4GXQA

Crystal structure of atp bound rpmatb-bxbclm chimera b1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
505
structure length
476
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAFVVLREFAPSEILAEELAFVDRLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the Substrate Specificity of the Rhodopseudomonas palustris Protein Acetyltransferase RpPat: IDENTIFICATION OF A LOOP CRITICAL FOR RECOGNITION BY RpPat.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
molecule keywords Malonyl CoA synthetase, Benzoate-CoA ligase Chimeric protein
total genus 139
structure length 476
sequence length 505
chains with identical sequence B, C
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gxqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gxqA01
4FUTA 3GPCA 3KXWA 2D1TA 2QVYX 3ITEA 4EATA 5BSRA 4RVNA 3T5BA 4FUQA 3NI2A 1ULTA 2D1QA 3NYQA 5BSUA 5KYVA 1V26A 5D6NA 3G7SA 3VNSA 3IESA 2D1RA 1YJ7A 4D4IA 1RY2A 4GR5A 4E5DA 4IR7A 3TSYA 3WV4A 3FCCA 1T5HX 1T5DX 3NYRA 3DAYA 4DG9A 5BUQA 1MDBA 3EQ6A 4RM2A 4D57A 3O82A 3PBKA 3WVNA 4GXQA 3B7WA 2Y4OA 5BSVA 5JRHA 4G37A 4GXRA 1AMUA 1PG3A 1PG4A 5IFIA 4PZPA 5BURA 2P2QA 3CW8X 3DLPX 2P2MA 3O83A 2V7BA 5K85A 2P2FA 4RVOA 4WV3A 4W8OA 3IEPA 3CW9A 5KEIA 5KYTA 3VNQA 1V25A 3DHVA 2P2JA 2Y4NA 5K8FA 4RLQA 5BUSA 3VNRA 3U17A 3C5EA 3LNVA 4ZJZA 2P20A 3IERA 4M46A 4LGCA 1BA3A 4D4HA 4D4GA 5DWVA 2VSQA 1LCIA 2QVXX 3LAXA 4R1MA 3LGXA 5BSMA 5BSTA 3E7XA 4D56A 3RG2A 4RM3A 4DG8A 4G36A 3R44A 2VZEA 2P2BA 4RMNA 2QW0X 3L8CA 2QVZX 4R0MA 1MDFA 2D1SA 5GTDA 3O84A 3E7WA 3E53A 2WD9A 4R1LA 5E7QA 2Y27A 3FCEA 4OYCA 5DV9A 3U16A 3T5AA 4OXIA 3IVRA 3A9UA 3QYAA 3IPLA 4GS5A 3ETCA 3A9VA 4ISBA 4IZ6A 3WV5A 4RLFA 3RIXA 1MD9A 3T5CA 4GR4A 4U5YD 5BSWA
chains in the Genus database with same CATH superfamily
2LR0A 5E6RA 4LV5B 2BSXA 4Y6LA 3B38A 5LCXA 2H07A 2IDZA 3LC2O 4UEWA 2I29A 1VHTA 2B3DA 3GJSA 3ICVA 1NM5C 4KLRA 4OBXA 5ALWA 5TPWB 4PAOA 4G4IA 1DXHA 3PCRB 4DLVA 2GYWA 4QGBA 2NTEA 4NC9A 5JAOA 3PQ3A 5MFZA 4R7ZA 2Y9MB 1NVEA 4PCUA 4Q3OA 2YN0A 3HN7A 3OO1A 3JQAD 4HAIA 1MG5A 1JSRA 4BBJA 4IR7A 4C0SA 4O4LB 1ZIYA 3PDIB 4YCNA 2L2QA 3R0IA 2DHCA 4GOOD 1PR3A 2OV3A 4J0DA 5HMLA 2WHQA 1G8HA 2JLUA 3M82A 4GMHA 3K4PA 2OHIA 1OI2A 4CKXA 1P19A 5DLQC 4EM6A 3GFRA 1OA0A 1YRHA 4BLQA 5DNEA 4E31A 5IASA 1X1BA 4AAYA 5HR5A 4AROA 1EA7A 3BGVA 3DNPA 3MLBA 2EWVA 2YR0A 3G2QA 5CXXA 2IEGA 4A6XA 4YREA 4QJ4A 1L5KA 2VAMA 3PRKE 4GC5A 4XB2A 4BBYA 4GSYA 4Y6SA 5JMOA 5K3CA 2Y3IA 3MJSA 2Q49A 1AT1A 2H5LA 3B53X 3FETA 4RHXA 4UMEA 1UDWA 4ZMSA 3B1WA 1KK2A 1PP4A 2J85A 4JXXA 4Z4IA 2MSNA 3FUXA 1I4OA 4X1YB 5A0FA 1XCLA 4F4FA 7AT1A 1JDVA 3JAMD 1GZ6A 1E2KA 1U7PA 2Q5CA 1XELA 5ERYA 1L1QA 3K2BA 4MQLA 2W0MA 1LRJA 3CLVA 5KAMA 2WFLA 1O9HA 1DKMA 1UXKA 1D5CA 1QVZA 4HG2A 1HRKA 3NP9A 5IAOA 5IT5A 1DOAA 4C7OB 1DRKA 4OB6A 1ZK2A 2VOJA 4NBVA 1HYQA 1Z6AA 1CUEA 3OSUA 3R3ZA 3SCZA 1JKXA 3C45A 4QGSA 3GPIA 4JI7C 1S4QA 2G8NA 2W90A 1IOWA 2Z5LA 3NZEA 1GGVA 2QLTA 4B46A 4BS9A 5C52B 5JQGA 1U2QA 1XSEA 1F38A 4BLWA 3CWZA 1XR3A 2GETA 4EFMA 1XU4A 3AR7A 4YWHA 1PD1A 2XOEA 4RHCA 1PNVA 4D56A 3GI1A 3I07A 3T7AA 3WQRA 4BQFA 4AS2A 2H9IA 3NJRA 4EB0A 3ON5A 2WYOA 5FWXA 2JD2A 1G3IA 5AI5A 1UBUS 4DBLE 4ENQA 3UJNA 4FFBA 4QDXA 1Z06A 1B0UA 4EPXA 3MTQA 1HORA 3PUWA 2F3UA 2V54A 4Q7EA 2R47A 4GP7A 1I7SB 4QTXA 3U7RA 1IG0A 5IAAA 5C8XA 4ZVPA 5IT4A 1AJEA 4D3FA 3MTAA 1U0RA 3H16A 4RBNA 1K4YA 1D2MA 4FMCB 4GI2A 1N9KA 1YRQA 1UBEA 1ADYA 4N6OA 4O4JA 4Z7NB 4KAXA 4BNUA 2GD1O 1X0XA 4ND7A 4OL0A 3N8KA 1NATA 2G3YA 3I0NA 2JPDA 3QKSB 2C94A 3AKEA 2Q46A 4MVJI 1HDEA 1SO8A 3EXG2 4I9UA 1O5OA 4XWGA 5BWLA 3DXYA 3HCNA 1XNRC 4BO6A 2X0IA 3W8NA 2XLBA 3IBGA 4P54A 2K5UA 5KKAA 4WKCA 4XGNA 2VUTA 2CBGA 4L5YA 2XR1A 3WA6A 5JQWA 4S1PA 3A36A 3AGQA 2GSDA 4XSGA 1NTOA 4EELA 3FNQA 1JKIA 1RWWA 4P7KA 1Z17A 4FGSA 4QT4A 2YKGA 1TTQB 2JJ2A 1ZL2A 1E4VA 2CN1A 4HH1A 4NCJA 2A4MA 4KO4S 3AONB 3EVEA 1JEOA 3TQFA 1M0EA 2OYCA 4EY3A 1HNWB 4IG4A 2PTHA 2DPYA 3LBHA 3PHIA 3W5CA 2WR8A 3QOFA 4I4CA 3BXHA 4RGVA 1TFRA 2CXCA 1J56A 3L7CA 2FMKA 4B4WA 1UKKA 4R2LA 4QAJA 1K8QA 2AIRA 4RHYA 4HFNA 3I0ZA 2QMOA 3ZDRA 1TCAA 2QT0A 1V1RA 5ICMA 5IUKC 3L8EA 1Z18A 2R7LA 3P2IA 1OWLA 1FSFA 4J1SA 3E22B 3NHSA 3CZMA 4G01B 4QTTB 2H1VA 2QUBA 2DOKA 3R7WB 2PJRA 4MUBA 2IX9A 3T5DA 4B3SB 1SBIA 3S70A 1U81A 3H9EO 3Q7RA 4RH0A 4DR6C 2Y0DA 3CNNA 4QWMA 2DAPA 4J4BA 3LZCA 2QD4A 4S1NA 5HOEA 2MCQA 4KSCA 1NW8A 4JI7B 4Y8VA 3WHKA 3DTYA 3PVSA 3O8BA 4AW9A 3F0TA 5I9IA 1B76A 1DBRA 1Z47A 2DHDA 2JGNA 1QVWA 2ZBDA 3JD0A 3ODPA 3Q8WA 4FR0A 4UXIA 2X1LA 3D5TA 3BDAA 3FOEC 2OCYC 2QG6A 4K9QA 4JYBA 4KXMA 3QQPA 3GRVA 3T38A 1BMDA 2VKQA 3N2YA 4KR0A 1VKRA 1PG5A 1AC5A 3BXGA 3ROFA 4A5OA 3R1IA 1R6TA 4US0R 3JR3A 4YMGA 5EP1A 2RGWA 2MR6A 3QVJA 4JBXA 3G0OA 1T0BA 4IMIB 1JDJA 1KKMA 3AU9A 4RY2A 1Q91A 3ESYA 2BPOA 2G88A 2I6GA 1R15A 2V6FA 4MV4A 5FR1A 4KPEC 3FI0A 1NGSA 1Y0BA 1KDZA 1FYWA 4COKA 4EBBA 1E5VA 4KIWA 3IEUA 1I5RA 1QO0D 1MJGM 4MW6A 5EXSA 1D8TA 5JSZA 1L9XA 3ZKWB 3W6NA 1UFQA 1AO3A 2RGEA 1I2DA 2O0JA 4JT4A 1C7IA 2W6ID 3QI7A 1SQGA 3LOPA 1NURA 3O8DA 4FGLA 1K06A 1M6EX 5FBVB 1VQ1A 4X62B 2IHNA 3PFNA 1QLJA 3E9CA 2PGNA 3R7AA 2GLXA 4E6PA 1VDMA 2B99A 5NULA 3VDNB 3V00A 3G17A 3G3EA 1WF3A 3A4YA 3HWRA 4RVGA 1MX5A 3W1VA 3TMYA 3ZVMA 1RVDA 2PFKA 1PLJA 4BN4A 4EUHA 2CLKB 4EGQA 4ZVLA 2XBLA 4HWSA 3H6GA 4IEFB 4GM1A 3R5KA 3R6GA 2OFFA 3K8ZA 4ILKA 1DZ3A 5A6VA 3TPZA 4W6ZA 1XQVA 3VR6A 3RTAA 4DAOA 1FNDA 2YWXA 5ELMA 4K6OA 4HZGA 5J5VA 1N6IA 3OTHA 3CT6A 1P5ZB 2BGMA 3CKMA 1DRWA 1DTEA 1Z22A 2EWWA 3AF0A 4ZT7A 3T7CA 3MWFA 4D0NA 1EIWA 1H8EA 3ANTA 5AKZA 1N2CB 2P11A 2FW0A 5D1HA 5FFNA 5M04A 2BJWA 3FTFA 9MHTA 3CG4A 3OTWA 4PO3X 1EINA 2R2AA 3EZXA 3JARA 5CX1A 4OREX 4GPAA 3BD7A 2IHBA 2GPAA 3K73O 3HJHA 3O90A 1NT4A 3PB3A 4G8JA 2H7YA 5D51S 1E8DA 4Z0HO 3SZLA 5DLPA 2GBCA 1GN8A 3O4FA 2F67A 3JQDA 4UE6A 5E4JA 4FKMA 5SY9A 1DC3A 5K6AC 1DC6A 4O02B 3LO8A 4PLPA 3COYA 2XNHA 5AXBA 4F4HA 4RTSA 1AH2A 4MVWA 3NT4A 3N2ZB 1EUDA 3AUJB 2ODEA 2CL6X 3IOYA 4IDOA 3RUCA 5BR7A 4RTLA 2O8BB 4RL6A 1DKQA 4WDRA 2B8JA 2GVNA 1T9ZA 4TTVA 4JYAC 2CEKA 2HIMA 4TMTA 4E33A 3ETLA 4KBFA 4XD2A 1A8UA 3B78A 4QBTA 3UYLA 1EUCB 2BUBA 2QD3A 1DJNA 3KXLA 3L7IA 1IK6A 5DM0A 4HNRA 3OT5A 5ICCA 4OKSA 3A6PC 2DBYA 3WQBA 4U1RA 3OIGA 3UJBA 2AYZA 1TK9A 1O94C 3QQ5A 2JGMA 2NCLA 1CUDA 2FJ0A 4MROA 4U3JB 4MH4A 2COUA 3FKQA 2Z51A 3IMFA 1ZGBA 3EXIB 1C3OB 3VHRA 4K0KB 5K45A 1C3VA 1HC7A 1S2GA 2CJYA 1KNQA 3CZQA 2CXRA 3LX8A 5ALNA 5G4KB 4ZZ2A 3WISA 5BSHA 5JBQA 4Z4QA 4JHXA 1P17A 1ZD2P 3E3OA 3TTUA 2WWYA 1DHTA 4JENA 2HA5A 1YUNA 2HM7A 4DUYC 4QATA 1VMAA 3I76A 4NFSA 2HXSA 3A58B 1P6XA 3IJPA 4F04A 2M5HA 3AR5A 2EP8A 1UFOA 2R6R1 2PIDA 2W4MA 1HZJA 5SICE 4EI9A 2PMWB 4JEHA 1N0WA 1FDOA 3UPDA 2V74B 1OAAA 5BQFA 2FWPA 4KAJA 4CDNA 5I7UA 3RANA 1CWUA 4E09A 4KPYA 3UK2A 1APBA 2O2JA 1LX6A 2C31A 1B6RA 1BWRA 5A4MS 4WZ6A 3O2SB 2D7DA 4UAVA 2QKYA 4F3TA 1ZNQO 3I2FA 3CLUC 1A96A 5IKPA 3CLRD 3SF0A 3KQNA 5EE9A 4QGAA 4KVFA 1ECJA 4Q4LA 1PFWA 2J32A 4WXYB 2BM1A 4YWJA 4GXNA 2D4HA 5IX8A 16PKA 4R9RA 1KI8A 2HW8A 2P41A 4RJIA 3QU5A 5FI0B 3TTVA 2RGXA 3IMCA 4FSXA 4F6LA 4L5AA 3TOXA 2ZDQA 3AHDA 1HT0A 2VLIA 4TLEA 1C81A 3O4HA 3A1FA 1JHRA 1QHSA 2IYSA 3WWZA 2YNMD 4B7XA 1OXKB 1YCDA 2WJZB 3T15A 5FL7A 4IDFA 3BCHA 3ZCSA 2EBHX 3R9WA 3AB7A 3E5MA 3EVGA 1MEOA 4FOSA 4XUGB 4AURA 3UN1A 1U2DC 5ITZA 2JFNA 1T6ZA 2P6OA 4GI1A 1JILA 3KUXA 4P0PB 4H6XA 2RAPA 1P2BA 5LQKA 4BJ6A 2ZS9A 3NGMA 3H2HA 4ISBA 1MUUA 4QDTA 1E1CA 4IIFA 4RVDA 3VR6H 3A4NA 4LRYA 1FNCA 3FPGA 1EP9A 2H7XA 2UYYA 4NJEA 3B8HA 1QF7A 2IY9A 2NO1A 3LBAA 1NVWQ 1NKTA 1CUCA 1UBOS 5ALYA 4KTTE 1J5XA 1WXEA 2JFUA 2NV0A 1E5QA 2RH4A 3A4TA 4J6EA 4AX8A 4R1TA 4BLRA 4CV1A 4B3GA 1HLPA 1KMMA 2F43A 2JEYA 5IYZF 2GR9A 3IQIX 4LQLA 1ZG3A 3NP7A 2BFNA 4OQNA 3JAKB 4KXUA 5C8YB 2QTFA 2UUPA 4HB0A 3JXEA 2A84A 1WVIA 2YJ3A 3BXXA 1YRYE 4MMXB 4MULA 1F5SA 1BCRB 5JXWA 5FOSA 3DFZA 2ZE5A 4MCAA 2HXYA 2YWHA 2Q5JA 4NYIQ 2Q5EA 4X20A 3WRWA 3ZI7A 4MYRA 1RQRA 3UENA 4ALMA 5J23A 4UMVA 4ER3A 3HWSA 1JX6A 2IUTA 2ZSKA 4C0HA 2H3HA 1IBKB 3QLVA 3PNSA 5I9LA 1FUIA 1TNDA 2ODAA 3JVIA 3OQIA 4K9LA 5TEWA 4WW0A 2VHVA 2Z8ZA 1PYOA 1G8FA 5IARA 2IEYA 1V8ZA 2FE1A 4DCVA 1GV1A 1Z5WA 3FJYA 2HBQA 4H16A 2QZ4A 3FNIA 4LBVA 2RK6A 5D3ZA 1K68A 3USES 3GRKA 5EZYA 2FCRA 3AV0B 1VXRA 1EGMB 1YU9A 2BBOA 5ESXA 3VJKA 3W7BA 3U80A 2R4UA 5JRDS 1T6YA 2CCJA 2AW3A 2HCJB 5JCXA 1T5OA 1B2LA 4TMKA 3HSYA 3RF7A 1ZCAA 3FRHA 3VMFA 4L0CA 2ID4A 1ABBA 2X8WA 1CY4A 2QENA 1T5IA 3ZWDA 3H5IA 1A9XA 4B3TB 3G0BA 1T2UA 4NOZA 1TJNA 3EFHA 4WUTA 1Z4KA 5K3FA 3IE1A 2PWBA 1M5TA 3AESB 4C5AA 2B82A 4LF9B 4D4KA 5AIAA 4QX6A 1B8OA 4EYSA 2QL5A 3AHHA 3GCDA 4YRGA 3OPYI 4LF8B 3HS3A 3SZRA 4TKVB 4C2TA 3OPYA 1FU8A 1P61B 1KK0A 2FSHA 3RFUA 3TJMA 2JH8A 1T1IA 4L6IA 3RUFA 3LXXA 1JZTA 3AG6A 3HVHA 4LRQA 1EJ2A 3P9SA 3BICA 1NPYA 2W6MA 4IRUB 2OC4A 4JITA 4S3MA 5KTNA 5GONF 1K4KA 5AKKA 2O59A 2ZT7A 2OHXA 4YJKA 4IFTA 3COJA 2ZYVX 5D3QA 2A1UB 1W2WB 1ZD8A 4OLAA 1MPTA 1JP7A 1MTOA 1YKFA 3E81A 3JARB 3PQ4A 4P4NA 5CX1B 5ALMA 4HEA6 5AR1A 5T8KA 3LKVA 3IT2A 3BF7A 1MO6A 1TZ2A 1VYTA 2WDZA 2V7TA 2XOKD 5AI4A 4URHA 2O0LA 3TINA 3KE8A 3JVVA 1UKAA 4Q6WA 1SXJB 4A2QA 3RM3A 5A9SB 1ZH4A 4GMFA 4K03A 3QYAA 5IP5A 4KZKA 4GMDA 3L79A 3WBKA 1L5GB 3LQQA 5KX5A 4FHCA 5B1DA 3RCBA 3CU5A 2G71A 3MWDB 3IIEA 4P3KA 4BC7A 3QVKA 3MXTA 2A9VA 2FE4A 2D6FA 2VAXA 4JCCA 1WCYA 4NKRA 4MJ7A 1OZAA 2W98A 5G0UA 4BBZA 4EA8A 5AVQA 3ZLJA 1RPTA 1KQFA 2C5GA 1JALA 5TX7A 3VYRB 2HA2A 2C9DA 2BGTA 1PWEA 2RJ3A 3HB9A 1Z2OX 1ZI8A 1QH8A 1B74A 3ETGA 4X41A 3U44B 4KL8S 3L6CA 5F5LA 5DM1A 1ONNA 3L6UA 4US2R 1Z3CA 1I2ZA 3O2NA 5JMPA 5ECYA 1JHXA 2JKYA 2XB6A 3QMVA 5KYVA 3HYSA 2IEZA 3GAZA 3V6LA 1BEZA 5CFLA 1W36B 5E8RA 4YAOA 1CLUA 3WNBA 1UF9A 1FFSA 5C0OE 5AW3A 1QIJA 2XH8A 3DM9B 1CUFA 4FILA 3BZUA 2ATIA 4BAZA 1S01A 5HM8A 2DWQA 1E6WA 1K7SN 3A6KA 3AETA 3LV8A 2CNWA 3VPDA 2PSEA 4HAUA 1QGUB 3OIVA 1FUGA 4K7JA 1Y4SA 5G1PA 2XMZA 3HZHA 3DEZA 1FOEB 5YASA 3FDXA 5J9FA 2XIQA 2E6KA 2Y6VA 1L5LA 4DN6A 4FE4A 3DTVD 2P2LA 4ENWA 1E62A 1KI3A 5BPHA 5F64A 4Q7QA 4X8OA 5KTKA 4DADA 1E9AA 3NDJA 1QO7A 1QHGA 2IVZA 3LIIA 3T1HC 2WSSA 4NPHA 1XNRB 2RCYA 3PQDA 2NTNA 3NOQA 1WCIA 1JDBC 1FQOA 4H7FA 4Q0MA 5DXAA 3Q9SA 4YX9A 2GSWA 2NAFA 1WKBA 2H5IA 2IXBA 3FR8A 1CUAA 2BDTA 4IYRA 4IZOA 4B8WA 1YQDA 4BGIA 4MARA 3CF4A 3C7AA 1THZA 1U5CA 3WDKA 4OX9C 5BW5A 4DV0C 1G3MA 1F48A 1H85A 3IO3A 1Y33E 3OE7A 1NUPA 2PPVA 3IIIA 5TPWA 2VFAA 4FYMA 5CB6A 4JR0A 4BQOA 3G9ZA 3HI4A 2FZVA 1TM4E 1NF3A 3V4VB 4KR7A 1C7FA 2ZANA 3ND6A 1Y6FA 5GM1A 3ZWOA 4RJLA 1VE3A 4UM5A 5BWMA 1ZUD1 1ODKA 2EKZA 3F3KA 3FNEA 4JY7A 3ZU3A 4N6GA 1QU3A 1PVDA 2F3SA 4P3NA 2AG6A 4PYQA 1EEHA 1P60A 3I04M 1Z73A 4MJLA 4Q39A 4JXZA 1CB0A 2B92A 1PBTA 2WKRA 5B3KA 2QQ5A 1N5JA 2Q1SA 4PY2A 3BEDA 3VUEA 3WP1B 1LBQA 2EQBA 2WUVA 1DP4A 4DEYA 4L9RA 1QGED 1E1DA 1XEXA 1XKXA 1ZXLA 2G9VA 5HPYB 1BXRB 1P44A 1BKYA 1EDOA 2OSBA 2PDAA 2XZPA 2Q3DA 4P31A 5IANA 3SO4A 1XA3A 5ILOA 1BFUA 1PRYA 4RMNA 3UGQA 3PD7A 4CKWB 5I9NA 1K3FA 2BFCB 1NRJB 1JJIA 2JGEA 4G26A 4XWAA 5B64A 3R3WA 1X7WB 1W5FA 1V7PC 2GO1A 3N2NA 4P5PA 3RC2A 2FJUA 3DF7A 3Q5GA 3VAAA 5AVYA 5H9WA 4Z9FA 5JRJA 4Y1RA 3R5TA 4KFCA 3OMLA 3W5BA 5EHGA 1UZLA 1A4IA 1OZ0A 1RRVA 1U0OC 3CLTD 1ZCZA 4M8IA 4AG3A 4E3ZA 5C1BA 1I1NA 3GLFB 4NICA 5FUBA 1GGNA 3Q40A 1CX9B 1J2TA 1JBEA 1HYEA 4ENRA 5CT9A 4LJ4A 4PIPA 5LMNB 2HSZA 3D6TB 1QIFA 1PG2A 3W9SA 2EW8A 3PQ5A 4GIBA 4U7JA 2JHAA 3IILA 4ETWA 2J4FA 3JWJA 4YHHB 1OF1A 1M7BA 4F5ZA 2VJAA 1ZIDA 1DWPA 2MYPA 2QTLA 3TNFA 1JDUA 3R5SA 4B2IA 3J81A 1P0IA 2IHTA 4GYWA 5GM2A 2V9CA 5LD2B 4EATA 2DFLA 3EFBA 1UWCA 1QDLB 1W4BA 3IDQA 3OKFA 1CBUA 2IU0A 3CQ1A 4MUYA 2JS7A 4RQUA 5BN4A 1ADFA 1W96A 4XVQA 4ND5A 3F9CA 2X9VA 4OJKA 4J7XA 1E4YA 2QL9A 3F2VA 4TXHA 5KYXA 4HNQA 1AHNA 4KFTA 3FHJA 4OEHA 2HA0A 1KH2A 3BMOA 4YMTA 3DF9A 1A7UA 1G9TA 4RVHA 3DWEX 4J1TC 4CNQA 2JI9A 1RJGA 4IF6A 2XQFA 2XWJI 5FUYA 3TXYA 1IHOA 2HYDA 2RBKA 3U31A 3KE9A 1RC1A 1VIDA 4BECA 5DTQA 5DZSA 1Y6RA 3MMNA 3GGCA 4RF3A 1UOQA 4XASA 2CZCA 2V3WA 4M22A 1DU4A 3U3MA 1LFDB 3DE2X 1NSTA 1WOMA 1XTRA 1UH5A 1UEJA 1M2VB 2VP6A 3HV2A 1EZ1A 4ZANA 1L7XA 3KV1A 1Z5OA 2XKJE 3N39C 2L69A 3JY6A 3WGVA 1KZ1A 1N33B 4INJA 3QVWA 2Q3MA 2XT6A 1E9RA 3I1IA 4P2GA 4OOEA 1SVOA 1NN5A 1UBCA 5FYQA 2JIZA 4MWEA 2Y2VA 3AM5A 2GBPA 5CG2A 1ABEA 2HOQA 1YR8A 5HZKA 1SVLA 4HRYA 5CUQA 3WWCA 5KTSA 2OGWA 3RO7A 3K7EA 3UM9A 1V5EA 1XLUA 2RBEA 4DIUA 1PIWA 1NBHA 1RABA 1NBMA 1D5WA 2YRWA 1ZITA 3I6BA 4HC4A 4MVJF 4U6QA 4UUPA 3UC9A 3MCUA 1AK9A 3WL3A 1KJIA 4F60A 4N7BA 1NQOA 4PQRA 2TYSB 4KNYA 5KYXB 3PXUA 1EE1A 1KXJA 4JQCA 4NZOA 2N3ZA 5THKA 3R8XA 5JAMA 2VH1A 2EQ5A 5I7HA 2GYVA 2Y1LA 5CYPA 3SR3A 4ZGBA 5ICSA 1JHZA 1T0UA 1U9ZA 3KVOA 3MMZA 3V1YA 4BQNA 1H94A 1FRVA 5CA1F 3RVSA 3AJDA 3FW1A 5C1PA 4L02A 3CEMA 4OHBA 5IJAA 4BE9A 4MGZR 2OZLA 2CV1A 1HXHA 1WHTB 5GONB 1C1XB 3ANMA 2G1JA 5EIHA 3TW8A 4EJSA 5L6LB 4MA5A 1WBBA 4DLZA 2GZ2A 3UAOA 1M75A 3WO1A 1CULC 4R2WA 3IDOA 3LRXA 2GF0A 3NNNA 1NNLA 3NBMA 4Y2VA 3R9IA 3P4XA 2HC9A 3CO0S 3E3LA 3FKSD 3JPYA 5KTTA 1NKSA 4DM7A 1FJ2A 3JV7A 3QMPA 4J91A 3G2KA 2V45A 1B8PA 4Q05A 1O94A 2C4UA 2QL6A 2ZIXA 4LE2A 2EFGA 4XSVA 2E48A 4EUKA 3Q1KA 1M5UA 4IGAA 4FYPA 5CB4A 3ZEAA 3X1KA 1R6AA 1GA6A 3D0QA 3SIXA 4B76A 5DSZA 1X92A 1TYZA 1VB3A 1E63A 4AF7A 1J8DA 2PXHA 4YAWA 1T9HA 4CR6A 1O0CA 3EJ6A 2CY0A 4YP9A 2X8AA 2FP4A 2VSXA 2WJGA 1YH3A 1IVYA 2DKNA 1QG2A 1KWKA 2YBDA 3GLHA 2J3EA 1PEKE 1UM9A 1G18A 3RW9A 3LK7A 3ONNA 4LXGA 3ZW9A 4M0MA 1T24A 4C4TA 2Z8YM 1E3WB 1ZKDA 2XWSA 3RC8A 2ZRFA 1Q77A 2XMSA 1T5BA 1P0QA 2JGDA 4RD3A 4RIGA 3IUEA 5BN5A 4CU2A 4WL0A 3S1AA 2P27A 1OLXB 4EY7A 4Y2TA 4LDNA 3LBFA 3ZKAA 1G7TA 4QBIA 2JGLA 1PS8A 2HU5A 3C97A 1NW4A 1JFRA 3EC7A 1QIIA 4R2XA 2NZUG 1MRZA 5DFAA 1DBWA 3EXAA 2V0NA 1AUOA 4I6GA 1XDZA 5A3QA 2WY2D 1T9GR 1NLFA 3RV2A 1XVLA 4HP8A 1NMYA 5I45A 3C4QA 3RROA 5AI6A 1YC2A 4ZICA 4QDKA 2EX0A 1DTWB 3GMDA 3UA4A 1OSNA 4IDNA 4Q5IA 2IS4A 3ZJTA 4CIBA 1T9BA 3HBLA 1F0KA 3DBLA 2WU1A 1E2JA 1JLMA 4D74A 2IYPA 4KWEA 3DNMA 3RBVA 1UDXA 3I34X 4OFZA 4IH4A 5IYZB 5LQAA 4DABA 5EUQB 4PBSA 1J9ZA 1GUDA 1S3IA 5AKIA 4BVBA 4DDKA 4DHWA 3WAGA 5DSXA 3HB5X 3H9BA 4KACA 4FSDA 4TWZA 5AQ1A 1T2FA 2AUTA 3UJ8A 4B5LA 2V7BA 4CIAA 3VSEA 1GKUB 2QTVB 1EZ4A 1J0CA 3MN1A 1OWOA 2EZTA 3F6YA 3LC0A 2E4AA 2ZW9A 3DKKA 4X20B 1BN6A 1YB4A 5DX0A 5EQDA 3ZN2A 4U2BA 2JLWA 1MAAA 4X71A 2PUTA 4I50B 4QUJA 5KNBA 4FYYA 5IMSA 4J16C 4LWQA 1P75A 5U4QA 4FHGA 3AW9A 3GIDA 3LQYA 3FVWA 3W6UA 3N1UA 1GAJA 1X9HA 2FW6A 2E1RA 4WAUA 4BO5A 2ERXA 6CHYA 4YDSA 3AIKA 4H3VA 4KO8A 4NECA 1CUJA 2XNSA 3MM4A 3OQOA 1Q20A 2H1IA 3DPUA 2TRSB 3U4QB 1N2XA 2PCJA 2H63A 4UBJA 4FFRA 2WIBA 1KKUA 3PFHA 2GK6A 3BSYA 4C29A 4E2FA 1CIPA 3V3KA 5AM3A 5M2QA 3CZRA 1OJLA 1SQFA 3CPJB 3RWOA 1NYQA 1ZN7A 4BNYA 3NCHA 3NWPA 3GZTB 1T8PA 4JI0B 4BUCA 1NW7A 1EDEA 3LL4A 1EWKA 2DTDA 1M1YE 3FMGA 3TRHA 5I7FA 3EG9A 2FEKA 4UTVA 3T7IA 1N34C 1JIKA 1PFVA 2O5CA 5EZYF 4UQPA 4X94A 5IBQA 3CFYA 3IT1A 5EXTA 3I9OA 3LHIA 2O2XA 2EIXA 3BMOB 3FMOB 5CR9A 4Z5XA 2XWQA 2V9PA 3LNTA 4HV4A 3E1GA 3N58A 3K1AA 2IL1A 2EVWX 1XDGA 2GH1A 3PGA1 5FOWA 1KVTA 4Z1OA 3DAOA 3IEVA 1E2LA 3MAAC 2QIPA 3IMGA 5DXFA 3NXKA 3WKCA 3TAHA 3HQ4O 3QEMB 4E13A 1N5IA 4QFBA 3DE5X 2MHCA 3A9VA 1ISJA 2I8CA 3HO6A 4POOA 2HIAA 1C9YA 2ZAGA 2LRHA 4F2DA 3CISA 3PCTA 4UPVA 4XM0A 4RTQA 2A1UA 3E9YA 4TS4A 3DV0B 5MFPA 2BC9A 2YCLA 3LT4A 2PO7A 3CXRA 1ZNYA 1VCMA 4LDAA 4OKIA 2C04A 4QWWA 3WGLA 4CUKA 4BQIA 5JATA 1IB6A 1ZJ6A 2XYRA 2YL2A 3C2QA 3DFKA 3EA5A 1SUAA 4RFSB 2UXDC 5CVUA 2RKWA 4FGUA 1H2BA 3WS7A 4XJSA 3ZLTA 1S89A 2H06A 4NJOA 4G4SP 2P2YA 2YHAA 3O03A 4K26A 3UICA 3VFDA 4D9NA 4DGSA 4H27A 4DY6A 3KVRA 4A1FA 4UTXA 2A58A 2J7PD 3C3WA 3PYXA 4D97A 2EJVA 3N6VA 1NUAA 3IMLA 1ACJA 1B3BA 1Q7BA 2XMCA 3FTQA 1GPLA 3A10A 3IAM6 1OYYA 2ZZMA 1E9EA 2HQRA 2DT5A 4YB8A 3BTSA 4DR1B 5TT0A 4P34A 1EUYA 3MEQA 4Z9XA 3SBOA 1VE6A 3QFRA 5LMZA 1T3LA 2QVBA 1JWBB 2YDYA 3GGJA 4FFNA 4PG5A 3V8RA 1RTKA 4ZQFA 1JDSA 2H4XA 3UA3A 1Q7TA 2WDPA 4XFDA 2IS6A 1GLNA 5HQ3A 2G6TA 3E9ZA 4PLZA 1A5BB 3STVA 3CQ2A 3BEOA 3FYUC 4MQ6A 3TM5A 1JWLA 1FLOA 3FVVA 4EUSA 2QXYA 2XNJA 4OP2A 4CF5A 1KSJA 4RVSA 4KN8A 2IOQA 3AB3A 1T2EA 3X43A 1EQAA 3D3JA 4K6MA 3DLHA 4WKNA 1AS2A 1SIBE 4QOFA 1OU0A 3QJYA 2M2IA 4UAUA 3L04A 1A2QA 1IBMB 1WUKS 3I8SA 4X45A 4BCDA 2UUAB 1EBBA 5HRAA 3EQ9A 1XXHE 2O2IA 3BRWA 5HCUA 1GQ2A 1UJBA 5FIUA 1GGKA 4YO7A 3U7QB 3KBBA 1N2CA 3JVEA 5AESA 3FCSB 3VNQA 2REOA 3CM0A 3G2MA 4GM4A 3WKBA 1Y1QA 4C6HA 3HSKA 4J2HA 1C8LA 2WD7B 1GPNA 4TLLB 1U1DA 1E3DA 2IE0A 3AKYA 3C98A 2FZ4A 3V7WA 2O07A 3REGA 4HMQA 4AXBA 4LUCA 1KU0A 1QG6A 1KORA 1N75A 2WZDA 2X42A 4DVJA 3I42A 1V60A 4G41A 3I6IA 4RKRA 4C30A 4WN9A 2NVWA 3ZNOA 1MVNA 5HZMA 1ENZA 1PKXA 2IHKA 4L3OA 4BX2A 3P0FA 3AJ8A 4N03A 5HW0A 3H2SA 1FLDA 3DUFA 5I7EA 4ETNA 5THQA 1IQPA 1YULA 5CMLA 4HDKA 1V35A 4YP0A 2A9FA 1EFPB 5DGHA 4TL8A 3MILA 1MO5A 4D8WA 4I8XA 1ULSA 4ARBA 4TGLA 1JQKA 4R2IA 1Q14A 4XIGS 2IYRA 5JCJD 1AA6A 1U11A 2HSWA 1AD2A 2VDMB 5CEEA 3KKOA 4QUKA 3LPNA 4CTJA 3ZCQA 4MQBA 2IFTA 5FL7D 1PFUA 5H82A 3BTOA 3Q8XB 1GM5A 4YXWD 5BPFA 1FNSA 1ZD3A 1YIOA 5DI3A 4CKCA 5K3OA 1Z82A 1ZA2A 2JAQA 2P90A 3HPRA 4WCFB 1PR5A 1VMIA 1NXPA 3MJFA 4A2PA 4D43A 4GQBA 3KSMA 4I3HA 3GKUA 2HX1A 2H2WA 4AMGA 1U3VA 4XH9B 1PQUA 4MGIR 2PT6A 4RXTA 1QXSA 2F3QA 1XD9A 2JVIA 2UDPA 2BJOA 3RUEA 2RMKA 3C8MA 3AEQA 3MBIA 1NF9A 3P97A 1G2PA 4YPOA 4FFMA 3DDZX 4B31A 4MUMA 2VJMA 3T3GA 3DZBA 3WLMA 4QYXA 2FPKA 2P67A 3PDJA 5BR8C 4Q1CA 4N0MA 5BSWA 3R5HA 4BB9A 4WFJA 3TNYA 2V1UA 3TUFA 1PX0A 1K7EB 4GLLA 2AMLA 3G8BA 4RY0A 3SSNA 3OJXA 1PEDA 1P3DA 4L0MA 4Q9DA 3H4TA 3N8HA 4H7EA 1HI9A 4HH4A 1UKYA 1V47A 5BSUA 4FMDB 2G72A 3CGGA 5GMOA 1ZUWA 1GPBA 1OC2A 4IJQA 3WGJA 4PLYA 4CV3A 2ZG6A 4RULA 2VL7A 1WMEA 1VFPA 1FUKA 1NAHA 5BOSA 5C9ZA 1U3GA 1FP4A 1KF0A 2LGJA 5FBQB 1JB1A 5A2QA 1L8LA 4AMUA 3JQFC 3IUPA 3S3TA 5LUAA 3GQBB 1BIFA 3PRYA 2A1IA 3ZE7A 3AFIA 2CYAA 5DK6A 3F4BA 4QYIA 1P62B 3F90A 4O1HA 3WL4A 5A1IA 4H3KB 1Q5PA 1QKKA 3IV9A 2VWPA 1KDTA 1WETA 1I4LD 2PH7A 4UUQA 4JI6B 1IUPA 2ZBFA 3IODA 3NVMB 4OP1A 5KC8A 5AHXA 3JQAB 3MOSA 1N3BA 4F3NA 2OBXA 4XI9A 2AFHA 4JJ7A 5CH5A 3CGWA 3ZV4A 4Z9BA 4ZKDA 4U3JA 2XXAA 3DEYX 1V3TA 3QZUA 4AJLA 2YY6A 5GOTA 3ABRB 4DANA 3MSCA 4XCQA 2P6PA 5LDHA 3PD1A 1USIA 2W6QA 3QXXA 4H77A 2VJBA 4K9KA 4DIOA 4MMYB 2DYKA 4HDNB 4TTIA 1RS0A 3TLKA 3C6YA 4TM8A 2HRBA 2XDQB 5KQSA 1A76A 1EK2A 4M7RA 1KJNA 1HH4A 3QJ5A 2WW8A 4IQ0A 3UMSA 1KHTA 2BGWA 3F1KA 3QPWA 4UBKA 1T0PA 1ZJYA 3H9QA 4BO1A 2D5IA 1HBJA 1JNYA 2UXBB 2C98A 2A7QA 1JVSA 3ITNA 2ZBPA 1SVSA 2RJOA 4C0QC 3EF3A 4FDVA 3DULA 3ZE8A 4F9EA 1KDVA 3K16A 5CNKA 2GTIA 1JN0A 3KWMA 4UBIA 3BTVA 3G5LA 4QDJA 4I55F 1EFDN 1GYRA 3RKRA 1CLEA 3GMIA 1ZVJA 5H80A 1UZMA 4O6VA 2IOFA 2ZAMA 2ERYA 1GNSA 3C1OA 4KXLA 3REQA 4EW3A 2XVAA 2XIJA 5H3LA 2P8JA 2ZT5A 3IOBA 5ECGC 3M6LA 5I7AA 4GOMD 2W2NA 3DZCA 3R0ZA 4F6CA 2F8SA 2VEOA 3B9PA 3D59A 3ZZMA 3OQIB 4RQAA 3VTZA 1BCSA 4E14A 2D2FA 3A32A 3PUHA 2W2TA 3CLSC 3LZDA 1PR1A 2XRYA 1CY8A 1KARA 2PG3A 4N5LA 4DLAA 4ZV4A 2PUCA 5AVXA 2D0DA 3P5BA 2GAJA 4UVDA 2GOYA 5LN1A 1KVRA 3CVJA 1NUUA 2CZQA 1T6XA 2XECA 4FNOA 1JQDA 3JAWB 4QC2A 1FW6A 4DR6B 3KJQA 1JECA 3EGWA 1CSEE 1KGSA 3OQVA 5HF6A 4TXNA 1AG9A 1GGMA 2C1ZA 4M53A 3QX7A 4FYXA 4NPCA 1Z56C 1VGQA 3C70A 2QUAA 3GVCA 2XB9A 3I9V1 1L1EA 3A6ZA 4W5TA 3PFKA 5HBRA 1VYUA 5LJIA 3U4HA 3CCCA 2QM0A 5AXDA 3QXJA 5I4KA 3D1VA 2W6CX 4KIFA 3ZCVA 1HE2A 4YRLA 2C5SA 1JSXA 4N8SA 4Q48A 4OJYA 2Q9CA 3N59A 4QLBA 3G1UA 3KOMA 4Q1DA 1RBMA 2H9YA 4Z4CA 1WUHS 1KAMA 2XTZA 1Y37A 2I8AA 1HNWC 4G8DA 5B3LA 1XZKA 2FPGB 4UC0A 1FDRA 4R3NA 5ITZB 1LUAA 1ZGZA 1K4MA 4Q7MB 5HXAA 1BG6A 4AKEA 3URKA 3R41A 4MWDA 2FN4A 3LXUX 3AUKA 4GM0A 3UUGA 2P3LA 4XIYA 3E4CA 1KMIY 1IB8A 3ELUA 4OK6A 2A78A 3CEHA 4DQ0A 1EX1A 1VYVA 3LTEA 4PGAA 4QGFA 2VYNA 4WA8A 3CE9A 4OU4A 1ZU5A 3HCBA 4IHJF 4ALIA 5HKOA 4EG5A 1GAXA 1R5BA 4X8MA 4JB2A 4YALA 4G84A 1DOHA 1XDWA 1M34B 4IX1A 1TM1E 2C0PA 3UCEA 3PLAE 1MENA 3FX2A 1BH6A 3VBCA 4X1KB 2CDNA 2YINC 1LH0A 1YF3A 1ZK1A 3EY4A 5CURA 2EFYA 4L50A 3U3RA 2M9MA 9ABPA 3KZVA 3SBEA 4UKDA 4IJKA 1VG1A 5EGNA 3T7EA 2ZI9A 2NAPA 4IWYA 3PHGA 2NVBA 1YACA 3CUSA 5ENDA 3DW3X 3WFIA 3HTXA 2OVBA 3MFQA 4MYSA 4GX0A 4OUDB 4A0HA 1RXSA 2HL6A 4RCZA 5K7SA 3G7NA 3D81A 5TPZA 1JHUA 4PX2A 4GKJC 5AVSA 2A5LA 3K0CA 4L9WA 1NVAA 4IQFA 5LIPA 3GR1A 2HLDA 4X9XA 2JKZA 3L41A 3F73A 4ZYYA 3OIFA 1U1CA 3WFJA 1BMFD 1M8PA 3HCFA 2WBLC 2ZJ6A 3S2ZA 4DZTA 4RF4A 4PF1A 5IJWA 4DNOA 4XJVA 3FNHA 4DJEC 3HJCA 4XJXA 1IZ8A 3NKVA 2IS2A 2H9AA 2A5FA 1U8EA 2QUHA 5IJXA 2XRMA 3ICPA 4ZVVA 5AVZA 4NCKA 5JJCA 3GLHB 3HN2A 4XPIB 3DO6A 5CITA 1QH1A 5A9TA 5JV5A 1GYQA 3PNYA 4EW2A 3MJEA 5A3RA 3A31A 3FPCA 4IDQA 4GKBA 1D0VA 2FP3A 5CA0B 1KEWA 4LWZA 1FS4A 2SKCA 3S2SA 4DSTA 1IN7A 1YCHA 2HU8A 3SXJA 4NQZA 4AI6A 4JYZA 5C53B 4NONA 4RGBA 3KQKA 2ISCA 2O8BA 2LBPA 1K2VN 3G5MA 5CVCA 4BBAA 1LJ8A 4QUAA 3UZ0A 1RWXA 1XZ8A 1YBMA 1N5DA 1PD0A 3OZXA 4ZEWA 2G07A 5AW0A 3ZLBA 3AQIA 1GTMA 2PHZA 5H59A 5AKJA 4QREA 3OAAD 3QLTA 3KPWA 4D02A 1GHTA 2NVOA 1IHXA 4C4OA 4CEJB 1N2EA 2WAAA 3P7MA 2HXGA 1FS6A 1IN1A 1Z07A 3FWPA 4RMIA 2ZTVA 1GZ3A 4PUIA 4JKYA 2IUUA 3N7UA 3CB2A 4JLVA 1JHPA 2J33A 3T7JA 4O2LA 1UMKA 4H2DA 5A05A 3WNDA 5AUQA 2DLDA 3ETNA 3CEPB 3L4BC 4OIMA 4WOBA 1NIJA 4LK2A 3WYNA 1MHTA 1AX9A 1Y3AA 3AR6A 2VK8A 3ESAA 4MHSA 5HKBA 2R6ZA 2VXBA 4WLEA 4I2VA 4AWAA 2LWIA 1IB0A 1ZXXA 4LOIA 4R9SA 1XO1A 3WHLA 5KOJB 4O8CA 4KITB 2P35A 2CJWA 3GPCA 4R98A 4LTDA 1BGXT 4CTNA 1W0KA 3DDWA 4KMMA 2IH2A 1YC5A 2B2XA 2GM5A 3IQHX 4R01A 3VTFA 1JH9A 2VPXA 4RLSA 1HL3A 1H2RS 1XV5A 2C4HA 4W63A 1VCIA 3THOA 1OFVA 2YW2A 3LBIA 1R3UA 3LQRA 3PDCA 3VC7A 1FZTA 3ANLA 4MX8A 3D2BA 2GEFA 1CZHA 1A9TA 1XZCA 3CV3A 3LCJA 3R8CA 121PA 2UYQA 4A8JC 4EARA 3U3XA 4A15A 5FF9A 3TNDA 1QHHA 5BVHB 3DP9A 3EISA 4KLZA 4I50A 4BV9A 2MYUA 2R5WA 1MDBA 2EJCA 2HKIA 3FE2A 3FNGA 4UPEA 1SPXA 1IBCA 5JMWA 4Z7OB 4AKGA 2W4QA 4PYIA 1I0ZA 2VA8A 2YJ5A 3B8EA 5A02A 2X6RA 4PLWA 4F92B 2ZEJA 4JZKA 4QYSA 4TTAA 5GJCA 4ZU3A 3GO4A 4DT1A 2XX3A 1PKEA 2I1WA 2PT5A 4HR7A 4L22A 4G0UA 1G66A 1SD5A 5INTA 3S5UA 1AN9A 2JAWA 3DVAB 3E9RA 4Q1VA 5CCXA 4JQYA 1A98A 3Q11A 4ZDKA 1E8MA 3QUCA 4PS1A 3ZTYA 4ZYWA 2BE7A 3AY7A 3OZGA 3GR0A 1P91A 5E8JA 3DBLB 1TM5E 5CJJA 5TMBA 3W9UA 3QG5A 3W5DA 1FDIA 1QZZA 5D01A 3MIZA 3HWWA 3EA0A 3F6RA 4W8OA 1ZQ9A 3TR6A 5LNK1 1SCIA 3DEIA 3WWOA 2RD2A 1T2AA 2BFDB 3HRIA 4EZBA 4AZ3A 4RK0A 3RWBA 2ZSAA 4G1VA 1WPRA 4ZJZA 1H1DA 1WVMA 3OWXA 4XARA 2IU4A 1GZHB 1TT5A 3EMKA 3LLMA 2AQHA 3KVYA 4UHKA 5TS2A 4DIDA 3SC2A 2YJ6A 2O7QA 4YJDA 2VT3A 1R8JA 3KXKA 3VA7A 1N4AA 5DWVA 3RI3A 1BXZA 4JIGA 3ZWMA 2QVXX 1Z2NX 1PL8A 1YZNA 2ZT8A 1XCOA 3CVVA 1GAEO 1KDPA 4ZVQA 1QTRA 1O03A 2B21A 2O50A 1XLTA 3RAFC 1DTWA 2YXLA 3TFOA 3SFTA 4V2IA 2F4VC 4MGEA 4E5UA 1NMQA 3BD8A 1SBQA 3GOHA 1OLUB 2HNBA 3MQ4A 1M2GA 5ILQA 3OBIA 4ENTA 4X84A 2W48A 3L02A 4MV1A 3GR6A 4P9NA 3FBWA 4ONEA 5KNBD 1W19A 4LNHA 3TDEA 3KDPA 1KRWA 1THMA 4YUWA 8AT1A 1E6UA 2QAGB 3KTFA 3A3NA 1XZJA 1Q74A 3E53A 3PF9A 3THXB 4ECEA 3TL3A 4OJQA 2IZ7A 3NHZA 1YFKA 1V3UA 1MJGA 3A1DA 1L1FA 3G2LA 4EA7A 1XHFA 2OKCA 4MR9A 4R41A 2W6JA 4CR8A 2BKXA 2VDOB 2GNPA 3K1TA 4I5GA 1GPUA 2W5UA 3FBTA 1MFZA 1U65A 3GFQA 3HB7A 4EGSA 1ZLXA 4O1MA 2C61A 1M73E 1YI8A 2CMFA 2G1UA 3DW1X 2NV6A 4JI4C 3CNOA 5F2OA 1D2NA 2JIRA 2PXCA 3HO8A 3MWYW 3WV5A 1UL1X 1XGKA 2OESA 3C24A 5AVKA 4MAFA 1B41A 4RSMA 3SYMA 1GVNB 3UVEA 3DGEC 5DO9A 3V46A 4B4OA 4UPDA 2GZMA 3LVQE 2P9YA 1X1RA 4OU5A 4UHHA 5BXQC 3BB3A 3Q12A 1JWAB 5CD1A 3D8HA 4QBGB 3M6UA 1OPXA 4KQMA 4NFLA 3I5MA 4W5JA 3TSCA 3ZQKA 3UAYA 3O31A 3CURA 4GLBA 1GL6A 1RYFA 4AXXA 4D45A 3ENVA 3V33A 2JDID 2BR3A 2J4DA 3U5TA 4DB4A 3AOEA 1AMNA 3PDHA 4G81A 4N3NA 3B1JA 1EXDA 1X9GA 1SIWA 1RACA 1PQYA 3PUZA 2OZLB 1EX7A 4OXKA 4HUTA 1KYXA 3HYTA 2VHEA 3U0BA 3RYCA 3MQFA 3AYXB 3DVQX 4PSKA 3GLUA 4YQYA 4BWFB 1ZRSA 2Q0QA 2EJWA 3SYRA 4PLHA 1KJWA 3GFOA 4DDTA 2H85A 2NQTA 2Q3HA 2Q6IA 2R68A 3LWDA 5ER6A 4UTNA 1U1GA 3CLKA 1LGYA 3DMPA 2DPMA 3KAQA 4R51A 3ZLVA 2G1PA 5EJ6A 1QWIA 4GXRA 1W76A 1ZJWA 4X92A 2H8GA 1JIIA 4C5BA 2X4GA 4RD4A 1IHPA 4V0KA 3AMVA 5EHNA 5HIJA 5J2UA 1UXIA 4CL2A 1BZYA 1XTUA 3WLNA 2VHJA 4TZ0A 3BJEA 3PF8A 5IULC 3WIBA 1STOA 5AI0A 3TKLA 4M87A 1U0GA 3GJXC 3MBOA 4HXFB 5EHQA 4BNMA 3DJFA 1N1DA 3MINB 1IEWA 3M33A 1QBKC 2OSVA 2FMFA 4NYMR 3H84A 4NENB 4WASA 4BEJA 2G36A 3H8SA 4X85A 1PDVA 1E98A 1F2TA 3H4VA 2XQIA 4FHDA 1L5HA 3ED5A 2P4UA 3AOGA 4YNBA 5H9VA 4XSHA 2A30A 2CXNA 3A4LA 3M6FA 4FBLA 1R4NB 3VISA 2NP7A 3JVUA 3HXKA 1TVEA 3U9LA 1YL5A 2OPLB 3CY6A 4XD7A 1QHHB 4FYJA 4CHGA 1XRLA 3IDAA 4AJ1A 4DCNA 5C51B 2KM1A 2W2KA 5DHFA 4EL0A 5DVZA 1P31A 4NK4A 1MA0A 1JQBA 1MTZA 3GVHA 4UU7A 1TU4A 3ONFA 2FDCA 3O4VA 2YV3A 2VATA 4G8BA 3ZWVA 2XUFA 2Y2UA 1G8AA 3FOAA 4INAA 2GCIA 5CAEB 3DE6X 3H8JA 1Y1RA 1OWNA 1SRRA 2W4IA 1M7GA 1QE0A 3NTVA 3V4LA 5DH9A 5JYBA 1MF7A 4XLLA 2JFPA 5ALKA 5MF6A 3N0RA 2IP4A 3DMYA 2VNIA 4HJRA 2BDUA 4U02A 1MDFA 5FJIA 1KRXA 4ZO4A 1P2VA 4REMA 5DIZA 3HHEA 4RNCA 1Z25A 3NATA 1FU7A 2IU3A 3KB8A 5C31A 2PGJA 3RRYA 1MXCA 1KU6A 2D2VA 3F6PA 4K2HA 4BNIA 1TYBE 3GUVA 4BC9A 2RB5A 1PDOA 4HQFA 2QX6A 2W70A 4MPDA 2E2WA 3HCPA 3R23A 3KTAA 1YHYA 2FZCA 5C80A 2DQZA 4HYYA 2NSLA 4ITUA 4IRMA 4LXIA 1TW2A 2AXNA 4IHKA 3HI6A 3TQTA 1YMUA 4I99A 3R7SA 4E5SA 1KPIA 2J9FB 2QDXA 3PNPA 4WBXC 3ZJYA 1R0YA 4YMLA 4ENUA 1NBMD 2IYXA 2C3PA 5B1HA 3E9EA 2C07A 3B6MA 2V5AA 1EP2B 4LBWA 2FZWA 3WMWA 2XNCA 1KQGA 3TNLA 2SICE 4KVGA 3CJEA 1U7DA 2GN8A 1HR0B 1FLNA 2UAGA 1D1QA 5EZ5A 4ZEVA 1ZMXA 3S81A 1FUYB 1JMYA 1Y5NA 4KH1A 5EP3A 1PT6A 1KEZA 3VSAA 4NEGA 1GILA 4WXPA 1OTYA 1RXVA 1XVIA 1PJRA 2VUUA 4HLDA 3EPPA 4RTPA 2C83A 1HTBA 2CVZA 4Z3DA 4AMYA 1DBPA 3QVTA 3LS2A 4ZI7F 2OYRA 1CZNA 1OY1A 5JOQA 4L4ZA 3K92A 2I67A 3QX8A 3GLIE 1T5HX 5DHTA 3MUNA 1PJSA 2DJIA 2ZRQA 5HJEA 1FDVA 2ZWPA 3W1EA 1YRLA 2AFHB 4XX0B 4PZAA 4JI8B 2EG9A 1W5EA 5CFQA 2Q1XA 4UCWA 4CXMA 3BBLA 2VYQA 4JLBA 3TRDA 4UOZA 1HE5A 2E49A 3JYQA 3K09C 3DDHA 2CWWA 3RIEA 2DH5A 4IEEA 3Q2IA 2XCSB 2D13A 4R2MA 4YT4A 1LLCA 2Y67A 3FFAA 2Q62A 2QSYA 4TL6A 1TT5B 3QVVA 3SX4A 3WX0A 5JC1A 1BOFA 4HRVA 1NQXA 3ZHUA 1U2DA 3LT0A 2G70A 3EB9A 3CTPA 4B82A 4ZT3A 1Y7IA 2GM9A 2BP7B 2P2DA 1TPZA 5DX1A 1H4QA 3K9NA 1GFZA 1ND5A 2W2LD 2OBNA 2WABA 4WOKA 2CDCA 1JG2A 3FPLA 2GHQA 4F3YA 3T1YB 1QOZA 4BMSA 2MTBA 3PHHA 2WMOB 3L07A 4NOKA 2QAGC 1ODLA 3GRPA 4J6FA 1TQDA 4UQOA 2ZRAA 3NWOA 3RSOA 2K2QB 1R5NA 4XEUA 3AVTA 1B8UA 2Y0PA 2IPLA 2QGZA 4JEIA 4L3WA 5ED0A 4DJ5X 4TTPA 4TYYA 3A6GA 3HK2A 1P4RA 5AW1A 2NOAA 4BMOB 2XD4A 1Z2EA 1L5SA 2X3FA 1FP4B 3LECA 3LVRE 2CFIA 1KEVA 1YA8A 4C6SA 3VO2A 3H2GA 1T9CA 2RHWA 2YVAA 3K2EA 2BHTA 5JD5A 3AIMA 4YJ2B 4MQEA 1RYEA 5ICFA 4KB5A 2JJ8A 2P78A 2NNLD 3G8DA 5AOAA 4BYGA 4FT4A 5BT8A 1UT8A 4YIKA 3GJQA 4HRAA 4BWGA 5JWRA 5TQ0B 5DGDA 2R8OA 1JHMA 3B12A 4XLTA 3I28A 2PZ8A 4NFHA 3BL8A 5H1YA 3W2FA 3NB0A 2W9XA 2XYPA 4NTZA 3V8NA 3WGKA 4MQMA 4HWGA 5DJ5A 4R0MA 2D3WA 1Z16A 2FFRA 5DCWA 4A92A 5K8JB 3BD9A 1TIPA 1BDBA 3N8NA 5K0JA 5EJIA 1LJLA 4KLCA 3GZ4A 1MH1A 3PQFA 1EXMA 2J5KA 3DBRA 4HDMB 4PQFA 3RSFA 3EIFA 1CDZA 5F3WB 3UT5B 1XYYA 2RFLA 3ELWA 4GBJA 3NQ41 4NDNE 2RONA 3GJYA 1NULA 2YJZA 4KQWA 4ARCA 2EKBA 4HAXA 2QW8A 2QJTA 3ABOB 2FW1A 5AHRA 5TY0A 3RABA 4EG1A 4DV5C 1UP6A 1Z0KA 1SUSA 3D8UA 3GL9A 3EVFA 1I2BA 4R31A 5FNVF 3K9GA 3K94A 4WLVA 2QJWA 4X3PA 3ZCUA 1U04A 5T67A 5T64A 3WLFA 1JTVA 2JFXA 1Q92A 2NXWA 4RPGA 3AHGA 2ODQA 2NTYC 3GNSA 5CCDA 3FCOA 4EH1A 2WF9A 3LVBA 1QCDA 5ITSA 4OAOA 1BD3A 1TLLA 1WG8A 2YWGA 5G2OA 2A57A 2ZI7A 3QPBA 4MDHA 4ZVKA 1U94A 2IPXA 1T1JA 2A0UA 2HRZA 4QTZA 4Y2RA 1BA2A 2PRIA 4DV1C 1HV8A 2ZZKA 5IDYA 5A9RA 5BR4A 1PT9A 2P65A 4NAHA 2HT1A 1KO8A 4BEBA 1CFZA 2B4QA 4DHEA 3JD4A 3C3CA 2ZI6A 4RIHA 4K3UA 3KLBA 1YDEA 5ALQA 1YTUA 3PPYA 4R0NA 5JBNA 3QE4A 4IS2A 4DYDA 1I3MA 4PG4A 5LQRA 3MOIA 4ZTUB 2WTXA 2JA2A 2W2PA 2LPMA 4WCFC 2XQGA 3QVMA 4MHOA 4OGWA 1J33A 5FHQA 1ZXBA 1G8GA 3WFZA 4XX2A 2NADA 4FGJA 1G55A 3P52A 3WNQA 1Y5IA 2K87A 2BFCA 3KQLA 2NXJA 3CUUA 3EXIA 4R6WA 1WEKA 2OZKA 5HQ3B 3H83A 3LT1A 4G5QA 3PGKA 2XRZA 3CIOA 3FGZA 4DSOA 2NPFA 1NVKA 3BORA 1ENPA 4MV0A 5B6PA 3HU5A 1CEYA 1OROA 5G4LA 1QTNA 1YVRA 2JJ1A 3KYBA 4FKZA 4GPD1 1E1MA 2VK2A 3RJMA 1BMQA 3DOOA 4YUYA 5KJ6A 3CUVA 4NY1A 3L8FA 1H2HA 1ZOOA 3AKCA 4ID3A 1GUFA 2RK4A 5FH9A 2QY6A 4H1HA 7ABPA 3QXCA 2QHXA 2MU1A 3KXPA 4WCVA 4OG2A 2J31A 2YS6A 5AIBA 4YI5A 2CSUA 2IWRA 2AUNA 5HUHA 1N34B 2O2ZA 5K8FA 3UXHA 3ZNPA 4NXNB 3DLCA 2ZPAA 5PGMA 2AEJA 3W6ZA 3QWIA 3IBTA 3TQQA 1ATZA 2P20A 2Q0HA 4Z4HA 1J07A 4BLPA 4JI0C 2WSMA 5DPMA 3BSWA 2J4CA 3C7CB 3IAEA 4D4GA 1XCPA 5BWNA 2DYJA 4OX9B 2HAEA 1RJ9A 4UEOA 2WAMA 4Z8XA 5IWAB 4BNJA 3A1TA 3LBYA 3ZHTA 3SXPA 4F3KA 2IXEA 4PONA 4EQZA 5KQMA 3E7XA 2NYVA 1JQEA 4TRJA 1WXXA 3ENQA 5EQTA 3WL6A 1EXWA 1IUOA 2LDBA 5I7OA 1WPGA 4WCDA 4AZSA 3ZDYB 1SUEA 3GGDA 4CKZA 1M1UA 1P0MA 1XTIA 3SHFA 4TQGA 2X0EA 1P2GA 2JJMA 2XWPA 4RE6A 4B32A 2IIPA 4Q7JB 1X1SA 3MXOA 1PTKA 4IIVA 4BO8A 1WCXA 1MJHA 2MYNA 1Z88A 2OB2A 3BWCA 4CFYA 3DFMA 3VR4H 1A5TA 2ADMA 2FFQA 2YWCA 1C29B 2OMKA 3EW7A 2EGHA 1PO7A 4YAUA 2I80A 4QOSA 1IY9A 3FNBA 4KHPC 4XWTA 3KSZO 3OF3A 4B3RC 2QV7A 2SBTA 2WIJA 5AH0A 1AQIA 2F3RA 4YVFA 4AVYA 4CMIB 4Z4EA 3TECE 8OHMA 3NHUA 2BRUA 1S9DA 1P1IA 4D9HA 3KU4A 3IPLA 2JL1A 4AUMA 1UUFA 2QIOA 1M6HA 1Z34A 4HDAA 1N6PA 5D1NA 2JLAA 2H2GA 2WWTA 2NP6A 1MV5A 3AL2A 3EWIA 1OX4A 1SM4A 3L92A 4MPJA 1W4ZA 3KJHA 4XDGA 1KIMA 1KOLA 1FFWA 4K6HA 1WSAA 3HADA 3Q85A 1H3EA 1WZEA 1TU0A 4FT2A 4CQJA 1A27A 3QWAA 4PC6A 1A77A 3KNZA 3KC2A 4JX8A 2JLYA 3L06A 4ATNA 1UBHS 3LQ1A 1Q21A 4X64C 5LB4A 1KYWA 1PZXA 4PWZA 4EJ2A 2YOFA 1U2ZA 4DIEA 4EW6A 5CFNA 4AJ9A 2QWXA 1FFCA 3HUTA 3NTOA 4D4IA 4D98A 4B3SC 2R6JA 3S29A 3AEUB 2Z57A 3VZQA 3VH3A 5L95A 4Q12A 5CXQA 1CNFA 3Q87B 5FI1B 3VX3A 2HR1A 4JHLA 3VU8A 3V4ZA 4V1CI 1MGOA 1E7MA 1QE3A 3AP2A 3JW8A 2QSUA 3R0JA 2G0AA 3O8CA 3EIQA 4UHEA 1YE3A 1KP3A 4OBWA 4TM7A 1B23P 4JEUA 3TDNA 4H0CA 3DO5A 1FX1A 1KI6B 3QELB 4A82A 4HZUA 1BWPA 4PC7A 1JSLA 1XZDA 4A9AA 2ASEA 2P3OA 3DLPX 1NJGA 1B2RA 1U7HA 1V3QE 1YQUA 2I7VA 1E3JA 1F0PA 1OFUX 2OCAA 4JQSA 4LJ6A 4Z2YA 1GV0A 3EPRA 1X7DA 4GWLA 4I8IA 3ORRA 4PFQA 1Y4UA 2ZBGA 4JI3C 3ASZA 4I3GA 3TJZA 4OQQA 1EI9A 2PLNA 4LGVA 4QPCA 5D3MB 2I1VB 3OM1A 1I24A 1VIYA 3KOYA 2ZCUA 3PA8A 3OJOA 2A35A 2G28A 4P0QB 3M34A 1C4XA 3CUYA 4QPZA 4MPTA 2GBLC 4TV8A 2R6GA 4EPTA 5BSEA 1NU6A 1Z68A 4HRXA 2QAJA 3K6KA 4BMZA 2ACKA 3Q0IA 4TLAA 1HYBA 1ODJA 2X1HA 2OCDA 3CZPA 4KN5A 3VR5D 4EZEA 5FL3A 2AYXA 3RVOA 5EMHA 2PN1A 1NFQA 2VHWA 1SY7A 5EMMA 4LC9A 1UMDA 2VHQA 3ICWA 1V9SA 3LGXA 1DKUA 1AQJA 4XWWA 4QXMA 4C7VA 4XVHA 4B47A 3QFFA 3LY9A 4RM3A 4ARUA 4P7GA 3ROTA 4PZZA 1Y80A 3OHSX 5LA6A 4A73A 4UMDA 5L40A 3DZJA 1HNZB 5CYGA 2DX7A 3T5GA 1KFJB 2E37A 1PGQA 1BXRA 2NIPA 4B3IA 5K20A 4JI5C 2JFOA 4R1LA 4ZTZB 4PE5B 1YJ8A 4PWYA 3ZQ6A 1GY8A 1M6VA 1PNOA 4UULA 1Q0UA 4NMXB 3ZVNA 1KBZA 3QKTA 4OJNA 4ZQGA 5LSAA 3MUEA 2IXFA 4BATA 2ZJFA 5FEMA 4R84A 5BORA 1DBQA 4HNHA 1QYRA 1G8KA 2WJJA 3MPUA 2ZIXB 5LU8A 1AS3A 3H2IA 5LMUC 4MR8A 3QF4A 2PZGA 4KWHA 2C58A 1XU7A 3K70B 1QC5B 5C35A 3K1AB 1S1MA 5BV7A 2CHGA 4XLZA 5JD4A 3KFLA 3A70A 5A5EA 5K8TA 2INGX 5JCOA 3RPEA 3W3AA 3Q7SA 4OY3A 3BD6A 5BN3B 3RFTA 3T7TA 2FUCA 2JRLA 1DO0A 2QZJA 3BH0A 2YHUA 3MWEB 4FZJA 4DY4A 1GG8A 3DCIA 5AXCA 3LWZA 2WAOA 1W0JD 4N5IX 2NQ2C 1ZN2A 4B6FA 2V3CC 3HZZA 3WLJA 1QK5A 3GMSA 1ECFA 5F52A 1GSHA 2H2AA 2GCNA 1P5HA 3FDJA 5T5QA 3U7EB 3QE2A 1XNGA 3UHAA 3M6AA 3C48A 5KUTA 3HM9A 3W8RA 2K6GA 4Q37A 3SJUA 1UKBA 1P9RA 4YK7A 4BZPA 3SS8A 5K6RA 4I1PA 3JSXA 4O2AF 4G4JA 3V4SA 4P22A 4DYVA 1C30B 4O2BF 3BB1A 2KJQA 1PHRA 4CM7A 4EG3A 5LC1A 4WUVA 2A9QA 2HPZA 3W4KA 1DJLA 5IKMA 3ZGYA 1GXSA 2VYCA 5E3JA 3U13A 1DSSG 1QV9A 3TG8A 3HY4A 2DVMA 2ZUVA 5ALPA 1W0JA 3LC1O 4RTOA 3KJXA 2VUSA 5B3JC 3IE2A 2JIOA 1AKMA 4LK3A 4PPGA 3P2KA 3TK1A 4F4DA 5GINE 2P5UA 4ZU1X 2GK3A 1G9SA 3NAMA 4UCQA 2WG0A 5B5SA 4M76B 2J07A 4JJIA 4O5AA 1QRTA 5DB4A 1X87A 2R8RA 2PGAA 1BEEA 4G0QA 2V96A 3B1KA 1E6EA 2ACWA 3QMMA 2W37A 1XEAA 3CCFA 5LLTA 1W7AA 4J0QA 4YPFA 4JJFA 3AILA 1SQ5A 2ZSIA 1YOBA 2EW2A 2FZ5A 1LI4A 3HVKA 1GZVA 2E87A 4EHDA 5ITVA 2YOGA 5D6OA 4YDQA 3PR2B 4JLSA 5HNKA 4TMZA 3VBEA 3HE3A 3R24A 5IVPA 3UIEA 2FFJA 1N7GA 3BK1A 1GP2A 1OBCA 1Z4IA 3GLKA 2X7XA 4Q3EA 1NW6A 1MJFA 4HTAA 3L0CA 1UR5A 2HCBA 4BU0A 4PR3A 2CUKA 5J1SB 5KYGA 3ORHA 3W1WA 1L7AA 4PANA 5EY5B 4JUDX 1UQTA 1NDQA 2FGKA 3SEZA 3QOWA 4EPRA 3H05A 1PFQA 5LXTF 1EB9A 1M2KA 3VU9B 4CEJA 3V2IA 3VH2A 3L0PA 2Y1OA 3RB8A 2ZB4A 3QF4B 2H29A 2NG1A 4AQYC 1LBTA 2XCLA 3HDQA 3IJ5A 3GP3A 3NFYA 5K6AA 1XTQA 5AHKA 4YJFA 1AHPA 3IHLA 3AXSA 4DLNA 2G8LA 4QQNA 4LC0A 3H19A 2PBLA 3L9WA 2QRVB 1EMDA 1LPBB 3FYDA 1NYLA 5CGZA 3SZUA 2MYTA 2P2BA 1AQLA 1RCTE 3HP4A 1YZYA 4OF4A 4E1AA 3PZBA 5BQPA 2J3DA 3R09A 4ER6A 2GD6A 3CX8A 4TRRA 3EGVA 3R9XB 4UNIA 1QIMA 2Q2QA 3LUHA 4PGFA 5CGQB 4NDAA 4EB6A 1ZN8A 3L7DA 7REQA 3AL0C 1GT91 5KSOA 3ILVA 3KVNA 3IKTA 4OXIA 2RHRA 1FYEA 2VBGA 5EUMA 4Y1FA 2OCKA 3U9SA 2G4CA 3V8QA 2P6NA 5K2OA 3QBEA 2OVFA 2C00A 3N5KA 4Y2YA 1Y82A 2CJPA 3BE4A 3WLQA 2IYEA 2HDNB 5FWNA 1L5WA 3CXUA 1OIVA 3ADBA 2Q07A 3GFBA 1RTTA 1W85A 4LDRA 4L0DA 4U2CA 4UHCA 2PTGA 4ZVNA 3I2YX 1H6BA 3UT0A 4AYWA 1SKMA 1L9KA 2C42A 1O9GA 5GV8A 2DFPA 3V4PB 3PLNA 5JDCA 2AJDA 3GJTA 4X7MA 5DBGA 1DEXA 5DOVA 1RMTA 2WHXA 5A6SB 1QPZA 1BDIA 1FSPA 3ROGA 1JBQA 4TT3A 4R1QA 3IP3A 4FFDA 2A59A 2OV4A 4Q9LA 4PSVA 5FOTA 1DXQA 4ZPJA 3E15A 3KOWA 2X8LA 1A8QA 1QB8A 4QLAA 3ZVRA 5DCUA 3WHPA 4EKDA 4ZQIA 1Z26A 3KAKA 4FMBB 1G7CA 2SNIE 4TVBA 4IHJB 2VEDA 5HIKA 3H8VA 1ZB8A 3TRKA 1L8QA 1Y1KE 1O92A 2O7SA 3I72A 4GKVA 3A9RA 2ZRKA 3U26A 3K0FB 2HRQA 2H5EA 3P9RA 2YWEA 3DD5A 1M2NA 1OD6A 2WT4A 2PX4A 3M4XA 4J4TA 3RLFA 4CETA 2IBSA 5U4XA 1V7QA 1HDYA 3C3DA 3KT0A 3NORA 3N3BC 4IL5A 3W78A 3WLIA 2VJQA 4DQKA 5LDGA 4M0KA 1TIBA 1CY6A 3OM9A 4H0NA 5DLEA 3AETB 3WIOA 1CJBA 1W4RA 5HCIA 4PRLA 5B12A 2GNAA 1OTXA 4FS8A 4LHZA 4BU1A 4UTOA 2F00A 4PGGA 3B9RA 2PL9A 3DE4X 4DIBA 3JQ6A 3O0DA 1TD9A 1LSUA 2X1MA 5JSYA 1C1DA 1EJ6A 1M76A 1MP0A 4XQGA 5HJ5A 3R3YA 3H9GA 1YKGA 2WJ6A 2R1UA 2WNHA 3HCAA 4PZLA 5KEIA 2EFCB 5E7MA 4Q9JA 1OV4A 3B6KA 3DHEA 1UK8A 1VG9B 1U6IA 1BROA 2PX8A 3CMCO 4F96A 3D4BA 4X0EA 4U7DA 1F20A 1BXGB 4DXHA 1NVBA 1U2TA 2BAGA 3LPCA 1ODFA 2Q4RA 3WRXC 3UKOA 2VTDA 4YLGA 3AVQA 4DV0B 3VKGA 4NMWA 3GLRA 3PKJA 4UEJA 5FOVA 3VZSA 5KVQA 5CTJA 1GG5A 2YV2A 3P9KA 2O3RA 5I01A 4UAJA 3OH8A 2NVUB 4NSNA 3KAJA 1TGYA 1KGDA 3ADOA 5REQA 1L4GA 1MNAA 2HREA 4PM4A 4CKBA 1EE9A 1UK7A 4RAOA 2CVQA 3OOWA 4M1EA 3WDSA 1NN1A 1OXXK 1ULUA 1V71A 1W94A 2B1QA 2X22A 3G49A 3QI2A 2RGAA 1OHHD 1JA0A 3OZWA 1WCWA 3QY9A 4MV7A 3L8CA 3QLVC 2PXAA 1DRUA 3A0UA 3ZWAA 1CJUC 3UQYS 2W2XA 1FP1D 4M8KA 1IAQA 3LUDA 2D5AA 4F9FA 4DREA 1NP6A 2VOEA 4IGIA 2HBZA 2ZJYA 5KX5B 5JWOA 2C4TA 3N3AC 3ESRA 1WXWA 4WOCA 1L8AA 3IOMA 1XZQA 3LI2A 4TZKA 4YUVA 1M6VB 3OCVA 1K88A 2LXNA 1A88A 3EYWA 1GOTA 2OBBA 2OZPA 4C4XA 4DA6A 2PUGA 1WULS 3M0EA 3TSOA 3INGA 3QIVA 4NBNA 3K70D 1UM9B 1FTYA 4CHTA 1A1VA 4X54A 2OORC 3FJOA 3NBFA 3W2GA 1YQ9A 3PPWA 4QOGA 4R54A 4BCBA 4CQMA 3I2IA 1ZUHA 3UJ9A 5IKXA 3WK8A 4JGGA 1G6OA 3KQTA 1W5BA 2H1RA 1RWQA 2JFFA 2BHSA 1Y48E 5KWIA 4CLOA 3HM2A 3MS2A 2AZDA 1YNOA 4KUHA 2E4ZA 3CO5A 5CT8A 4RTMA 3WB9A 1GGHA 3GCXA 4NYJQ 3ZCTA 3ETJA 2Z6AA 3QVLA 2GDJA 1AK1A 1T91A 3CW2A 3NKLA 3AW8A 4II2A 3BK7A 5AE3A 1H42A 5EJ2A 1NPDA 1AQYA 4W99A 1CR1A 3FTNA 1XWWA 2PRYA 3I1YA 4WBNB 3FUTA 3IQWA 4Q01A 4LFBC 3OPNA 4UXHA 4XXHA 2OXIA 5DNDA 4OH7A 1RE0A 4MWGA 5G0TA 3CX4A 5MN4A 2CYBA 4F85A 1MKYA 1ZGGA 1MJNA 1PZFA 1VHQA 4YP5A 3HG7A 4PPFA 2D54A 2RHGB 3P2JA 3PGJA 4QNRA 1ZBDA 2WM9B 3NOVA 3L95X 2FUEA 2ONYA 3ORYA 5EVJA 4FU0A 5L3QA 4F11A 2E0GA 3ND7A 4OFBA 1DAPA 1VECA 4NYIR 2Z95A 4EGCB 3KR9A 5LA6F 2EJUA 3I9MA 4IOJA 4DCOA 5DNVA 2QRGA 2B4KA 1VL5A 3VMMA 2GCOB 3LRPA 1U7XA 2UVPA 4YRFA 3G8AA 5G02A 4PZUA 5BVGB 4WEOA 1NWHA 1JLHA 2I3AA 2XUQA 2ZYIA 3ILSA 3R6DA 4INZA 1XYGA 1FFBA 2X13A 5G41A 1R12A 1Z74A 1EBFA 1NF2A 3GUUA 3ENKA 3LKDA 1J21A 3LP8A 2DG2A 1TRKA 2GXUA 4K1XA 1NHWA 4BP9A 3A28A 1ZAKA 2JI8A 1E3MA 2F1HA 1UJCA 1F6BA 1U4NA 3HLKA 2BRUC 3HY6A 3PPVA 2MMGA 6GPBA 3UMMA 3ZD7A 3TX6A 3IVGA 3HP1A 2VK4A 3ID6C 5DM2A 3VAYA 1YZGA 3FUUA 2N0SA 1DJOA 1YJBA 2ZBRA 1Z6QA 1KYIA 2VP3A 4W7SA 5EMLA 4BKQA 3DMRA 4B4UA 3C5HA 3DE3X 4OHWA 4MS3A 2ZUCA 1Z8NA 4Q18A 1E2IA 3U3DA 4AYTA 2WB4A 1YS4A 4BN5A 4JODA 4KHZA 4M37A 4DV7C 3LP5A 3K72B 1JG6A 1B7GO 4YV7A 4PAMA 4ZI5A 3UUEA 2ZBVA 1NV9A 3VR3A 4P08A 3TKAA 3AZQA 1WOYA 4JM1A 1DDGA 2IEDA 4TRMA 2QE7A 2ALJA 2VSQA 3UHPA 3FOBA 3REFA 4NZMA 1O95D 3TR5A 1DRJA 3O9MA 1IWPB 3LJKA 3RT9A 4EL5A 1CQXA 2CNNA 4M9QA 3GRAA 3G5AA 4X7PA 3SFZA 4U7FA 4EDHA 4EEXA 1TUEA 5FWDA 4CMEA 3EE6A 3DL2A 4HWKA 2GZSA 4JI6C 3KZMA 5A5VA 3KQUA 1FFXA 4WEQA 4E2XA 2GZRA 3GLHE 3F2IA 3PNKA 5F1PA 2G0NA 1ZU4A 3QY0A 1NVFA 1O5IA 2JGAA 3MF4A 4HAVA 1UT5A 4RK5A 2ZSEA 1PYDA 3DMFA 4ZOBA 3W5JA 2AUMA 5KHLB 3MC1A 2PMDA 3FRJA 3TSZA 4BNKA 1LK0A 3ZZ1A 3LF2A 5BN4B 1WMDA 3ZKWA 1YFJA 1S3GA 4JL5A 3GEHA 3L6RA 4HUQB 5B3JA 3CVUA 3JYLA 1W5TA 3AFMA 5DHQA 1T2NA 1L3IA 4QGHA 5TF4A 1W6RA 5GIOE 1YJQA 1Z2AA 2W2OA 1Y3FE 2ILTA 2UUAC 4PIVA 1H2YA 1EWYA 2IS1A 5HUQA 2P9CA 2Q99A 2PZAA 1Z83A 3TQHA 4PN3A 1QANA 1H1LA 1P39A 1B6GA 4AX4A 1RRPA 1Q83A 2AFVA 3QKIA 2FRXA 4NULA 4G5GA 1PCXA 2BJVA 2FETA 1E5XA 1OIXA 3USCS 3C3AA 1QWOA 1AXRA 2QQGA 1HZZC 5ICGA 5BNFA 3F6CA 4DNFA 1TI7A 1MG0A 1T0JB 3C6XA 3NAGA 3P94A 1OX6A 2ZJ3A 5DT2A 4HN4B 3U39A 1UJNA 3ABSB 1A5ZA 3HN6A 3OQBA 1JJAA 1H5QA 5D00A 1PJ8A 2VT6A 1SQ6A 3LOQA 2XUHA 3PGXA 2DTEA 1B43A 3SS9X 3G88A 4EG7A 1MB9A 3A7DA 3MJRA 1RY2A 5DHRA 1QLHA 1Z6GA 4K3VA 4WKGA 5J5CA 5A3JA 5TMPA 3RQSA 2JCXA 3CTMA 5TV2A 1YQQA 3GFPA 1R8SA 2J59A 2R5NA 2HF2A 4KQFA 3CG0A 1QGYA 3D1JA 4J43A 2GTPA 4J7CA 3FMFA 2Y92A 5FI5A 3VNUA 4PSDA 1SU8A 1KK3A 3GRCA 2IDKA 2V7GA 3JQ8A 1USGA 4LZPA 1EG7A 1NVVQ 3NBKA 4IIJF 1DUSA 2C8VA 2VA9A 1WVGA 4OLJA 4Z9AA 5JEEA 1X39A 2NU9B 5K0SA 5K3BA 4QU8A 3NIDB 3OOSA 3KT8A 3O2QB 4HH3C 1GNRA 4NBSA 1QHEA 4D8UA 1IDN1 2V6JA 3AFHA 1V48A 3C1AA 2EL9A 2ODBA 3QXSA 1FCJA 1XP5A 4W1SA 2F7SA 1P1RA 3V97A 3JWIA 5F7XA 4KNWA 4L6AA 4XZ3A 2WPNA 3PFBA 3R5FA 2AG0A 1PR4A 5EFZA 4ZVSA 1KOJA 1L3BA 3RARA 2GD2A 2P1RA 3U1VA 2GN9A 3H5AA 4P3PA 1KKLA 2EKLA 3DTVA 3IQEA 4U8GA 4WESB 3RTCA 2H7CA 3A2LA 4AMZA 4TKUA 2J3QA 3I45A 3ROZA 1U3FA 2P2JA 1ETUA 1PK8A 1IG3A 1DWOA 3BVPA 1BAPA 3KSDO 1K27A 4RPLA 2WLSA 4C3OB 1R1DA 4HMPA 5HIAA 2R1TB 3PQ7A 3ZU2A 5JJKA 1OU4A 3QFSA 4MS1B 3DP7A 4BGUA 3GQBA 4LHEA 1XRRA 2R1VB 1K6EA 2GFIA 3DE1X 3EOAI 4JBIA 2R5FA 4C4AA 3GX1A 2FUG1 4LPSA 4US1R 1ZMOA 2DFNA 3WGOA 4MI3A 4R8SA 4DCJA 5GOZA 1CDDA 4CMHA 1AGPA 1DFHA 1ZOSA 3COWA 5CFMA 1Y8RB 4PICA 1SMKA 2FJPA 2PYIA 4B73A 4FCCA 4ZMBA 1QQBA 3IKMB 1EWQA 4LYEA 1L7MA 1OAKA 2GD0A 3AZPA 4OKNA 5AKHA 3VQTA 5SYMA 3THSA 4ABYA 2QD5A 1MIOB 2I7XA 3INNA 5DIFA 3B52X 3D3NA 1N0VC 1W88B 2QMQA 4B3DA 4M9UA 1SKBA 5JCPA 5EPUA 3OTGA 4DR1C 2HF9A 3QLEA 4CF7A 3B6EA 5E7QA 1PR6A 2YHIA 5F98A 5FO1A 2XYVA 1UWDA 3ZCPA 4KOAA 4YCBA 5MN5A 4GUDA 2YICA 3PC7A 4ICIA 3UCFA 4PSCA 4KN9S 2JF0A 3BL5A 3UC5A 4CVNA 3PHCA 1L7VC 2ZVPX 1SHTX 1Q2UA 3DHYA 4X1OA 5AI9A 5U1PA 2F9MA 1P1CA 1X8JA 1TAUA 4IQ8A 4LHSA 3WADA 2BSAA 2VQFB 3JAWA 4R68A 1QAQA 2PYDA 4MVXA 1GLGA 4JB3A 1PU1A 3BXZA 4G23A 3TR0A 1I6LA 1M1NB 1IMJA 1KVSA 2AI1A 3SK0A 1C9EA 2G25A 2VQFC 4WI1A 2H4YA 3IBSA 2G7ZA 4NRDA 5JIBA 3DVRX 3MJCA 2BW0A 4IINA 4IUDS 4XVRA 5ALRA 3S1SA 1GCAA 1SU4A 3OCUA 3WRXA 4E7OA 1F8FA 4GI5A 4U8HA 3GARA 1VYHA 2OFXA 4ABTA 4B33A 3ORQA 3JQCA 5F3RA 4Z0TA 2GAOA 5JSZB 3K4HA 2FPWA 3EXHC 5CFOA 4M1YA 2C4WA 3TVDA 1O96A 3NHWA 5EP4A 4MCJA 1WR8A 3H5TA 1ZCFA 4MQUA 3EBLA 4F91B 5CLLA 3T3NA 3L40A 5CVEA 3RTGA 4M89A 4EMBA 3M6VA 3HYNA 3VPGA 1QHIA 1DDIA 3CE6A 1IHYA 4LOLA 4L4SA 2PMEA 1XBTA 3GROA 3HB4X 3L1JA 4G1EB 1UBJS 4LJAA 4R7TA 2PAFA 4MDEA 4FEGA 3F8TA 4GZ3A 4GLJA 4BO9A 4CGYA 2JHGA 3MT8A 4IDHA 2UZ4A 3LX4A 1T26A 3GLIA 2GI4A 2WTEA 2GEDA 4JBNA 1PR9A 1XTPA 5IRCD 2CZGA 2XCQA 4I0WB 4LMRA 5KDLA 4TKUB 1WW2A 4LF5C 1IM5A 1K75A 2HNAA 5JY1A 1XRPA 4EVSA 1NNSA 5DEOA 3WRYA 2FSPA 4IILA 2VJPA 2XVXA 9LDBA 1BJRE 4M0DA 3QHAA 4NV0A 2BUCA 4KMSA 4YRQA 1E3WA 4CEHA 2QGFA 2I8LA 1VRCA 1AKNA 1M6WA 3IIKA 5B4TA 3OTOC 3V8VA 4Y2UA 1QCCA 4CDRA 1HQKA 1FY2A 2VSYA 2HK9A 3RS9A 3T4EA 4N41A 2CFTA 1SQSA 3TB4A 4NE7A 2R6CA 2P8SA 3DTNA 5KB3A 1K2WA 4A0FA 3T0GA 1ULHA 1Z0ZA 1NJ5A 4MWZA 2IQ5A 1UZUA 3Q6MA 3PWTA 5KDOA 1VJDA 1E32A 1U7ZA 1OVGA 2OGSA 2WOJA 5GY7A 1Z7BA 4GMXA 3T3HA 4A91A 2XMBA 3WJ2A 1Q0PA 5I6DA 4IDDA 1ZK0A 2UUCB 2EWMA 2MSKA 1ESEA 1E9DA 1A2KC 3NDRA 4NOMA 5BRNA 2YZ2A 1XEWY 5IVKA 1DV1A 1NVTA 2ATCA 4Q24A 2WWHA 1LPMA 3D02A 3I8XA 4HVLA 5AQEA 4E2YA 3IXMA 3AYZB 3KETA 3RS0A 5C34B 3R44A 4WFQA 2NUTA 4NG5A 1K9VF 2HBRA 2JLRA 4XWOA 1XZGA 3JPWA 4LF9C 3RBXA 4LPKA 1RWNA 1LSSA 1F1JA 4QUIA 1OGJA 3OUUA 2ZSJA 3S99A 5HZHA 3NS7A 1GTG1 4FI3F 3PC8C 4U9UA 1UC5B 4ACAA 3LKBA 3E7WA 3OPMA 3T9DA 1QKJA 1PJ2A 2A5DA 2WTUA 1Q22A 3JQRA 1UFVA 4QNNA 3CZCA 4Z3OA 4RTJA 4D4MA 4EFLA 2NU6A 2ATWA 4MRPA 5T4EA 4ZAYA 2F43B 4CQMB 1T4CB 4IXTA 4D9GA 2IBTA 5DYTA 4ZP1A 3EK2A 3OOYA 2AZXA 3D6UA 4BVLA 1Y9ZA 4POAA 2J6IA 1YR7A 2F6RA 1M54A 4EP1A 3LGSA 1AGXA 3J80D 4MIYA 1C9MA 1NZFA 2XTMA 3I39X 3UNXA 5EKUA 1QVAA 4P36A 5LUBA 3D8NA 4PAWA 4XGQA 3D5EA 3A26A 1YR1A 3FB4A 3PQEA 3AUTA 2X2EA 3VC2A 1GSAA 5BO5A 5JT1A 5JPIA 4Q15A 1TCCA 3SM9A 2HIGA 1W47A 4FYVA 5F7JA 4F1KA 3KQHA 3FTEA 4CL8A 3AJEA 2ZXUA 1XVAA 1Q1QA 1O94D 5E6UA 3ZHBA 3HA3A 3IURA 3AUAA 1JTEA 3R6LA 2XZOA 1XROA 2OG2A 3NM5A 3QJGA 2QVYX 1QZUA 4PAGA 4R0VA 5DKFA 3KUKA 4V1CA 1R4MB 2B36A 4CM6A 4E5MA 3A1VA 3N7AA 1JIVA 4WOJA 3TQIA 1RE1A 3IO5A 4RZIA 5AW2A 3UJDA 4GUAA 1ORDA 3KO8A 4GLFA 5IJ0A 4JBLA 4DV5B