ4A 2QT1A 1SGWA 4IIDA 9LDTA 5I4IA 3TR3A 3N2KA 1IY8A 3T7TA 5K8JB 1MENA 2KS6A 1O2DA 4ZCIA 3ZJVA 2PXXA 3TOCA 3UCFA 4F8EA 1YMVA 4HDSB 3PB3A 1ES9A 3DMDA 5DNAA 4QFBA 4M1QA 4R3NA 3AFMA 4ZCPA 2C0QA 2XECA 1EGHA 1MT0A 3ZE8A 4IRUB 5CCXA 4X66B 3ZH9B 4X20B 1NMEA 1UJBA 4A82A 4FFWA 4JP5A 4OL9A 4CMEC 1N32C 3I9JA 3LPNA 4FFBB 4PG6A 1XDDA 4QFCA 3ORQA 3UM9A 3WRVA 4TWAA 2IHNA 3L4EA 4RZ2A 2HHCA 1C9JA 4UUOA 3SS7X 5AKGA 1V39A 1AMUA 1NRWA 5BRJA 4GXRA 5JDCA 4CKEB 4R7GA 3X1DA 1ID1A 4WFKA 4YJHA 1N5DA 1E1RD 4ZJYA 4R16A 4ZVLA 3I64A 4FNGA 1EFTA 1U4OA 1FTWA 1GSAA 4EHNA 4B17A 4Q0MA 3NHBA 4ZVSA 4EB8A 1Y33E 2H1VA 3PXBA 3F4BA 4G0ZA 4XOUA 2BT4A 1BCRA 5KTYA 5HCIA 1E2HA 5IVIA 1WZIA 2TECE 3BCHA 3GQBB 2WFLA 5BUZA 4DR1B 1OASA 3P96A 4KGDA 4C89A 3LLSA 3L7MA 3PICA 4L1KA 5HE8A 3ROTA 4H0CA 4OA5A 4ENQA 2H4XA 3EOZA 1FCJA 1C4WA 1PF7E 3C97A 4RPLA 3DCNA 5CA0F 2P4SA 5HKBA 1KIFA 1KAHA 1VZ2A 4P7JA 3ROQA 5ADVA 3PZRA 4I7EA 5EZQA 4CEHB 5KKAA 4E11A 4WXRA 3DLBA 1FJGC 5EYPB 4OI1A 5KVAA 4W1PA 4OJYA 4RQTA 5DEIA 5DKFA 3L6CA 3PQCA 5D8DA 4G0WA 2YL2A 4JR0A 4GU5A 3U26A 5HUJA 3HO6A 4UTVA 1ST2A 5B5SA 2EP7A 1Z0UA 2DC1A 2OLJA 3ZCTA 4K8RB 4XVHA 4HYYA 4JODA 2IHBA 4MMZB 3HCNA 4YNBA 4N6NA 5TF0A 3LK7A 3WK5A 2VBIA 1K88A 2V9CA 3B82A 4CT0A 5LXTA 1I36A 3H11A 3PX7A 3IQFA 5IN5A 3DVAB 3W5AA 1C0LA 2FWNA 1WP4A 2YOHA 4J0HA 2MDTA 1DT5A 1SBZA 2YHSA 5TB5A 2XEXA 2ADMA 1T0PA 1LF5A 1NBEA 3HUFA 2DRIA 1P4EA 4PE5B 4X92A 4HT3B 1NDQA 3KX2A 4E14A 2J08A 4L08A 5C7OO 4ZVVA 1M0SA 2DLCX 4JDPA 1N32B 1ORTA 1SHZA 4TRMA 5AVTA 2KZ0A 2CFTA 2Q07A 1NX9A 4X63A 3AZOA 3T9EA 5LQCA 5FOQA 4RWZA 5FULA 1EUYA 1AUVA 1XRMA 1JIXA 4WUVA 1PJ8A 5CYGA 3CVWA 4NE2A 3JRXA 3TE7A 4LJ4A 4HUJA 3ZBTA 3QVXA 3PGKA 3QBTA 4M46A 1O8CA 1QYDA 2FSIA 3QELB 1IHYA 4NNPA 2AW5A 1BH2A 2LCIA 5IAEA 1SCBA 1SBYA 1P2FA 2HAEA 3CWQA 4WZBE 1D2MA 1XTUA 4KGXA 1A95A 3PITA 4Z1MD 1S9DA 4BFSA 3KLOA 1GL3A 2WTUA 4TMTA 1PL0A 2Q2QA 3HUEA 4OGFA 3ZZTA 2BY4A 1JALA 1TJYA 4TTQA 4N3CA 5KYYA 1QAMA 1Q0QA 3HZZA 3IILA 4FEYA 1X1RA 3UN1A 1E2DA 2X4GA 4BNWA 3REOA 2WSYB 4PPFA 3J81A 1GXSB 3A9WA 3GG2A 4MB0A 2PSJA 3MMXA 1HE8B 2CN1A 5FOVA 3HK2A 4PFKA 1IHDA 1RLIA 2ODTX 3Q98A 5IYZB 4L16A 2X1LA 2UVQA 2VXCA 3KYJB 1FJGB 1S8FA 1XTTA 2QRUA 2WF5A 3ASVA 4MH0R 4B0OA 4XAQA 4KSYA 4JYCA 4DADA 4FFVA 5I8WA 1HR0C 2PA0A 3RUIA 3V55A 4ZDKA 4WJKB 1JRLA 1ZK3A 5EXEA 3LAXA 5SZJA 4ND2A 1BZYA 2WINI 1TF7A 2N75A 4H9GA 4LY9A 1YDFA 1CJMA 3GA0A 3H2BA 3LIPA 3O0TA 4MLZA 2V0GA 1JAHA 2HA2A 3ZHYA 1IFXA 2OGWA 2WKQA 1E99A 5G4LA 3F3SA 3NTQA 3UB4A 4A16A 1TJ5A 2X77A 1H2XA 2FW1A 3IP6A 5FL7D 2I7XA 2A9FA 3WOHA 3E8MA 1M8KA 5DT2A 2Z2XA 4IUCS 1R8QA 1OTHA 1XRLA 4E2XA 3FYCA 1KTVA 3I01A 2ZBPA 2YBDA 2RHOA 2NVUB 1ODCA 1ZMOA 2OD7A 3HKEB 4HQ6A 2XMBA 2FFJA 1EZ4A 5EJMA 2FMUA 2O8EA 4WK6A 2OLKA 4I36A 2OEPA 1YFZA 2ZOSA 4GOKA 2W93A 4MAFA 1JU4A 2RK6A 1NJ1A 3MELA 4E1BA 1JXQA 4FSXA 2Q5EA 4C6SA 1K6IA 1Z37A 1DDGA 1JZTA 1OIVA 4ND7A 4HFJA 2AKYA 4IOMA 5BWCA 3UVEA 4UQLA 5KYXA 4B6FA 3PEUA 4US1R 4B44A 2A92A 5T6MA 2XTJA 3QW2A 1JKJB 3A32A 5DNCA 1KFJB 3QVOA 4JEHA 4ZHQA 1ZZGA 4WLVA 4M8SA 4TWRA 1CPYA 2WFMA 1UMBA 1XRQA 4QM7A 3WADA 4F96A 1SFRA 2ZSFA 5JMWA 4ETWA 1HLFA 3RKSA 3HJHA 1LFAA 5C32A 2XITA 3BTUA 3D3QA 1G9TA 1D0SA 3L02A 1P1BA 2P1DA 3PFHA 2E4AA 4UCQA 4X9XA 4AYWA 3TSWA 1ESCA 2J85A 1UDBA 4BN5A 5HIAA 1KOGA 4NK5A 2EGGA 4ZANA 4CWAA 5CJJA 4N01A 1Z2CA 4P7BA 2C9CA 4HMOA 5F5NA 3S4YA 4MCHA 4GPBA 5DGIA 2VDOB 3PR1A 4FMCB 3U80A 5H9WA 3OX4A 3TG2A 1L6RA 3AR4A 3WGKA 5KX5F 1FP4A 2CNBA 2WE7A 3ACCA 1SXPA 1HR0B 2G9RA 4C7BA 1TKCA 2E2WA 3I12A 3JQBA 3KKLA 3KWJA 2QE7D 2GR9A 1NI4A 1YQTA 4YCSA 3A27A 3IPAA 4IDHA 1B7GO 5IC4A 1K7SN 4IVNA 3B48A 4NE7A 1BQ3A 2WTEA 1FFDA 4UMEA 5BNFA 1CFZA 1WPXA 2JKVA 2QL8A 1J8DA 1P60A 4LECA 3SFTA 3G2KA 2BFBA 3MXTA 1JR3D 3QF7A 4E31A 5IKEA 3QEKA 1L9XA 2X6TA 2EQAA 1NR7A 2EJVA 2N1BA 2HYIC 5EFOA 2WV7A 1L7OA 4HWTA 1NYRA 3AVVA 5BR7A 2Q0SA 3COWA 3KOYA 3TNJA 1J0CA 2QX6A 1NG1A 1DB3A 1PGQA 1UMKA 1ZCBA 2PYZA 4B0PA 5F33A 2HMWA 2C5SA 5ARDA 1GQRA 1SVNA 4OK3A 4Q1EA 2VTKA 2R6FA 3LK6A 1WXEA 5JBNA 5K0ZA 3X1JA 1M8PA 2OXEA 1F17A 2AOTB 1QVZA 3PA6A 1HTBA 3PDCA 1E9DA 1XMPA 2JFPA 1JXAA 3S44A 1OH8A 1ZBQA 3EVNA 3QENA 1EWYA 4CKZA 2HUPA 1N6OA 2L2QA 2NW6A 2P5TB 1SEPA 3HU3A 3S55A 4B80A 1PL6A 3WGVA 3VA7A 3A2NA 3OZSA 3PK0A 3TTUA 2YJ5A 2YXLA 1H2YA 3M9LA 5HS4A 2NZUG 2F4VC 4EJMA 4G4GA 1KDYA 3RAJA 2VL7A 4GM4A 4IXDA 1KH3A 2YQ4A 1R18A 1SNYA 1N9GB 4AZ3A 2WP0C 2MCFA 2KZFA 1XYYA 2FSGA 2BMFA 3E05A 4LRWA 1ENOA 5EA2A 3FF1A 2EQ5A 3OLZA 1GTJ1 2NACA 3JYLA 1JHUA 2PZBA 4DDWA 1F1BA 1J97A 4JCCA 4AJEA 1B8PA 5KNDA 4E7OA 4WAUA 3JQEA 4PPYA 2PZMA 4Q39A 1W2GA 3WISA 3LSTA 4MWZA 3G02A 3W6UA 1YJXA 4BBYA 3P4XA 3R6LA 3ISVA 1IUNA 1I6MA 1TUGA 4Z4EA 3KXPA 4LRTB 4PC3A 2H00A 4DGQA 1EXVA 4D9KA 2P41A 3K0FA 5E4TA 1E5XA 1UPFA 3KALA 3QXHA 4OH1A 2P62A 3I8SA 3UQYS 4BVEA 3TF5A 2OZLB 1II8B 4MR7B 4XKJA 5FJJA 1DAOA 1TZJA 4EDHA 1ZMRA 4BFZA 1KEEB 3H8WA 1XRCA 1DJQA 2B2XA 5GOZA 3DJFA 4QFDA 2X0NA 5ICMA 1MXBA 4P4LA 3JQ7A 1E5QA 3HTXA 1P4GA 4G84A 3WNZA 2L82A 3R6WA 2GSDA 3GARA 2IEZA 2BFPA 2QRGA 3D2CA 4IZIA 3EXEA 4OH7A 3WGLA 4XR4A 1AB5A 4TLLB 4EFMA 1IIBA 1A50B 4Z4QA 4QARA 4E5YA 1XMQC 4DC9A 5GP1A 2RGYA 1GSHA 1L7XA 4AZTA 3N0WA 1RR6A 4L8LA 4QQKA 3RVBA 3ZK8A 2XI4A 1XZQA 2VJPA 2R4TA 4I3GA 3S7ZA 4ALLA 2ONKA 3AI3A 5K3CA 2O2GA 4ZO4A 4M1EA 1W7AA 3TL2A 2JF0A 4DLNA 2YFQA 1VQ1A 3AF5A 4KO2S 1MN6A 4YJ3F 4PQGA 1TA0A 2QMZA 3JQ9A 2I9KA 2IQ5A 1H05A 1Q0PA 2ZRFA 3D7MA 3GCWA 3IMFA 1M1XB 2R97A 1NN0A 3SLKA 3FI9A 2F4VB 1S5PA 3N76A 2IVFA 4UAUA 3QVSA 2NVWA 3W3AA 4OHUA 1KAOA 4TYMA 4DWOA 4FLFA 1XDUA 1XIVA 4ODJA 3WJ2A 3L06A 2WSIA 1COWD 1JSCA 2F4NA 4EOGA 3RKRA 4WBSA 3MA0A 3OIGA 3ZTWA 6ABPA 3I0NA 3DLAA 1N6RA 2NUTA 3WK6A 2FHPA 1ISSA 1FTGA 3LFHA 3RC2A 4PZYA 1L4EA 3FUUA 5CFQA 2WC1A 2AA3A 3THOA 1IWBB 3ACDA 5JZVA 4RF5A 4IDOA 3TLEA 4GXQA 1PGJA 2C07A 4ZT2A 4YAUA 1EE1A 1ODLA 3C4QA 2N42A 3FY4A 4HSEA 5E1BA 4HXYA 3ZE7A 2Q5HA 2WIKA 3TO5A 3MSCA 3VPFA 1G42A 1OI2A 4Y2GA 2UXBC 3GPIA 5IT9D 4IFTA 4ONEA 3R8CA 1EDDA 1NJSA 5FPKA 2YXBA 1RXIA 3I0ZA 2ET6A 5HILA 3WI7A 1IC6A 1QUEA 3Q8XB 1A5SB 3UJDA 1QKIA 4W1QA 5AI6A 1MOPA 4JB0A 3V4LA 1OKKA 3TRIA 4RTMA 2VHUA 4A8JC 3EDRA 2FX3A 1CY1A 3HA3A 3ORHA 3S8MA 4BQPA 1GG9A 4D8TA 2JLXA 1XE3A 3CPJB 5FI0B 4Y2HA 4TRNA 3O95A 3ODGA 4DNFA 4RORA 4UNRA 4KPGA 1J2YA 5BSUA 3TNDA 4D9GA 3IVCA 1C0IA 2IYEA 4HH3C 1XMQB 3CTMA 2FE4A 1EK6A 3VOTA 2PX5A 1ISHA 3G7SA 2YASA 3GD7A 4D2IA 2IYLD 4C20A 4C7OA 1AUPA