4GXQA

Crystal structure of atp bound rpmatb-bxbclm chimera b1
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
505
structure length
476
Chain Sequence
MNANLFARLFDLDDPHLAIETAAGDISYAELVARAGRVANVLVARGLQVGDRVAAQTESVEALVLYLATVRAGGVYLPLNTAYTLHELDYFITDAEPIVVCDPSRDGIAAIAAVGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGRSGAMLSHDNLASNSLTLVDYWRFTPDDVLIHALPIYHTHGLFVASNVTLFARGSMIFLPFDPDILDLMARATVLMGVPTFYTRLLQSPRLTETTGHMRLFISGSAPLLADTHREWSATGHAVLERYGMTETNMNTSNPYDGDRVPGAVGPALPGVSARVTDPETGELPRGDIGMIEVGPNVFGYWRMPETSEFRDDGFFITGDLGIDERGYVHILGRGDLVITGGFNVYPEIESEIDAMPGVVESAVIGVPHADFGEGVTAFVVLREFAPSEILAEELAFVDRLAFMPVIFVDDLPRNTMGAVQNVLRETYDIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Malonyl CoA synthetase, Benzoate-CoA ligase Chimeric protein
publication title Structural Insights into the Substrate Specificity of the Rhodopseudomonas palustris Protein Acetyltransferase RpPat: IDENTIFICATION OF A LOOP CRITICAL FOR RECOGNITION BY RpPat.
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Ligase
total genus 139
structure length 476
sequence length 505
chains with identical sequence B, C
ec nomenclature ec 6.2.1.-:
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4gxqA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4gxqA01
3R44A 4RMNA 3IVRA 1YJ7A 3WV4A 1MD9A 4G37A 4OYCA 1T5HX 2WD9A 3A9VA 4RLFA 2Y27A 4EATA 2D1RA 1BA3A 2D1SA 5BUQA 4ISBA 4FUTA 4RM2A 1RY2A 3T5CA 3FCEA 5KYTA 3WV5A 5E7QA 2VZEA 3DLPX 2D1TA 5DV9A 2QVYX 5K85A 4RVOA 3IERA 3FCCA 3NI2A 5KEIA 3RIXA 5DWVA 4W8OA 2QVZX 4OXIA 5BUSA 2Y4NA 3LGXA 4D57A 5BSRA 4M46A 4LGCA 5JRHA 1T5DX 4GXRA 3ETCA 1PG4A 4R1LA 3CW8X 5KYVA 2P2JA 3O84A 3WVNA 4DG9A 3DHVA 3E53A 2Y4OA 3E7XA 3C5EA 3GPCA 3KXWA 3RG2A 1V25A 4GR5A 2P2BA 3DAYA 4RLQA 2QVXX 4IR7A 4D56A 4E5DA 4G36A 2V7BA 3A9UA 4RM3A 4PZPA 3E7WA 5D6NA 4WV3A 3PBKA 1ULTA 5BSVA 3O83A 5BSWA 3B7WA 3G7SA 3U16A 4GS5A 3QYAA 3T5AA 4U5YD 2P2FA 3CW9A 2D1QA 3EQ6A 3NYQA 4ZJZA 3O82A 3LNVA 1V26A 2VSQA 3TSYA 3LAXA 5BSTA 3VNQA 4IZ6A 3IEPA 4D4HA 5BSUA 4R0MA 5IFIA 1PG3A 1MDBA 5BURA 5GTDA 4RVNA 3IPLA 3IESA 2P2QA 2QW0X 2P2MA 4DG8A 5K8FA 4R1MA 5BSMA 3U17A 3VNRA 4D4GA 4GXQA 4GR4A 1AMUA 3NYRA 1MDFA 3VNSA 3T5BA 3ITEA 3L8CA 1LCIA 4D4IA 4FUQA 2P20A
chains in the Genus database with same CATH superfamily
3QIAA 5NLLA 1AK9A 5GZ1A 1XXLA 4G37A 5HJ2A 3C3CA 3TZKA 3CEHA 3AP2A 3TEMA 3KXKA 5LQAA 1YACA 3UO8B 1J33A 4FPXA 1OFUA 2GZ3A 4M21A 2HLNA 2KZ0A 3V5NA 4C9BA 5JDCA 3OQIA 4M6WB 3I8SA 2IW3A 4EENA 2VAVA 2BMAA 3H8JA 4D9CA 2FRDC 3RFTA 1CUDA 4NYMR 2BGTA 1DCKA 5K8JB 2X6TA 3ZJ5A 4EITA 3TEFA 1XRMA 2HIAA 1Q0SA 4OATA 1P44A 3O9VA 4CDGA 3KKZA 2A9KA 4M86A 2CLKB 3ZE0B 1QG2A 3L49A 1E2HA 1V39A 4OAPA 1L5VA 1R5OA 4KMSA 4ZVPA 4ZDWA 3SSAA 1NQAO 2ZIAA 3ABSB 1IC6A 3WAJA 1IJFA 4HGZA 3OCJA 1GT91 1RRPA 1YL7A 5JQGF 3NNNA 5IWAB 1S2NA 1XMXA 2BEKA 1PNQA 3KKPA 4L72A 2VUTA 3UHJA 1YZGA 1ZJYA 1IVSA 4PE5B 4ZDIA 5AK5A 3V1KA 5A4FS 3A1DA 4FD3A 1Y1RA 4JI6B 4G8BA 2M98A 2XODA 1OD6A 2KBFA 2KW5A 2CYAA 3BSWA 3KJZA 3NAGA 3OIDA 4FFDA 1AT1A 1EXMA 4M36A 4NTZA 3S5UA 5EHXA 2ZSKA 4HSGA 1I2DA 5CURA 1GRCA 1PU2A 2COUA 5EPOA 1KOLA 3K71B 1Q6YA 1VBFA 5CA0F 2B61A 1XD2A 2XB2A 2UXBB 4WCDA 3RFUA 3EY4A 3I6ZA 3H3JA 5CVEA 2Z2IA 4ZEWA 4QU9A 5C1IA 5GONF 1JBQA 1M5TA 4IFBA 5EIWA 5FHQA 1N2EA 5JR3A 1HNWB 2BEUB 3EGVA 1IU9A 2O8BB 4P7GA 3F98A 1XZMA 4P0PB 2JAHA 3MRXA 3VR0A 2V5AA 2F90A 3IAEA 4OYLA 3UMSA 4U7TB 5HMMA 4CHTA 4QPNA 5J4KA 2WA1A 5GJCA 2CHVA 3NPMA 4GHWA 4K8RB 4PN7A 4WMLA 2YWFA 3EE6A 3GA7A 3N53A 1W9HA 3RSFA 3OMLA 5D7BA 5T67A 4NEQA 5AJWA 4X64B 4GECA 2BCEA 4EYEA 8LDHA 1ZWLA 1JP7A 1L5YA 2BFDB 3LZDA 2J08A 4F1JA 3Q10A 4AZTA 5P21A 1G2QA 3IELA 2WYIA 2AT1A 3BWVA 1OZFA 3KALA 2VT7A 3LWZA 4EDHA 2C7QA 1JIUA 3CGWA 2BSAA 4KWCA 5GTDA 2QF7A 4AN1A 4KE8A 4XPZA 5F2KA 1E20A 1NN3A 3IR6A 3T3HA 4C0WA 1QHYA 4IDFA 3BIJA 5BV7A 2EOAA 4QDUA 4MKXA 5D86A 5IW8A 5IANA 5EI5A 4B6PA 5KWIA 4QEDA 1AZWA 4A8HA 3IMLA 5KJCA 3JD2A 4MUFA 5KQLA 2H1VA 2ZSUA 1HTBA 3CVOA 3HHEA 4WKCA 5AIAA 3BQMB 4DLBA 4RTPA 2W90A 1OJLA 3LT5A 3NETA 1WY7A 3RSGA 2QL7A 5A9SB 4JR2A 1QIEA 3KSUA 4C78A 2O6HA 3KTDA 1W5AA 1YOVB 2H48A 1ZA2A 1GPLA 2CK3A 2ZYIA 4YMIA 1JDSA 1ZH8A 3EQZA 4UHBA 3F7NA 3FCYA 1RJEA 4BO0A 4JMPA 1MGOA 2H3EA 1LY1A 1P7YA 2V98A 3CUWA 2WP0C 3H65A 3W5JA 4G4GA 4LHZA 3H8WA 3T9AA 2WK1A 3WWOA 2QDXA 4LXUA 3DXXA 5DHTA 1OX4A 5KNBH 4QATA 3UW3A 5JD4A 1S2LA 1OWMA 1CHNA 2PBLA 2BLNA 2O4UX 1NRIA 3N2GB 4AU1A 4DLAA 4A3SA 4F3NA 1ZOIA 5E3JA 1FTSA 2QSZA 4N6OA 5JANA 2GBPA 4EGSA 2Q62A 4EF5A 4PSKA 1FLVA 1C7JA 1NGSA 3NDJA 2Q5FA 2OV1A 2QXYA 3JQFC 5D3MB 1FFEA 4LK3A 2JLUA 1FLNA 2AZDA 1E6LA 2CW5A 4HV4A 1H8HA 2XY4A 4L2IA 4XVHA 2QRNA 5D87A 6ADHA 1K7YA 1T9BA 2JI9A 3W6UA 3ADOA 3BDAA 4EHLA 1ECBA 3O4FA 4IAOA 2O14A 1CRQA 1FUIA 4G4SP 4I6EA 3TAHA 3R9WA 2YHBA 2OBNA 3K15A 3IR5A 3RD5A 3L7KA 3GJRA 3OOEA 5DBHX 4CUKA 1IQPA 3SC3A 3RRMA 2JRCA 1ZZEA 2YYSA 3IBSA 3K5HA 2PV7A 4JI6C 4G89A 4F8YA 1AMOA 1VKJA 1YB6A 1E5LA 3HJCA 3IA2A 4PO3X 2JB9A 4F3RA 2XGGA 2JFOA 3FVTA 1XI2A 2A58A 4ZT6A 1JTEA 4KAXA 3ZVMA 1E4EA 3HM2A 4FD2A 9ABPA 5GIPE 2PN1A 4IVRA 4D92A 4W5TA 2V7UA 2G1JA 3HR7A 3IDQA 3KQWA 3SZRA 3SOPA 2K7FA 3IUBA 2Q3EA 3WTCA 3DBRA 1A8UA 3A25A 4Q4LA 4IF4A 4X3OA 4CM5A 4D9IA 3KSDO 2XWQA 1ONBA 1UXHA 5AJZA 5EWLB 4A0GA 1RXCA 1RAEA 3ILXA 3EVTA 3TL3A 4EG7A 4ZDJA 3OT1A 3G17A 1W5FA 3BSSA 5TY0A 4IMPA 3RQIA 4BS9A 1BHO1 3UMVA 1RXSA 3QBJA 1CR1A 2P1ZA 3DDWA 3OOJA 1CJKC 1GNQA 2C4TA 3KWJA 3M82A 1L7QA 4MVJM 5CA1F 4F38A 1W0KD 2DVMA 2CLIB 4PSDA 1YQDA 3O82A 4ZAYA 3TX2A 1VYTA 2QHXA 2Q6VA 4X64C 1LF5A 3UOAB 3D3NA 1IEVA 4XJXA 3HJFA 2PX6A 4MH4A 2F3RA 5KPJA 3FKQA 4LFAC 4GM1A 3R2JA 4MYTA 4YJFB 4KSCA 5J4HA 1VKHA 1UBEA 2ZJ5A 2RC5A 3OZDA 4PLWA 3WSVA 3FPSA 1WSBA 4LZPA 1C1XA 1H3FA 3WGUA 2CFRA 1RBQA 1EDDA 3M83A 3SZMA 2KE5A 1HQCA 4GLLA 3DHWC 5A3RA 2CY0A 1A9OA 2EEPA 4P54A 4PSVA 4RH1A 1BJRE 4DYVA 3G2IA 3KVVA 2EIHA 2W2PA 3D6MA 1ESEA 5BR4A 1SWVA 4GI5A 2DYKA 2EXXA 2RK3A 4G1FA 4JOQA 4UZFA 1G7CA 3ABIA 3DW3X 1F8XA 1YKGA 1PQPA 2CLEB 5HFJA 4AZSA 1V5FA 2E4VA 4BNHA 3PIIA 2ZVQX 2GETA 4CT5A 4DS3A 3LF1A 4ZV7A 3JARB 1ZPDA 3GA0A 1VMDA 2ZSJA 2R1TB 2AG6A 3DL0A 4MXDA 3RUAA 4ALKA 1T4BA 4DR6B 2FZGA 4KTTA 1NDQA 2OV6A 4HUQB 4HAYA 4ND1A 2GBLA 1DQPA 2XRZA 3P5SA 3I4FA 1B6SA 3FPEA 1ZGAA 5KX5A 5E7QA 4IXMA 1SA0A 2BBTA 2WE7A 1P8JA 4JJKA 5HE9A 4R9SA 4F2WA 2NU7B 4V02A 1G6OA 1UPUA 4DR3B 2XT6A 3KYDB 3GRZA 1KFJB 5B3JA 3HMQA 2J4DA 2C88A 2QN9A 1JHYA 1Z4OA 4YMGA 2A3NA 2IIVA 2ZIUB 4B34A 1MHPA 1A8QA 2OLJA 4PX2A 3N54B 2HYDA 3HP7A 3JWPA 3LUCA 4CGYA 1THMA 4OLJA 3AESA 3BJRA 4Z9AA 5AXBA 3PWTA 1UJNA 4YROA 4K6HA 1WHSA 3EZ2A 1SUWA 4HG2A 1NUHA 2LD4A 4MW9A 4DA9A 3FPLA 1M5UA 3A1UA 4DJAA 3C1AA 4LDRA 2C3OA 3AL2A 1SVLA 2A9QA 2EV9A 3T15A 2NNLD 2DPXA 2J6BA 1JHVA 2B8EA 1FFDA 1KK1A 2HA2A 3B6JA 1ITZA 3C87A 3Q7EA 4HDKB 2F3TA 4XOUA 2SKDA 4RD2A 3PJGA 2I71A 3CLUD 4INJA 3SQMA 3QE4A 5JASA 2ZIGA 3PHGA 4EMBA 1J7JA 5K6AA 4ZAWA 1XK6A 1DCFA 1XU9A 4IWXA 4ETIA 5TEWA 2FEKA 4OUKX 4TLCA 1AQLA 4RLQA 1YQEA 2W4MA 4QYXA 3CURA 4BCDA 1ZCFA 1U0GA 3AU8A 5G1PA 2OEPA 3Q1LA 4IV5A 2I65A 3ZU5A 4IFIA 4EPWA 3LQKA 1XEXB 5AKLA 4ZVQA 1AQJA 3U80A 5KUTA 2JLZA 1VCMA 3Q0IA 1U7DA 2F17A 1S3FA 4LZZA 1UJ4A 4I4TF 1XE3A 3IEVA 3ZD6A 4ZT7A 3PQ3A 2GKGA 3DOCA 2FLKA 4ITVA 1L7AA 3MTDA 1Y6JA 2ZWPA 3MOGA 4NFYA 5FFMA 3SXUB 5I4IA 2VPWA 1E0SA 1YULA 2A5FA 2OZKA 4P84A 1DIGA 4UAGA 2PWZA 4HUTA 2P1RA 3ILVA 4Q3KA 4L22A 2LCQA 5KIAA 2VOEA 4CEIB 1CP3A 1U31A 3HU3A 4MV7A 1DUSA 3QWHA 1KYIA 4RPLA 1II9A 2HQBA 3LYAA 1FSGA 3H42B 3VX4A 3GT7A 4PCVA 4KQ9A 5I9SA 3H2SA 4ITRC 4S1OA 4EKEA 3IRUA 3NHMA 4DSNA 2VNIA 2HEIA 4CMEA 2QMEA 4RKRA 1B6TA 2ZJ8A 3TK1A 1UBNA 1QLJA 2HSDA 4I3HA 5FNVF 3BD8A 1TO2E 2R2GA 2EFEB 3ACDA 2YYZA 3RQSA 3P0RA 3UGKA 1W0CA 2QW0X 4BNVA 4CQMB 2JKYA 1N2CB 1D4ZA 3LPNA 2AG5A 3T4XA 2QW1A 1TZMA 2HRBA 3EXEB 1KEZA 4OM7A 5DHSA 5FR1A 5LZ8A 3OQNA 1LLQA 3G5LA 4AKTA 4EO7A 2I6UA 2JVKA 2K4MA 3KZVA 3EYWA 2H2GA 2J9YB 3HKDA 4NABA 1JDUA 4QXMA 3V1MA 2R1VB 3STXA 1JWLA 4J0IA 1T1JA 5BN1A 4F4IA 1VFNA 3JR7A 1U9JA 3SX4A 1SIOA 3E1GA 4KO2S 5LYJA 3LYHA 2OO7A 4CODB 4D3YA 2FR0A 5ENVA 2Y1OA 3ZHTA 4CF4A 2UZ1A 4KPUB 2R6ZA 1G9SA 2PX5A 3H2IA 4REMA 4DMRA 3K92A 3OHMA 3OIFA 4FQ8A 3C5HA 1XTIA 1EVLA 4DR6C 3V8VA 1EB9A 1EKXA 2WI8A 4EJFA 1G5RA 4QNNA 3ZNNA 3OE7A 3PFFA 3SMVA 1D0SA 3ZU4A 3QENA 1IAQA 1HDOA 3NHWA 4F3YA 2ZJ4A 4FGUA 2DMRA 3E3LA 2BR4A 3M6MD 5ALPA 4YQFA 4EJMA 2H2AA 3AHFA 4BDSA 2ZU6A 3KAPA 3EA0A 3I92A 1J06A 2JAPA 3OETA 4JEMA 6CHYA 3NUZA 1PZFA 3DTVB 3K9CA 4MUJA 2Y66A 4FI3F 1ONNA 5DM2A 4F9FA 1DC6A 3FKJA 2D2VA 2GX6A 4IJWA 1JHRA 4RACA 1KNXA 1ISFA 1U2ZA 4B45A 3O8OA 5T57A 5JUWA 1QGDA 1YONA 1L5HA 5KQPA 2Z08A 3QV1A 3E9EA 3V9AA 2P30A 4M7OA 4NQZA 2P77A 2I2FA 5CCBA 3A6PC 4ARUA 5JXIA 2YJ3A 1KR5A 2P6PA 3DVAA 2FKNA 2VK4A 4HATA 4HN2A 4HVLA 5F23A 4BATA 4EW6A 4RF4A 4UUMA 3KELA 4LXTA 1UBHS 3WJ7A 3T7EA 2YRXA 5AW5A 1NP6A 4IJUA 3THXB 2WUFA 3BKWA 3DEHA 3JWEA 4BO2A 1COWA 1EI9A 2OT3B 5FOUA 4R5MA 5F77A 1ZM3A 3Q3IA 2Q4OA 3K09C 5K0SA 5DYGA 2V7EA 2ZUDA 3GFQA 3P2YA 4KTVA 1V5GA 3O47A 4MUBA 4O29A 1JBEA 4MYHA 3QXCA 3W5IA 4DXHA 5L8VA 1JHDA 3GO4A 2H7CA 2I6TA 1Y81A 2OV3A 4D8TA 4AQYB 4C03A 1O94A 2DFPA 5AM1A 5KYUA 1QU3A 3FGZA 4IO1A 3U0BA 3H16A 4CLOB 3UAOA 1Z26A 4NMWA 3IE0A 4TZ0A 1JYEA 3GCZA 2WHXA 4K3UA 1J0AA 4TTPA 1QB8A 3M1LA 2FHPA 4CNBA 1QDUA 4UQLA 4G26A 4NSNA 4LHWA 3UWKA 3SS8A 1ORVA 3FOWA 1I32A 4LOLA 3L7CA 2WG1A 3DJFA 1LZLA 4YRFA 5DIZA 4EJ2A 1AKTA 5EWJB 3H8VA 4WZBE 3OP4A 5CM2Z 1DWPA 4LRYA 1MDBA 3R7NA 1QH9A 4YDHB 1E62A 1XJ5A 2PWYA 2WWHA 2FJUA 3HN2A 2E1PA 4B1FA 2YJ6A 1D03A 1TVKA 2XUJA 2R6GA 5KWSA 1ESZA 1JMKC 5T8KA 1F9AA 1BKDR 4JJEA 1XKXA 5I4CA 2QT1A 2NTNA 2ZRBA 5K05A 3CLRC 5I6DA 1RKXA 2F3UA 2FFRA 4X8MA 4L3VA 2YJGA 3GFOA 3AOGA 6Q21A 2HJRA 1ZDMA 4YJ3A 5FLEX 4NDZA 2NZVG 3FDZA 4MS3B 1PT9A 4MW7A 5L3VA 3K1ZA 2C84A 2HDOA 1C0KA 1JHXA 1A7JA 1NU8A 2GLTA 2HRCA 2M6RA 1KP3A 2BJHA 3M6AA 4P36A 4JI1B 3S29A 1MD9A 2CF5A 1FB5A 2P0EA 1RDFA 2Q7OE 5JJBA 5JADA 2W2NA 4B32A 4B2IA 5AM2A 3LWBA 2ZANA 3P9KA 3BYZA 1KXJA 2I4OA 1OAAA 3H1EA 4NBNA 1SG9A 1VE7A 2QVCA 4WBNA 3RAGA 4CIYA 4JYMA 4O63O 5IAGA 3SSNA 5C7OO 1V0JA 1ACJA 2EFCB 3CLUC 2C04A 4GMKA 1NVAA 1PQWA 4DCUA 1VG8A 4O2BF 5JBNA 5FLXA 1TJ3A 2XAAA 2MYTA 3GMSA 4MRAA 4ARZA 1IL0A 1RMQA 2NU9B 1AIPA 3OTWA 1E2NA 3BH7A 2P4UA 2D1YA 1M33A 1E1KA 4KSBA 1J7KA 3HB7A 1JFSA 1K8YB 3D6UA 1P3Y1 4MUHA 4QDTA 2PV0A 5EWMB 4BX8A 2WVJA 3TRFA 1PRYA 1ISSA 2J0VA 2ONKA 3PQ4A 4RYDA 5KHOC 4IOKA 3FTPA 3VX3A 1RKBA 2PS3A 1SD1A 2XXBA 4TMWA 4XWAA 4NCAA 2ZUSA 4ND8B 2R8XA 3UA4A 2F43A 1WWKA 1TLFA 4YWHA 4BMYA 3J81A 4CQLA 1ZUWA 3HJUA 5ALJA 1S9DA 3AHDA 5ALNA 2HV9A 4NMMA 3JQCA 5F7OA 4GU5A 3DHVA 4NBTA 4XQ0A 3T6KA 1UQRA 4XD7D 3FETA 3OCXA 2XJ9A 5LQUA 4JT8A 4PG5A 4RIIA 4R1PA 4O1IA 5TQ2B 3TPZA 5AKZA 3V4PB 2ZG6A 3TIXB 5KU1A 2IK8A 3K4PA 4EUKA 1PK7A 3A1EA 1CETA 5EJ7A 2OKCA 1W2GA 3TLXA 3WGLA 3AFNA 3F6CA 3BWYA 1M8JA 1NJGA 4X84A 1UWLA 5B55A 1QF7A 3TLZA 1ELOA 3OZCA 4YRNA 4B0PA 5LOVF 2X0RA 1IRXA 5FUQA 4P1ZA 3RTEA 3A10A 1FP6A 4KQCA 4TMZA 1EAMA 3A1NA 3QLUA 1JLRA 3OPQA 3QNMA 4GC5A 4HAZA 3TQTA 4WV3A 2Q9BA 3H13A 4IEIA 4Q39A 4BNJA 5EUQB 4B35A 1RQGA 3OKFA 1RM0A 4MV5A 4I50B 5DP1A 3AQIA 5B6IA 2HPAA 4KK4A 5HGJA 2UUAC 1J97A 3GPIA 5HF9A 1PR6A 3K6RA 1JLHA 4Z4HA 1NQTA 3DCYA 4EHAA 1KRWA 2OHFA 3AEKA 3BF8A 3OTGA 4MVWA 5G4KA 4KLNA 1XXHA 4HO1X 4JUIA 4P4SA 5EERA 4ONEA 4PV7A 1I24A 1M2VB 2RI6A 3ZQKA 3LRPA 1K1EA 5I4BA 4H1HA 4LJLA 4UTXA 2IQIA 2IBSA 3O1IC 1P1IA 2I4IA 3D8BA 3MQ4A 2F00A 5ALWA 3SVLA 1NLZA 4FYYA 3BF7A 2XF8A 4K3VA 3TYXA 3UMJA 3FZEA 3FRJA 3M9WA 4J91A 1OPRA 1E1CB 1V8OA 4ZCQA 3B70A 2AOUA 3GFVA 1FSFA 4CZ2A 2JCGA 1CZLA 4CKYA 3D1LA 1M34A 3HKCB 4FCVA 5AOVA 2APJA 4MH0R 2W6MA 4MJ7A 3OMXA 4QXRA 5DBFA 4ZVUA 3GFGA 4FU0A 5AI4A 4OSPA 1RD4A 3UJBA 3CY6A 4MO2A 2LVBA 4RTNA 4MQLA 5AW3A 3H1FA 2VQEC 4PO8A 4TV8B 5EUBA 2ZUTA 2V9CA 1PJAA 1ZU4A 3ADCA 4I9FA 1KP9A 3KXIA 4RADA 1EFLA 1MH1A 4W1SA 5CLLA 1ZL0A 3AUUA 1JDZA 4D98A 5KSWB 5HG0A 4LVOA 4W82A 3MSXA 1OIWA 1U5AA 4XWOA 1DARA 2OHVA 4MHOA 4JLJA 2H29A 5M5BA 1FLDA 4X8OA 2MMCA 3THSA 1KI1A 3CNHA 1UFKA 2J3IA 3FOBA 3U09A 3A7EA 3JX9A 2QZSA 1YDWA 1N34C 3QFFA 4AY5A 2H51A 3FCCA 1NUUA 3R0JA 1ZVKA 3OIGA 3B8HA 1N9GA 4IFEA 3L8MA 4NU8X 4PRZA 3PFIA 1UJBA 4R8VA 1KO5A 2NUPB 4HB3A 1K7XB 4HP8A 3EFBA 1CR2A 5DN9A 5DM60 2GA9A 4B7UA 3KLBA 5JATA 2XTJA 3MCAA 3OIUA 3TNYA 4C7JA 3THYB 1JA0A 3NHUA 4QLBA 1DXHA 2ZTLA 3H86A 1U6JA 4GMXA 1AKNA 3WKEA 1UCFA 1ZFNA 2VAWA 1HQDA 1NKSA 1QCDA 1U2EA 4L7QA 4MGHA 5JCOA 2B83A 1Z8FA 1USPA 3RREA 3GW8A 4EMSA 3U44A 1G3QA 3N9IA 3W6ZA 3QZUA 5ULLA 2ETXA 3CWZA 1A76A 1J2YA 3H18A 4E21A 4ERNA 3C70A 5ECGC 1EPUA 2OXFA 4HLDA 3RV2A 4BN4A 4MA4A 4E5UA 3LQ1A 2QRJA 3TXXA 1RP1A 3KLNA 5IP5A 3AF2A 2I03A 3H9QA 3KKQA 2AOXA 3BX1A 1TT5B 4HYYA 4W99A 5EPEA 4J2OA 1NMXA 1WG8A 1OR8A 3ZHZA 2PUDA 3O31A 3KSRA 3D4LA 1ODKA 2OO4A 3DWGA 2PKWA 1OWPA 3S2YA 1SR8A 4JBYA 3DTNA 5HM6A 1XEAA 1KVRA 2X5OA 4PTYA 4OEHA 1XVLA 3T0FA 4NS4A 3LY8A 1WXHA 2ATWA 1P2FA 2Y8EA 3ZWOA 5IFLA 4ZOLA 1PWXA 1L7NA 2K5UA 1I01A 2ATVA 4DLWA 4EHJA 3G2KA 1XFDA 4AKEA 1U0TA 2J0QA 4X71A 3ENZA 3L0SA 3EZYA 2VR1A 5KVAA 1X7ZB 4FCWA 3ER9A 3AFOA 3HI6A 4AWXA 1MC8A 4P0TA 4GIBA 3TGLA 2VI5A 1QHIA 1VG1A 4RGVA 3GMDA 4QJ4A 4MEAA 3QSYA 3K9BA 5T7BA 2MSKA 2ZZMA 1P1KA 4JEIA 4YMSA 3FGNA 1XZIA 1HE4A 3GAMA 1K08A 3PVSA 4L1KA 2UYCA 1GJRA 1M8FA 4BO6A 3WLMA 2V03A 5EMHA 3N74A 3NWEA 2WE8A 2OVFA 2WU3A 2F1IA 3L46A 4DKJA 1ILEA 4QL3A 3LK6A 4XTCS 4XQ9A 4ZQIA 1USGA 2HA7A 1V1RA 1RQNA 2Q3MA 3ICEA 3HU2A 1NW5A 1ML8A 3O4VA 4Z9FA 1P5JA 2CL0X 3H5WA 4OH7A 1KMHB 4MW4A 5CBKA 1VMKA 4AD8A 2Z51A 1HR0B 4TM7A 2PUBA 1HDRA 2CL5A 2BAGA 2RG1A 5CJPA 3U7JA 5C8VA 3QVWA 2AC7A 4J16A 1B1CA 1VPDA 1I94B 2WBLC 4P5EA 5B3KA 4JDPA 1E9FA 4Q34A 1ZH6A 1GTG1 1M1NB 1P1HA 2DJ5A 3D0KA 3QEKA 1NDHA 3QIVA 3JQEA 2FP4B 3R0XA 1DDIA 2YV3A 5IAEA 1CRWG 2MCQA 1Q5PA 1C0IA 3ZV7A 2C96A 5CDFE 3QITA 1N1GA 2P2NA 3AUKA 3M6UA 3V7FA 4O4LB 1V47A 4A0RA 5AHOA 4H3KB 2I2AA 3ROTA 5I9BA 4EG0A 2OYRA 1G60A 1MIHA 4H16A 2QROA 3WK6A 1SQ0A 4Q1DA 4Q66C 2OLEA 2P67A 2DHQA 5ALLA 5A6SA 1QIGA 4ZO7A 1BSVA 3RYFA 4ADSG 1ADCA 2YZMA 3HCRA 3NO4A 4J29A 4Y1RB 1RJ9B 3TNDA 4BWGA 3QUCA 4C2AA 5IMSA 3OIWA 4L5CA 3VDQA 4EDFA 3DPIA 1WU7A 5AXDA 1WHTA 5I47A 3O21A 4LGCA 1I1HA 4S12A 3URKA 3DBLA 2YMLA 3F97A 1RRMA 3MELA 5EGSA 1UIRA 4R9VA 1P3DA 4N8DA 3RRJA 4MUYA 1FK8A 3DO6A 2W8ZA 3DPSA 1ZK0A 4LJ5A 2YBEA 1E3EA 4RMGA 2GHIA 1DUVG 4EF4A 3TBKA 1MX3A 2HTEA 4R31A 4TTIA 4GL4A 1FBNA 2IYWA 5JPIA 4B7XA 4IJQA 3E9CA 2A9PA 3C7CB 1Z88A 4QFMA 1KH1A 2HWUA 3U4IA 4X5OA 3SOZA 3H1GA 1BIFA 1KZHA 3FTFA 2AQIA 4G5FA 1V43A 4LMRA 4JFAA 4UDYX 2HU2A 2XGJA 4XB6B 1RT9A 2IYTA 1V4VA 3DB2A 3EMVA 1TA4A 2QYHA 4TWRA 5FOWA 2R4UA 3D7RA 3IP6A 3T1QA 1UXOA 3DL4A 4GR9A 4TXJA 3VV3A 3VHXA 2AMLA 2PGNA 1DKUA 3W06A 2BEVB 5J9FA 4BGEA 3WA6A 4JYZA 3L1IA 4X7MA 4HLCA 1DJOA 1GGEA 2PMCA 3BG5A 1BX3A 2SECE 4B71A 5AXCA 1G6HA 3HK2A 4IIVA 4MYRA 5E6SA 2E2WA 2W6ID 4UNPA 3SIWA 4WQMA 5LUAA 1QRRA 1DC3A 2FWIA 1FFXA 1MOZA 1HZJA 5THQA 2CYBA 1AQIA 2OECA 4NICA 1XGKA 4P58A 4V24A 2HMAA 5EP1A 1FDVA 1P2VA 5TQ0B 4YRKA 4RFSB 2NO7A 3EQ6A 1NF3A 2FPOA 1D9ZA 1LSUA 1T9DA 1XCLA 2ZJ2A 4TUYA 4DLSA 2CJYA 2BFBB 2GPJA 3A4TA 4MJ3A 1E1RA 1M6WA 4L4XA 4CTOA 3EVBA 3NOXA 4KIUA 4PAOA 1QPBA 1QHNA 2QTZA 4YFVA 4KFUA 4E2ZA 4ZK6A 1TJ5A 1TF2A 3NTXA 5AQEA 1NE7A 1KVUA 3GDFA 2PEZA 3DW1X 3HP4A 3VMMA 1ES9A 2VK1A 4BWYA 1XZHA 1H22A 3W3AA 2G36A 1NY5A 2G06A 3WWYA 3NS7A 4P33A 3IILA 4GEKA 1YIOA 4H1VA 1PX2A 1Z8NA 3LOUA 3MGAA 4PNZA 2Q4DA 5FBQB 4X66B 5KNBD 1P81A 1AF4A 4JC4A 3DTTA 4RA9B 1CJBA 2MIIA 2WT9A 1CUIA 2FFQA 5FORA 3TZLA 4B3FX 1FJXA 1FP4B 2QI9F 3ELWA 4F06A 1JW9B 3TI7A 4DBLC 5G0TA 2ATCA 4LYDA 3EVFA 5IHXA 5M34A 2C1EA 1LKZA 1P62B 2HX1A 2WSYB 1HR0C 4OLFA 3L0CA 2JI8A 4X0EA 3UV7A 1IN6A 1Z34A 2EG5A 4IQFA 3UWPA 3CJQA 2RH9B 1BGWA 1Z45A 2ABWA 2GJ8A 2QU8A 3IAS1 4JLPA 2B9EA 4OBBA 1IWBB 3VKFA 3X43A 4A8JB 4ASUD 4C76A 2UUBB 3U49A 1ZJJA 3OQ6A 3QMWA 3I3OA 1OZ0A 2IIQA 3E1SA 1HE1C 3RS4A 1B8NA 2GB4A 4FNGA 3UMFA 3ORQA 4MYUA 4QAJA 3NBKA 3QELA 1MVLA 4X3PA 4Y2XA 2ZE6A 3EMBA 3VTKA 2XBLA 5E95A 5H16A 4RH0A 2PUFA 4YT5A 4IDEA 4G5OA 1IMOA 2IH5A 1SCJA 1G20E 2HTFA 1P6XA 3R3JA 2H7VA 1Q3KA 4ZVLA 5TF0A 1QRTA 3A6EA 2GNPA 5K3CA 1DBVO 1YR1A 4BGVA 4LF6B 4I4IA 4UMEA 1WOMA 2A33A 4PZLA 4X7RA 3TRHA 1LH0A 3HDHA 3LMKA 2QN8A 2D1FA 3O93A 4ZEOA 4NJOA 4X6XA 1C9KA 1JG7A 1I5EA 1T2FA 4Y9TA 4BLOA 2PX0A 3SHWA 1T9GR 1TKAA 4P7KA 1GGHA 1L5QA 3PFKA 1Y6ZA 1YZ3A 4TMFA 3L4KA 3EVGA 4JT9A 3QLVA 4P3NA 4IY1A 3BT7A 3CQ2A 3RYCB 1HFWA 5AK6A 1NUTA 3CKKA 3IIJA 2EKPA 1PSDA 3OSUA 1HSOA 1X42A 3UOGA 4CTMA 2UYOA 3AFHA 3OD5A 2FPXA 3CZRA 2H4WA 4MIEA 1A95A 1AXEA 1L4NA 1Z2CA 4PYOA 4EYOA 4H1WA 2MWMA 1AGXA 2ZYRA 4TVSA 4DR2C 2H9YA 8OHMA 4JNKA 3PDIB 4GOJA 3FWHA 4FONA 3ENQA 3IAUA 1A97A 4OM8A 2JHPA 2FUEA 3PRYA 1BJKA 2PSSA 2YYYA 1N0WA 1DJPA 3VR5H 4HDSB 4RIGA 1ONPA 2ZWIA 4XDZA 5TMEA 1JVNA 2HIGA 5G41A 3WOVA 1BH2A 1UFQA 1I51A 4K26A 4DSUA 4WCFC 5LQRA 4D43A 2WVHA 4X1IB 3F7OA 4ILEA 1A27A 3GPBA 4I4NA 5DLDA 2R3SA 2XMQA 4WZAE 4AS3A 5C8YA 4WOCA 3WBFA 3GVXA 1MEOA 5C0OE 4R1TA 3DUFA 4PZAA 3CF0A 2MSDB 1T4MA 3NYQA 1HT3A 2Y2VA 5L3RA 5PNTA 2VQFC 3QKIA 3QX8A 1PS8A 2FI1A 2IKQA 2ZVJA 2X0EA 3DTYA 1C7EA 2HC9A 3TFWA 5AK0A 2YZKA 3DMFA 1UXIA 3DVQX 2CNKA 2BMDA 5IFIA 3RBXA 2DWPA 4NOJA 5EAIA 3VTZA 3WDKA 5HZKA 4ZVNA 3S27A 1QC5B 1Y4AE 3DQPA 1B0UA 2ATEA 4K6FA 3S28A 4ER0A 3K0CA 3RU2A 5B7PA 1WULS 3VNBA 2YFHA 5CFRA 2PE5A 1AVTA 3KVYA 1YRQA 1NW4A 4RSRA 1E2QA 2GEDA 4URWR 4EPXA 5C7IO 1GZUA 1OYOA 2AFIA 3CINA 2OCDA 2P2CA 4I4CA 1VKOA 3ZV3A 4Y6SA 5DTMA 2PUAA 4LV8B 4BQNA 4CCYB 4GMGA 1JA1A 4B3BA 3L79A 1U0BB 2BGRA 3ZU3A 1NBMA 1JLLA 5FUBA 1HZZA 2IYOA 4EZBA 4TT3D 2ZJ6A 2AFHA 1YBHA 3UY4A 2YUIA 5KYYA 2SICE 4CKBB 4TOIA 2A5JA 2FUG6 1ULAA 4LQ4A 5C52B 4L85A 3WTBA 4PU0A 3NRBA 4NYMQ 2XRFA 2QNRA 5AJVB 3B82A 3NB0A 4A8JC 3DPUA 4BSZA 5AUQA 4YRGA 4AJ2A 2GZDA 5BYAA 1F2TB 3CNEA 4PLZA 2QUHA 4WUVA 1EUDB 2W2LD 3EUEA 2PH1A 2ACKA 1Q91A 3K2QA 4KGVA 4M1KA 2IL1A 1QHGA 7ABPA 2PGJA 3PQ8A 1VRWA 1L1FA 1WZCA 2IYVA 1PJBA 3DCIA 1MBZA 1ZM9A 1K9VF 1PEYA 3BM5A 3FPKA 4JXKA 4MLPA 3IAFA 3FUXA 4FE3A 1G7TA 4MIYA 1HFKA 1MB2A 2WDPA 1U9ZA 2VTDA 1HLDA 2YL2A 2ZSEA 3AEYA 4GPD1 2GLXA 4KE9A 4M9RA 4JLSA 4Y2TA 1QHHA 1PP4A 4GUDA 4LF6C 1D2NA 2W6PA 4Q03A 3T61A 1D1TA 3LA8A 4EQZA 5BQXA 4BXOB 1MAHA 1ZB8A 2ACWA 2PLNA 3D5EA 4HH3C 5DF1A 1CDZA 1QFZA 1Z62A 5ANRB 2VL7A 4RHTA 3DL2A 1OCEA 3OIYA 2YVAA 1S01A 3PDCA 5J58A 2DHMA 1U2DA 1CUZA 4MULA 2CLLB 1YAHA 5CXQA 2GYVA 1RAIA 3HBJA 1Y5IA 3HG7A 1A9RA 2WKWA 3MW8A 4JQSA 5TE9A 5E9AA 1Q1NA 3ZQUA 1OLUA 4OTZA 4A16A 3TW4A 3D1JA 4C07A 3H5IA 1FMTA 3KZOA 3L4BA 5A03A 1NMSA 1VHJA 2NPFA 3TJZA 3X0DA 3WK8A 1T3ZA 3OT5A 4DMMA 2OYCA 4F9TA 2WT4A 1NJFA 1EMDA 3Q7IA 4UC0A 3JV7A 5EXXA 1FUKA 1OZGA 3ROPA 4LPSA 1IUPA 1BFUA 4JP2A 4MA0A 3PNMA 3C48A 4HEQA 4N49A 3VO8A 5DNAA 3VVLA 1X80B 3T9DA 1SKYB 4K2AA 5JFTA 4WK6A 2I7DA 3A36A 1I9CA 4CF3A 1Z47A 4OHWA 1IK4A 5B1EA 4RTLA 1DAMA 2R6FA 2HCFA 4GUAA 4ZTZB 4L3WA 4PY2A 4Y0AA 2V9PA 5JYBA 2K7ZA 4KQ1A 1A2BA 2YQ4A 4G65A 2DWOA 3TRIA 3U9TA 4XM2A 4EOGA 1NNEA 3BQNB 1AM4D 3RANA 3DCJA 3OM8A 4X85A 5JVDA 1EXWA 1OF1A 3PL5A 3NTVA 1V3UA 1SCIA 4D79A 2HF9A 1UZAA 3FUWA 1H69A 5A7GA 1FXUA 1GU1A 1PJRA 2QAGB 2O7QA 5HPYB 3LUKA 1Y48E 3GGCA 5FPHA 3ZH2A 4UDXX 4BVEA 5LZ2A 1D3AA 1SHKA 1PR9A 4BO1A 4LFCB 2HWKA 1P7VA 1CVLA 2WKPA 1TQ4A 3FCOA 3N5KA 1GKUB 3A1SA 3IHKA 4TV9F 4YK7A 3ZE2B 2QMOA 1WTAA 2E0IA 3MINB 4TWJA 2IHUA 3C7DB 4ZVTA 3CLSD 4NBRA 4U6NA 4ZAVA 4EYKA 2R6DA 1BEEA 1SVNA 1YZKA 2O8VA 3QMMA 1XNGA 1F2VA 1ZHFA 3I9LA 4OSEA 3HCNA 1R0XA 4EW2A 5KTMA 1Q50A 5COBA 3ZGXA 2Z43A 4J43A 4RANA 2FZKA 5FTJA 4C22A 2C3YA 2WV7A 3NBQA 3OUZA 5IN4A 2BRUC 4DNOA 3REQA 2J46A 4MVJG 4NEGA 1F4VA 1N2CE 1JJBA 3UJ3X 3O4HA 4EA9A 2DUUA 2EGHA 2FCRA 3H7IA 4MUNA 4CEJA 1TU4A 1DDGA 1QG6A 1E2JA 4HAVA 5COQA 1VL0A 5IT9A 2ZRGA 3DR5A 2X8JA 2F3PA 2MMGA 5C4IA 1MABA 1OFVA 4QGFA 4RNDB 1UMCA 1YB1A 5EEHA 3WYFA 4EYGA 5BOSA 5EJ9A 1KAEA 1Y3BE 1XDSA 2I8AA 1TCCA 4Q02A 2OCLA 3CSDA 3HXTA 4URUR 4F4FA 3QJGA 1LWOA 4LMPA 1K7CA 3VR4A 3P2KA 4XDYA 5AK3A 5FCDA 1WSWA 3SCZA 1UEIA 1O9TA 3GLGA 1DJLA 4MGZR 5ALTA 5IDYA 2ERCA 1JMVA 4X95A 4EUEA 3H19A 2J8ZA 3E0XA 4Z1MD 2DAPA 4OHCA 1ZNZA 1ZX1A 1ORIA 3GJSA 4O1HA 4UNQA 2YXDA 5BWBA 3P52A 4MA5A 3CCBA 3DV0B 3VZSA 3WGIA 4HNTA 3HXQA 4I1PA 1WMAA 2WNIA 3V1NA 3B6ZA 3W4KA 3SF8A 1YGPA 2BSQA 4B79A 2PMWB 5FV4A 2IS4A 1V8PA 2ZBVA 2ZPTX 1AG9A 3EDOA 2D0PB 4OJMX 5F64A 5L3QA 2JIMA 4BEWA 5HZHA 2A30A 5FD8A 2FRXA 1LI5A 2L69A 4BEJA 8AT1A 4UM7A 1EQUA 3UB4A 3LY9A 2VNJA 1OYVA 1QZTA 4KQHA 3PRKE 4MWTA 1VE9A 1ZIPA 2EL7A 4QQ8A 2A9VA 1V35A 4W8OA 2M6LA 4DMGA 4Q4CA 1QIFA 3S8YA 2R7MA 4PYNA 1HT0A 2X4GA 3VZCA 3CGGA 3GVHA 1R0LA 1ECPA 4QQKA 1BS1A 5K2MA 3KOXA 4O6VA 4D56A 2XEXA 1T9CA 2NZJA 1OWNA 4DPMA 3DO5A 4RVFA 3E81A 1ZUNB 3ASUA 3AHHA 4TRNA 4A2QA 4ECEA 2VHCA 3F2IA 2B0CA 3BJIC 5LQDA 1L7XA 1SBNE 1R6AA 5F52A 2LCIA 2PO7A 2FSHA 4HH4A 1QYWA 4MI3A 2ZYDA 3K1TA 3B7WA 4B6EA 5KQSA 4HMOA 3AY7A 4REQB 1W8IA 1XP5A 2VP9A 4HEA1 4H3VA 2GTHA 1HOXA 1GHTA 5FYDA 4IG4A 4QREA 4UTVA 3EA5A 4EEKA 2ZETA 3LQQA 1KGDA 1UMBB 3DWIA 1EH5A 4NVRA 1D4OA 4QARA 2XNDA 5DHQA 2H65A 4OKSA 4GG1A 3ROEA 3NMUF 1VIVA 2YJ5A 3JQ9C 1K5GA 5HNKA 1EWQA 3COYA 1AUPA 2OUKA 4JR1A 3IBTA 4LOJA 2JIZA 3STWA 1C14A 2QAGC 2QD1A 3CBQA 5L40A 2HSZA 4L5JA 3G9QA 3FIJA 2IEGA 4LJRA 3HA3A 3NC1C 2HPZA 1UPFA 1BAPA 3JQAA 3KKLA 2O54A 2FFAA 3GJ5A 4LFCC 2RONA 4G25A 4N82A 5A3JA 1Z28A 2O6LA 4L74A 3CM0A 2ZQYA 4MVYA 3RU3A 3P2JA 3T7SA 5DHUA 4GXQA 2O2GA 1QRAA 1GR0A 4RZ2A 2V74B 3OECA 2WIKA 2ZJZA 5KOHB 3L8CA 1LBHA 2PT6A 2WSBA 1EJ2A 1U9CA 1Y1TA 2ZW9A 3OOHA 5HF5A 5IBQA 4Z2YA 5A71A 3C3XA 4N8EA 1Z5OA 2ZS7A 2P9TA 4RJJA 2CNDA 5FPTA 3ZCQA 4E51A 1VPTA 1A1SA 1S7GA 2HBZA 1N8KA 2C2BA 2XBUA 3JRNA 1KY5A 1LW7A 4QECA 5TGDA 4KFTA 3MZ0A 3MUFA 3EDYA 5HZMA 4I1RA 4WOPA 5IT5A 1TTTA 4BPRA 1Q1QA 4JYCA 5KBYA 1MO4A 3NBAA 3PX7A 1NXOA 3RTDA 3EZFA 5FF9A 1H2EA 1HPLA 1PO7A 1W2WB 2IPXA 4JD5A 3C4QA 4MWSA 3UWSA 3WKAA 4B46A 2X86A 4ZHQA 5ES4B 1RHMA 4MQBA 1YB4A 1JHQA 1PR3A 5CFZA 3TTTA 3IBFA 1Z2PX 3R6TA 4LNAA 1Z0JA 3VZPA 4KDEA 2H6EA 3ND5A 2O8EA 5T4EA 4IQ0A 4CF7A 3NHPA 1SCAA 2RI1A 4MWDA 1RQPA 4HY3A 2AIRA 1QGZA 5DP2A 1K6MA 2OPLA 1V3VA 4QDOA 4PUGA 5ES3A 2CV1A 1CQPA 4L78A 4BKPA 2ZOSA 4R6WA 5JROA 3RE1A 2NTJA 4U2KA 4NXNC 1KDTA 2AVDA 3JW8A 3WZLA 2LPMA 4LOIA 1VSQA 1GL3A 1G7RA 4ZGBA 3VAAA 3ROGA 4PFSA 1ZL2A 2QUAA 1BQEA 3E05A 3IP1A 4HDQB 4OB6A 4R0VA 3IR7A 4HLUA 1PL8A 4RYLA 3UJCA 4F04A 4YY3B 1XAGA 3JWIA 4HQOA 1JAZA 1YXMA 3CEJA 4NECA 1VGQA 3OQVA 1N32C 1Y7LA 2PD4A 3CZQA 2XIQA 3SFTA 3TMYA 4CPDA 3DEIA 3HY6A 4G9BA 5I3ZA 1L7OA 3ES9A 4M1SA 1PZHA 2CBZA 2DB3A 1P9RA 3CFYA 4YTEA 5HKBA 3T1HB 1CXZA 1FSSA 2BKLA 3ANSA 2OYSA 4AMGA 1LLFA 1QJ4A 1QGUB 3Q40A 4WUTA 3SMQA 2VQ6A 4ER3A 1SIWA 1DAOA 2JH9A 3CLSC 3COPA 3EC7A 3GLIE 3NC0C 4JI4B 2OZLB 2P9HA 1YK1A 1P31A 4INAA 4J0JA 5CFLA 1I3CA 4RV4A 1RTTA 4N0QA 1Z08A 3T5GA 1AX9A 3BMQB 2OQ2A 2R8ZA 1DB3A 4H08A 4DA8A 4IQ4A 3NPDA 2GAOA 2PRSA 5J5AA 4I5IA 3K1JA 4F7WA 3TDMA 4PSAA 4J0EA 5GWXA 4BX0A 4ZZ3A 3O73A 3TCXB 2F8TA 5JH7A 4YYEA 2VBFA 2WTMA 2I2BA 3C8DA 1HDZA 1K3FA 4UUNA 1NLYA 1CT9A 2WG2A 3IC5A 3WMGA 1JALA 1AHPA 1GOTA 1TUBA 1ZH4A 2C5HA 2JATA 4OHVA 4U5XA 1H0KA 5L53A 3ZD7A 4RMJA 4E32A 3DEJA 3UWOA 2CNWD 2C0PA 1ZI8A 1GIAA 1QVVA 4PC2A 4RL4A 4BASA 5K6TA 4LRUA 2FPUA 1EUZA 3D6AA 4B8WA 3W5SA 4CKEB 3E58A 1G8SA 4P53A 2HD4A 2GZHA 2DLNA 1KH2A 4C4ZA 3WWPA 4D0RA 4EFLA 1CVIA 4KMOA 1OXUA 1FYFA 1ESDA 3FPHA 1M2OA 1PE0A 1Q0RA 1RAFA 5GADl 4EVIA 3JU3A 3QH4A 4QODA 3CX6A 2V7XA 1Z33A 1REQA 3R44A 4I8DA 4F8JA 2ZWMA 2Z6UA 2A86A 3OH8A 3SIPA 1RE0A 2C94A 3GT3A 4YV0A 1YOBA 5LVAA 1OIVA 1XDZA 5KTSA 1Y1LA 2WD7A 1QBGA 3Q7RA 3OJLA 3F49S 1JT2A 1LU9A 4FOSA 3V8MA 4BGIA 4DV5C 3LFHA 4W5OA 1DC7A 1SULA 3FTDA 1RWBA 4MGYR 1H4VB 4NAVA 4KLZA 3T12A 1RRGA 4JLAA 4FHEA 2YOGA 1FMJA 4C20A 7MDHA 2QRUA 2DXIA 3RTCA 3K8YA 3L1HA 4RVGA 3ZY6A 5HUQA 1QDEA 4L4QA 1IUOA 1BHJA 5J2UB 3USCS 1KK2A 4E33A 5ITZB 3OZIA 1XF1A 4EB6B 4A0QA 4LWQA 2YY6A 2YQZA 1CEYA 1S3IA 3GR6A 1HDCA 3LX8A 2QV0A 4ND5A 3ZQJA 3LBYA 2VDMB 3MB5A 2RFLA 2W98A 2GJAA 4GGOA 5DLPA 1W29A 4F6CA 3T1YB 5FWDA 2Y0DA 4D57A 3CISA 1AS3A 2CXQA 3KTFA 1QP8A 2C57A 3WFZA 4AYTA 1M75A 1GV1A 4BJ3A 1DKNA 2LCFA 4C4SA 4BJ6A 5CCEA 1PG4A 3D8HA 1T1SA 4INZA 4G0OA 4N5HX 4PPQA 4QQFA 5KVSA 1PKEA 4EHKA 1V96A 2B35A 2Z5FA 4C0LA 1RI5A 5CPBA 1S2IA 3AONB 3B38A 4YV1A 5C1OA 3CG0A 1RRVA 4DCSA 1LZKA 4MRMA 4DRZA 4EQ6B 5KJFA 3CS3A 3RVQA 2F3SA 3S2GA 4DLPA 1RYNA 3IV9A 5EKUA 4YY3C 4RTKA 2K6GA 3R9XB 2O7VA 4PWYA 2M9MA 4C5AA 2IZOA 3BJZA 5BR7A 2R44A 1NBAA 4QPZA 4RHYA 4AULA 3JAKA 3AF3A 3FNRA 2WFZA 3MT8A 4D8YA 1XAIA 4IR7A 4GZLA 3H6HA 5B4TA 1ZVJA 4HPVA 2FQYA 4D3SA 1DINA 3L4JA 3T1HC 2BFFA 2WPDD 4CCWA 4PRKA 3M3HA 3N7TA 4TL7A 1MXAA 3LCJA 3W34A 2PY6A 3PVCA 4JLKA 3YASA 2WA2A 7REQB 4JI0B 1WCJA 1WS6A 3AVQA 4AZVA 1BDJA 2Z4RA 1YWGO 5CXXA 3CW9A 2X19A 3V32A 4HLQB 2CT8A 2CMFA 3CNLA 3QVSA 4Z49A 1KK3A 2QR2A 3LVBA 5IBPA 3VPFA 4OQMA 1X8KA 4HADA 3JAWA 4N03A 5C81A 4CEHA 2QRMA 4WN3A 4R0MA 1E4VA 1OI2A 4KACA 5CIYA 5CA0B 5CD9A 3KKNA 3LT1A 2I1WA 1TA9A 1QYRA 1QQ5A 3LQRA 2G4CA 4NCBA 1QX4A 4OFZA 5A1GA 1H1TA 2IV7A 3BCHA 2QS9A 2ZBFA 3AR9A 5GONB 1F06A 4XWYA 3W4IA 1Z2NX 3EJWA 4WOKA 2HWYA 2LXNA 3I4CA 1RBMA 3KAQA 1WDKA 1ZSNA 4YP7A 3JR3A 3ZY5A 1NBWB 4AY6A 1UBFA 2PX4A 4ZV9A 1I7DA 1GSIA 1M2HA 4O25A 5CVUA 3B60A 4ZJPA 4WBNF 2QTVA 4UEOA 4IDQA 4DIEA 2ZPUA 3EEBA 4UW9A 3ZE8A 4IXTA 1IYZA 3HKEB 3I04A 4GVXA 1QRUA 4BFVA 3HVUA 1G42A 1GPBA 2AI2A 1DEKA 3WL6A 2J6CA 5DRTA 5CEFA 1MV8A 3L7AA 1PD1A 3AC0A 1O0CA 2ZUEA 2NUTA 3KEQA 4KO1S 3VO1A 1DTSA 4NV1A 3MBKA 4FWBA 2BMEA 1DBRA 2I2DA 2XCQA 5LQMA 2WM3A 2XPCA 4G1UC 4ZQCB 4JYBA 3EZ6A 2C9BA 3I4LA 2A7XA 2DPHA 5DV9A 2D1TA 2BDEA 1J6UA 3GCDA 1PF7E 1FFBA 4QLOA 4ZHSA 2HO4A 1C80A 5L95A 2Y0BA 3NI2A 2IF2A 1JWBB 1GA6A 2P68A 3ITKA 1PEKE 4L5BA 2ZDGA 3IALA 3W5HA 5IF3A 3N6XA 1YS6A 2KYRA 1JU4A 1ML3A 3QOXA 2WNHA 3ILYA 1ULBA 1D4FA 1SURA 2DQSA 3HU1A 4M1QA 3AR4A 3TSCA 3I61A 2VRNA 3T1YC 1FNCA 3FB1A 2DLDA 4TTJA 1LD3A 3MTIA 4DV7B 2P1DA 3LQ2A 4J4BA 1ISPA 3HN7A 5JARA 1ZW1A 2W48A 3IJEB 4X1YA 5TJHA 5K3OA 4OHZA 3U4CA 4CXMA 4EG5A 3PXDA 5DGTA 4UMFA 3QKSA 1WY5A 3HFRA 4AZ3A 5LCXA 2OORC 3F78A 3JASB 3OJWA 3GVCA 3NDRA 3QWIA 5ALSA 3TOVA 5JNSA 1QIMA 2VJMB 1D9XA 1U2PA 2WSMA 1N5KA 1OI4A 2HRDA 1IG3A 5JBIA 4DQ0A 1L5FA 5BN3A 3CVYA 1GCAA 5REQA 3GCWA 4RY9A 2RHMA 1S96A 4IQGA 3EEQA 5K2OA 1KI7A 2NVBA 3A1FA 4B6QA 3UENA 1CPYA 4UM8B 5LXTA 1BHQ1 3KOZA 4XLLA 2G8LA 2JK0A 3L3BA 2IPNA 1E3LA 4RVHA 2FAXA 2WZCA 3JQBA 4X91A 4EHDA 3PGMA 3IA7A 4OLAA 4A6EA 1SUCA 4F1WA 4KDRA 1P80A 3DVRX 5EXPA 2QN7A 4UVHA 1VEHA 1K4YA 2CNBA 3PNVA 4J0CA 5E9QA 5HRCA 5I9NA 4KYVA 3HBMA 1M2KA 4ZU3A 4B7ZA 2CZQA 4NP6A 2J9RA 3LO5A 4JI0C 5JZBA 5KO2A 3E23A 2H1IA 2QG4A 1PSWA 4HWTA 1XU7A 1G21B 1KKUA 4AKHA 5B2FA 1MJHA 2MINA 3BUSA 3PKIA 2OSVA 4LDQA 3VH3A 4TKMA 1CQJB 1NG9A 2XYVA 3ICPA 2AMYA 3N2YA 3P9XA 5DHAA 2AZXA 3GAZA 5FLYA 2VH5R 3GQBA 4D82A 5IUNC 3QF4B 5CM8B 1CEXA 1A4IA 2P7HA 1GUBA 1L7MA 1ESCA 4HGNA 3CRZA 1IJEA 3FUTA 4NCJA 4RULA 1TQHA 2MOKA 3FI0A 1XVAA 2AZTA 4BRSA 1NI5A 2BGLA 2XDWA 4N5MA 2HCBA 3DB1A 3HFSA 1QK3A 4QGBA 4BO4A 5I7UA 4X62B 2W5UA 1T5SA 3NV9A 1NR1A 2VHTA 4IXDA 2BGJA 3DGFC 3WQQA 3SPXA 3L8EA 4JV5C 1H0RA 2H63A 2C4HA 2YJNA 1OKKA 3EIUA 1WDMA 3O7WA 1V7PC 4FN5A 1U8FO 5CA1B 4FWTA 4KHPC 3D6TB 2JLVA 4C0BA 2Y2UA 1N4DA 5E2AA 4E88A 1GDTA 4ZLPA 1KP2A 4NPCA 4Y6LA 3OZEA 2WY2D 1ECJA 3TLYA 1T3TA 4W1QA 1WSDA 3PF8A 4ZYTA 4A27A 1NXXA 5E7MA 2ZUWA 4L9SA 5FPPA 4BVAA 4DIOA 3MD9A 4GAEA 3JVDA 3MRTA 3FRHA 3H0EA 2BUBA 3U48A 3Q0TA 3IKMB 2L42A 5CB4F 3Q72A 1M7GA 2C2OA 1M73E 1KE2A 3DMYA 5JISA 2PYZA 2CEKA 2Z1MA 1N8SA 2VDVE 3DFFA 3OX3A 3H6KA 2AE2A 1Q15A 3DE0X 2HHLA 3UJNA 1J90A 1F2DA 1W34A 4ZAGA 3SS9X 3TNFA 4YAGA 1S89A 4K6KA 4DZZA 1NM5A 1T5OA 1GVHA 4RZQA 3KEGA 4GI3A 1ULUA 3KU4A 1SCNE 2PL9A 2V5UA 4LRQA 2VS1A 1LQTA 3SHVA 3TQQA 3ZGZA 3BREA 4KBFA 3WLPA 2GN2A 2VKTA 2VNKA 5DGDA 3KR1A 2QENA 4LFBB 3FLAA 4Z8XA 4V0KA 5EN4A 1UC5B 1U1GA 5BNFA 3LVQE 4D46A 2V8OA 2A4KA 1EVQA 5TPWB 4NYIR 3P8ZA 1CFZA 5IBRA 3TTSA 3ZWVA 1XPOA 2JKZA 2J0SA 4ARAA 2VCHA 3GUHA 5A04A 5A3QA 4CQNA 1JHPA 3Q2KA 1LLDA 2Q7XA 4LKOA 4B6OA 5LQJA 2YHUA 3FZGA 4J7XA 3S1AB 4EVSA 4WKPA 4EI2A 4JLMA 4ZGWA 1ID1A 2RCNA 1TU0A 5FKJA 1VPEA 4IJKA 4ZMSA 1HEYA 2J33A 3D02A 4IEFB 4FJ2A 4QVKA 3ZWNA 3NBFA 5JE8A 3IT0A 3U4QB 1KMIY 5K8TA 2WUEA 4BNGA 4DMCA 4HEA6 2JASA 4OI4A 2PUEA 4G36A 3AWIA 3QK7A 2V7BA 4YA6A 1W30A 2BEWA 1OT5A 4RSMA 4DCPA 3ASYA 1FDOA 5EQJB 4KXNA 1O9BA 4C7KA 2PLWA 4DHEA 4EH1A 4DDTA 4BVHA 5B1SA 2P6RA 4MWCA 1UFRA 4EO9A 1VI6A 4BO9A 4OB8A 1Z0ZA 3PWKA 4W4TA 2YKGA 4GPZA 4LF7C 3NM4A 4TS1A 2OK8A 1X7WA 5B1HA 3D54D 2NLOA 3PNLA 4P6VF 2YMMA 4LVCA 1XZ8A 2BJWA 3MCZA 4IZ6A 2D2EA 1GRVA 1RKQA 2FEAA 5A06A 4KXXA 1H85A 1W76A 2ORVA 2FZ4A 4Q1FA 2Q0XA 4UHFA 5HS4A 3IUYA 4G01B 3G68A 4UPVA 4PLHA 1J56A 4WWHA 2QX7A 3DLIA 1VLLA 2H1LA 2IHYA 3ZU6A 4FKBA 2VTKA 3FLBA 4DIUA 2G6BA 3BGDA 1DWUA 1YNOA 2QY6A 3VZQA 1PEDA 3H1TA 5KVQA 2WC1A 1E8MA 2PZLA 1WO8A 5AVOA 3I0MA 4CKCB 3CX3A 1UDCA 3F5SA 4I4TB 4KV7A 1YA6A 1ODLA 2WAXA 5SY4A 1G8KA 2ZR0A 3H83A 2C97A 2CMHA 4MZDA 3ZI4A 3E6AA 2ECFA 3IAHA 2NO0A 2XCSB 4YDQA 3ITEA 4Q48A 2VHZA 5A5GA 2C31A 2HA0A 2WJJA 1E79A 2AW5A 1SUIA 5DN6A 2MR6A 1G5HA 4EKGA 1JR4A 1YJ7A 2C03A 3ZKWA 1YS4A 4CG2A 3CQ9A 4NATA 2PUTA 3V34A 3D0RA 1JDVA 2ZTHA 2ZLBA 1YR8A 2ZRPA 2KDNA 3MWEB 3JVVA 4MUEA 3SYMA 2VHEA 3C3MA 4BFUA 3BQ9A 2OBVA 3VU9A 5LUBA 2G9QA 2B5WA 3W6OA 3A70A 1J23A 1RNLA 4XPIA 5B6JA 3O2JA 5KDOA 1ZRNA 2HB6A 3DD1A 5C31A 4A4DA 1V8BA 4P86A 5TS3A 5JMOA 3N5CA 1VI5A 3F96A 5ALIA 3U3XA 5JY1A 1QWSA 1EJBA 2EP8A 1YB7A 1JFLA 2I80A 5JRZA 3GQVA 2AFRA 3QJ5A 1HDIA 1KEEB 3P20A 3PLRA 1ZVMA 2GBGA 3Q3EA 5BRAA 4JXJA 5ALZA 3AM1A 1ZG3A 4GVLA 5FEUA 1PQ4A 2QGZA 1B1AA 3I01A 1RKUA 1P5FA 3EQ9A 5K51A 4C29A 5B64A 1M2EA 1PR5A 2J09A 3QRWA 5F35A 4DV6B 1AGPA 1SQ6A 4KQKA 3V8BA 5A4AA 1J1IA 1VSUA 3PUXA 3NWOA 2OXRA 2PA3A 2I1VB 1ETHA 4PX9A 1Q1ZA 1JVSA 2IPMA 2J1LA 3WGQA 3LT2A 1A9YA 4G0UA 2A0KA 3EAGA 5K0GA 1GZHB 2E4UA 4YT4A 2D28C 4YUWA 3H5VA 5EKXA 1H3NA 3FLEA 1IY2A 1OC4A 2RB4A 3TZ6A 4X7BA 2Q8PA 3ZWWA 3K96A 2ASVA 2GCOB 3LRXA 4MUMA 1BE0A 3OAAD 1ZQ1A 2I6SA 4TKUA 3PEYA 2R2AA 1KMMA 1IATA 2G9ZA 3KHKA 4L02A 3AGPA 4QBGB 5DTEA 3L1UA 2D5BA 2OMEA 1HH2P 1JG4A 1XTZA 2ZIFA 1RCUA 3QEJA 1KAHA 2VCEA 3WBBA 5JNTA 3SWWA 3DVSX 2IOHA 3DZKA 4L0CA 3BMNA 5E1DA 2G7MC 1Y8RA 3N2KA 4MVXA 1HRDA 4RPGA 1LI4A 1FEZA 1OH7A 3P9YA 1E3SA 1ATIA 1ZK4A 2R8BA 2O0JA 3BILA 3L8YA 4BP8A 2P3LA 5I7OA 1AO0A 3VR3D 2JFGA 3AWDA 3VDXA 3VR2D 3B1XA 3KPVA 4FE4A 1JAYA 1OFHA 1W581 1N5OX 3OWOA 5EZQA 1E1DA 1GZ4A 1M0TA 2GTIA 1SNYA 2KHZA 3KAKA 3QHPA 5JECA 1R4MB 2PKQP 3CN9A 5GZ3A 3ZX5A 5EIXA 3WGZA 3ZHOA 1XF9A 4EWLA 4YCCA 4YUYA 3COVA 3LRTA 3QLTA 1A9SA 5K09A 1E1YA 1KO7A 3HY4A 5E3HA 1YDEA 1SKYE 2FWNA 3ZWPA 4NFSA 1OXMA 3LIPA 4KE7A 4FC6A 1SIUA 2OFXA 4FCCA 3WLRA 1JVBA 4DJJA 2FW9A 2PTGA 5GVSA 1U8UA 5CYGA 4O5OA 1BCRB 2HZ7A 3R24A 3WK7A 3K6SB 2QGFA 1GPJA 4YRSA 4UHDA 2O1XA 2CXSA 1E3TA 1NVKA 1UDXA 2F1HA 3OE5A 1VA4A 5J2TA 2V54A 3QKRB 2YFYA 4OXKA 1YBVA 1NVFA 2VBGA 1D7AA 5CR9A 2CFOA 2ECOA 3PPYA 3ZIDA 2WR8A 2J3EA 5SZJA 2QE7A 3PYXA 3EY9A 2HLHA 1B8OA 2G76A 1ULZA 2QX8A 4OJTA 1NR5A 2M6KA 1HF3A 3V9PA 4YCDA 3CG4A 2YY5A 4R2KA 5TT1A 1AUQA 1S8AA 3LFUA 3F4BA 3LX6A 4E2FA 1VPWA 2B4KA 5JMTA 1SU8A 3SF0A 1SOUA 4JODA 1C7FA 2O7SA 5UKDA 1KVSA 4NY1A 3F90A 3COWA 5KYKA 1SCDA 1CUXA 4M98A 2A8YA 5IVIA 1TUIA 1U28C 5DK6A 1XNRB 1RXEA 1R4AA 3NV7A 4LNHA 2W6ZA 3UHAA 3QWBA 1ECCA 4K6MA 2YN2A 4IIJA 4IGKA 3LKDA 3ORYA 1KQFA 2DYJA 1L5WA 2VLIA 2Q49A 3OEED 4JOSA 4RM2A 1RXYA 3ECSA 3ADKA 2V45A 5EJ6A 3EUAA 4JSYA 3K9NA 1CD5A 2B20A 3IP5A 1BMFA 1E6KA 1F5NA 5IFKA 4J7UA 2VZEA 1RI3A 4KGXA 1X1EA 4DNFA 2XKAA 5AE2A 2I1QA 3Q7SA 2Q6TA 2W2OA 3E84A 1L7RA 2Q5HA 4US1R 3O2QB 3EG9B 3VKGA 4KFRA 5D5HA 2RH4A 2II6A 4KBGA 2FE1A 3GJ8A 3OF2A 2V1XA 4HXFB 1F20A 3V4VB 5C46F 1TEZA 1Z74A 3G7NA 3ZV4A 1I7SB 2CVFA 2BW0A 1I1NA 3MBOA 2NN3C 4MP6A 3BJEA 3RU9A 1XTVA 5JNUA 2BFWA 2HHHC 4O59O 3TS1A 3KVOA 4MVCA 4WI1A 4AK9A 4P7FA 4B5LA 4B74A 2JHAA 3C1UA 1JEAA 1OA1A 3L5KA 4LCEA 1XEWX 1XJQA 4LRTB 3BXGA 4OLBA 5DNVA 4U7PB 3E0QA 2FW7A 1SUAA 1JKMA 3AZOA 1KETA 3EMKA 1QP4A 5K4GA 4KPEC 4BFCA 2VVTA 1ESNA 3CX4A 1RQLA 1BN6A 1OOEA 2AG0A 2YWHA 2B30A 2YNMC 4DPLA 4YJ2A 4HPWA 2RGCA 5FADA 4O2BB 1DDOA 1NVEA 2EZ9A 2Y67A 3N0TA 4WFJA 4TSKA 5DULA 5CFMA 4X92A 1MPTA 4E08A 3EGWA 1PGPA 5KCZA 2CB0A 1EWVA 3AGQA 4FB4A 2A9FA 3T3IA 3QUAA 2AYZA 3ZJ4A 2GJSA 4NDAA 2BLLA 5JSYA 2I7XA 3ZIAA 2F8MA 6LDHA 1T9ZA 2BFAA 1E2UA 2QSYA 3GV0A 3H5TA 4JL5A 4LVUA 4NENB 5CYFA 2R8EA 4BYGA 2R0QC 2C07A 3V8EA 4PNHA 4CFSA 3O83A 3G7UA 2VDQB 5CGQB 3KV3O 4MLZA 3HKBB 4ZTBA 4JB2A 2Q9UA 4YMVA 5CIWA 2QZ9A 2QTFA 4CNQA 4F85A 4R2WA 4DWOA 2WF8A 2PQ6A 2RGBA 2G28A 4U7GA 5BRNA 3CUSA 3WC4A 1QIKA 4PG8A 1CUYA 2F1KA 1FUGA 3HDYA 1SVMA 3I28A 2AFVA 3I39X 4ZXPA 4JP3A 4WZBA 2QTLA 1WBDA 4AS1A 3QWFA 4RORA 2Q6OA 1DOZA 3OLYA 3K1YA 3K0KA 1YVUA 1Z6TA 4FIDA 2DBZA 4MICA 4DUYC 2H1WA 3USZA 5CX1A 4BZXA 3UKOA 3LUPA 2GK6A 1XTTA 4K9RA 1VPLA 4B8ZA 1RJWA 1IBKB 1E3MA 4P93A 2J3MA 4OQNA 5HCNA 5LOVB 1B6RA 3EW7A 2CJWB 3EFEA 4Y6PA 5TGTA 5JXWA 3ZJUA 4G5SA 5KINB 3RROA 1UINA 4UBMA 2P4QA 4OHYA 1GQ2A 1SD2A 2V4UA 1NC1A 1P4HA 3CJTA 2ZM6B 3V4RA 1GKKA 2FPMA 3EFOB 4NAUA 4YMWA 1ST2A 3BD9A 4ZYLA 3EPRA 3GPDG 4J9UE 4MVJF 3RF6A 4DL9A 4C01A 1X1TA 2W93A 4F97A 4ZVMA 2HT1A 4CKWB 1SXJD 4OHXA 4FMPA 2JIQA 3P0IA 4NHOA 3UXMA 1NKTA 5CPFA 4KLRA 4D96A 2YV5A 1Z38A 3L82B 5DX8A 1FFSA 4Z3DA 3SYTA 3UT5A 3ZDXB 4AYXA 3GRRA 3RNOA 2FR8C 5IJ9B 2WU0A 4UXIA 1MXFA 2X3YA 4HWPA 2ZS9A 4CI0B 1U7UA 3CRNA 3PFNA 3DT9A 4WKGA 4NQRA 5AJTA 4TROA 4HRAA 4YIKA 1J25A 3BL6A 5AI0A 5DI3B 1RM3A 3MMXA 4G67A 3VSCA 5CEEA 1L3CA 2DFVA 5K6RA 3BRWA 1JPNA 4GOOD 5A1IA 4PLPA 2XB4A 2Z8YM 1D07A 2P5YA 1YQUA 1T4CA 1TO6A 1X7XA 3R0VA 4JI8B 4ZPJA 4J9VA 1QM5A 1MRSA 1GT6A 2PXXA 5G3YA 4LC0A 3RHFA 4GOKA 4A5OA 3FBWA 3GLIB 4GBJA 1Q0QA 1MAUA 2Y4NA 2Q0HA 3LVFO 1ULHA 2R85A 1WW3A 3G0CA 4KRGA 4NZ9A 5AVVA 2R84A 4CCSA 3PE4A 4NU6A 1GTZA 1SZCA 1NDUA 5J47A 1W19A 2AJ8A 3LI2A 4MLCA 2W37A 3H99A 1RVV1 1GRNA 5F1OA 4IX1A 3C14C 5ILQA 1EHIA 2X7HA 3GZNB 3PT9A 4ETNA 2VDUE 3EA4A 3TF5A 4C4PA 1TRHA 1NI4B 3MERA 2RGGA 4YJHA 1E99A 3TE7A 3I9KA 4LISA 3T7AA 5CBPB 4MDFA 3NM5A 3RR2A 4CM4B 3DT8A 2DUJA 1E8DA 2WT8A 2Z57A 2F9FA 3A6JA 1X1CA 3AETA 5DKFA 5IF9A 3ZBQA 1TF5A 1GKYA 3H2TA 2Z83A 2A94A 1ODTC 3AR2A 4RXTA 5K20A 1KWGA 1BRTA 3U4MA 1XHJA 2JGDA 5SZKB 4QOEA 2P4EA 3WNVA 1NYRA 4P31A 3SXJA 2OENG 3BE6A 4U39A 1E3JA 3DSRA 3FFWA 2UYQA 3QEMB 4MQFB 1U3TA 4N4AA 5MDHA 2IX3A 5IEJA 3AVTA 2IXDA 1FRVA 2BP7A 4NBUA 4B3DA 2A5DA 4PHHA 3GXOA 4J0GA 5DB4A 4IVNA 5JSQA 3IOEA 4H7DA 1SCQA 3LE8A 4YLGA 3VMFA 1VXOA 1J5PA 1MG0A 3RJ5A 1F60A 4KIWA 3K70B 3JCZA 1WMBA 2C2GA 2FSVC 4E5SA 3GEGA 3C7TA 2H5EA 4S35A 3UJAA 5JO0A 1FYDA 2PS1A 4U3JA 1CYEA 5DI9A 1Z8HA 1V95A 4CM8B 3DZJA 1XJWA 1TZKA 1UKYA 5WRFA 3JZAA 1FRZA 4J03A 1YRHA 4XVQA 5DCUA 5FBLB 1DS6A 1UJ2A 2E8CA 1KYTA 4GQBA 3RC7A 1MA0A 2QQ0A 3CT6A 4TPSB 5EE1A 1IBKC 2Y99A 2JIDA 4XLZA 1JRLA 1GQFA 2J0UB 3A1WA 3KBBA 3RLIA 3TI9A 1EG7A 1TZBA 2O1SA 1SCUA 3IS3A 3QVUA 5FI0B 4OI0A 1Z5NA 2AV6A 1QFYA 2Z6AA 3D3WB 4Q3LA 2AW3A 4KX5A 2XOKA 2UYGA 4OMFG 2IHKA 3RS9A 3TL2A 2WMDA 3N58A 1H0SA 4YPFA 2EWWA 2REBA 4LMBA 5FOTA 2WSIA 1YR2A 2VYNA 1XSEA 1PUXA 3ZS9A 1JEYB 2EFJA 5LMNB 2A6PA 1KU6A 1Z7BA 3DF9A 3AOEC 2BHSA 1FP2A 4JBHA 1DX6A 4MRPA 4QBIA 5I01A 1Y8QB 2ZKLA 3DE3X 1XC7A 4NBSA 1AS0A 1QORA 3R6DA 2YC4C 4FBMA 4KGDA 1RLIA 4KXMA 4OBWA 4XGRA 5KJEA 3V1TC 3PC3A 3NTOA 4B2LA 3TN7A 3KOYA 4A26A 1OAOC 1PLJA 4IINA 3GEBA 1WKVA 4I66A 2OHGA 3D0OA 4LF9C 3D4PA 1YMVA 3R5HA 4PQFA 2OCXA 1MVOA 2UVPB 3U3JA 3KLPX 3D3JA 4JI8C 1NY8A 1FXWA 1P60A 5DM0A 5EIBD 3N2IA 5FUYA 3D43A 4I55F 4F72A 1PQYA 3DEYX 5LP6A 2XGMA 3ODGA 1M5RA 3PC8C 1XRCA 1CJCA 1ZIXA 2C78A 1BWRA 1JHMA 1P39A 1UEXC 2GN6A 1L9KA 2C8KA 2W6CX 3LBFA 4LGVA 4M0LA 1BKSB 4B75A 2FPKA 4QOGA 1VBNA 3NEJA 1BDMA 1WMDA 4PLCA 1WU8A 1GRQA 1CY8A 3SKVA 1PL7A 3O84A 5BMVA 2FMIA 1UUFA 4QUDA 2P90A 1MFZA 4DHWA 3GJ3A 1B7GO 1NWCA 4TVOA 3JTMA 4A1FA 5FOSA 2G17A 4NJMB 5FV7A 4MWBA 2P2SA 2X76A 4KNWA 4Z53A 4TLAA 3HJBA 4EB8A 4QYWA 3NT5A 3D7MA 4MITA 1UAAA 2CFSA 3P9PA 1W4ZA 4IYRA 4ER5A 2YTZA 4Y6OA 2COEA 2X2FA 3N86A 3TAUA 2VHYA 3BWCA 1PG5A 3JQRA 4WY8A 2VYVD 5F51A 3SC4A 3VPXA 4D97A 3G5AA 2RBGA 3QYPA 4CG0A 3B3GA 3PRHA 3IEXA 2R5WA 2PUGA 1Z6PA 2D5LA 2HQ1A 3ZZUA 2N46A 3B36A 3VYVA 4J0QA 4WXMA 2F4VB 2F1RA 1ST3A 1SFRA 3CRW1 4ENPA 3JRWA 2EFYA 2CN1A 4FHDA 1HDYA 1SXJC 1T5TA 1X7YA 2J30A 3ELDA 1GPKA 3QI2A 4HF7A 2CL7X 1LS1A 3KP1A 4W5WA 4HVTA 3GJYA 3QKUA 2NYAA 3X1WA 1ZQ9A 1MXCA 1Z3CA 4L51A 1MF7A 3T1NA 3K70C 2AC2A 5HQ3A 1E89A 1KI6B 1KIMA 1X8XA 2ACEA 1Y42X 3O8QB 4GW3A 1UBMS 3ZY4A 3R76A 3F9IA 1O89A 1K98A 3MN1A 4LOKA 2R79A 4MROA 3Q9UA 4R01A 3M6FA 3ZG6A 1G8FA 3WL3A 2QTHA 1TIKA 1TU3A 4WEQA 1U6IA 5D7NA 1YCDA 1T6XA 4JQCA 2OCBA 2WWTA 2H0RA 3V4OA 2X8WA 3KJHA 1ENOA 2PRKA 4P35A 1SHJA 3IQGX 5BQ5A 1E6MA 3UV3A 5JD6A 4BLQA 3PXUA 4OQFA 3FYDA 1IM8A 1DWOA 1Z4KA 1Y89A 3VAYA 1G5PA 3NYRA 1GNVA 1QCYA 3LM8A 4MV4A 1KI8A 1SOVA 3RVOA 3O3MB 4BMXA 2P69A 3Q41A 4JMLA 4X20A 1TYDE 5IYZA 4IOMA 3CN7A 3VZDA 1QLWA 3GDOA 4ZHQF 1FS5A 2NSYA 3OLVA 2NU6B 5DPMA 4EJSA 1E69A 2QTGA 4E14A 1YMQA 3P71T 4NBWA 3WRYC 2A84A 3M5DA 2FDCA 1MO6A 1FJ2A 2B8WA 3OZ7A 3TLGA 3QVKA 1PZNA 5CDFA 1L4KA 3W2EA 4L8WB 3DNFA 4M54A 3R74A 3MB8A 1CW2B 1PJ2A 5AMXA 2CZCA 2W4IA 4RZIA 4TLBA 2EW8A 3VHRA 5CFPA 4X3CA 5JMWA 2JBHA 2D00A 1V1MA 2KI5A 2UVDA 1R16A 2JRLA 4B09A 4HRVA 4MP8A 1KS9A 3ND8A 1ATZA 1Z5UA 3A6HA 2F9LA 1TJ4A 2FSUA 4M6WA 4DJFC 1PYDA 1DADA 2EKZA 4N3BA 5DE3A 3RYIB 5KYWA 4CDMA 2DPLA 4MR9B 1TXGA 5HHTA 1L5RA 1CWUA 4BNYA 1Z7WA 4S1PA 4OQPA 1HI9A 3MILA 5HIAA 4RENA 1CQIB 1NJ5A 2X5KO 1CUUA 1MJFA 1P9OA 2HNKA 4J0FA 2P27A 4AJHA 4AO8A 1JEQB 1X0VA 3DLAA 1VHDA 3M3DA 3WLKX 3O0DA 2FWMX 3ZI0A 2G5TA 1WOYA 4G5HA 3I53A 2DG2A 3P9IA 4DG9A 3PD7A 5MGNA 4GI2A 4KQ6A 4HSEA 4C6HA 3DFIA 1Z6QA 2MJLA 1L4MA 1TE2A 3NORA 2JJ1D 1OILA 3ANYB 4AXBA 4JOBA 1XPJA 4DC1A 4IIUA 4YH1A 4KQ2A 4J49A 5I9LA 4TXHA 5CK4A 1A69A 3L05A 4UE3S 4XQGA 1D8TA 1ZKDA 2L82A 2VDJA 2EGGA 2WU8A 2VBIA 2Y1DA 4JP1A 4GXNA 1A96A 1IZ8A 1FMLA 1TC2A 3C7KA 2OBBA 3LBNA 4MR7A 3W4JA 3S0JA 3GN2A 1CRZA 3NP9A 5IU6A 1UAGA 2P11A 1VL5A 4FMCF 1FNBA 4E4TA 1U8CB 5BT8A 3T0GA 1CTQA 4M0KA 4DSAA 1KQGA 1HEIA 1GA1A 2A1UB 4H59A 2CVQA 3BSYA 1CUWA 2IJGX 3SSOA 4AMVA 5MFPA 2IV3A 1HDGO 4M9SA 3OG9A 1UDAA 5BSVA 3PYMA 1J42A 2NADA 3WLJA 3IIIA 2A7QA 5B7NA 3I5YA 2F62A 2VSOA 3D5TA 1VL6A 3NGMA 3J81k 4B87A 1A9TA 3CVWA 2LKCA 1HC7A 1NONA 3ZBTA 2IHNA 1KMNA 3FNGA 2BEUA 2O8BA 1F5SA 5SV2A 5BR8B 1G66A 3FDFA 2V6IA 4AECA 1DHRA 2XT9A 4Q3AA 2I99A 4BNKA 3V8RA 3RIHA 2GAJA 4JK3A 2YRFA 2NVOA 2X2OA 3BGIA 3KZMA 5FLKA 2PL1A 2BFDA 4I46A 4PQYA 4XD2A 3MWGA 1KAGA 1BRMA 2DE0X 3EFHA 1V9LA 2HO5A 3JQGB 4FYIA 1GZ5A 3H2ZA 3LWDA 3R7BA 3RU7A 1G21E 3ABQB 4F3TA 3ASVA 1N6IA 3G8AA 5H80A 4D99A 2XDYA 2I0FA 2CFCA 4N5IX 2ZB8A 2XUPA 1Z3IX 2QZZA 4FDUA 3UX3A 2CMKA 2ZU0C 3PQEA 5EIBC 4CRWB 5B37A 5CEJA 4I9NA 4XASA 3AL3A 3EIQA 4KN6A 4LX8A 4AW9A 4D41A 5DNCA 4Q1EA 2LNDA 5BSFA 2H85A 4CMIB 2QVGA 5AKKA 3TSZA 3C8MA 1UPXA 1R88A 3EPPA 3OQ1A 4JKOA 4MK4A 4YO7A 2J5KA 2ZUVA 1SBIA 3I05A 3PV0A 4TZKA 4XKJA 3ZWBA 2XIJA 2O1WA 4Q1VA 4IVPA 1TT7A 1CZOA 2ISSD 4D2IA 1SO8A 5A9SA 1YJXA 3BAZA 4L07A 1OV6A 4WOJA 4BMDA 1JKFA 1P73A 3QFSA 1W46A 1I30A 1YOVA 4FTFA 3HA7A 5DLQC 3ON5A 3ZQ6A 5DNYB 1DAIA 1DLIA 3GEHA 3ZUPA 3F1LA 5F2OA 3VO9A 1J22A 1OI7A 3G2HA 4X41A 1DKOA 4IXWA 4JBWA 5KHAA 5TF4A 3WKCA 2H8GA 4LYGA 2JGJA 2NQ2C 3C5CA 4JT2A 4UVGA 3RS0A 3ICQB 3VNUA 4R41A 1H5UA 1NNI1 1P2DA 3MGKA 4RVOA 3P45A 3MRVA 1A2QA 1IMJA 2F1OA 4YASA 5ICGA 3TQFA 4Q9JA 1W9MA 4JIGA 5J4LA 4R3WA 4NJEB 2G5GX 1QU2A 4I4LA 1RACA 4MQMA 1SZDA 1TGYA 2N1MA 1PTJC 3MJHA 4NE9A 2QVZX 5EE0A 4EZEA 1U8EA 1AK2A 5AM4A 2IFTA 4LN1A 3N2GA 4J94A 3BXHA 5IJ0B 2Q45A 3ER8A 2GOYA 2QI9C 1N1EA 4C4OA 2VF7A 4HAIA 1GZ6A 5HS6A 2N42A 4KG7A 3ORSA 2AXPA 3R8FA 1E2MA 5C5CA 1G6Q1 3MOSA 2YWXA 2Z2XA 1ECLA 4JLVA 2F67A 2VWHA 5CNMA 5B53A 5D3MA 4H0NA 4D8WA 2D4AA 1U94A 4E7PA 4FGJA 1LNQA 1M1ZA 4P7BA 4KXVA 4KH1A 5IKMA 4L76A 3N2LA 4GYJA 4IDPA 3WNBA 2X8LA 5K0JA 3LF2A 2PBZA 4H6VA 821PA 1EXVA 1CF9A 1P0MA 2OCIA 3KXWA 2EEZA 1Y5MA 4UUOA 1LVHA 3NHKA 5CLQA 3IPRA 5CLGA 3WWEA 5BNZA 5IZ4A 1D2EA 2ZIXB 3EF3A 3CUYA 3W7AA 3SNKA 5CCDA 3ZDYB 2C7PA 3CHYA 2P2LA 4ZIRB 3QVLA 3OUUA 3V8NA 3E48A 2Q5CA 5FWYA 2I29A 1SEVA 3AW9A 3GGGA 5ELXA 1H2FA 3I2JA 3IMCA 2G3YA 4WZAA 2VP2A 2E7GA 5BW8A 4YJGA 2DY1A 3F9CA 3I9V6 1FVFA 1MN6A 1XD2B 3L1VA 5FBHA 4DREA 1JBKA 4PGFA 3WLEA 4LQLA 4PHCA 2FSSA 1O95A 1WEKA 4GKJC 5EWLA 3L0PA 4W7HA 4TLLB 4DLLA 2O2JA 4GSYA 2QUJA 3QE2A 3VISA 2BH9A 1RXIA 1K86A 4BB6A 3CH7A 2QSJA 5C1DA 2OAQ1 4R7ZA 4A8PA 3KLOA 3A6GA 4IJVA 4KQWA 1JEEA 2D74A 2ODWA 4X54A 1H8HD 2JHFA 2AKYA 1NUPA 5EHZA 4JYAB 4ZT3A 4IDHA 4EECA 4ZRNA 4CIAA 1YQTA 1Y1KE 2GYYA 4OGLA 2ZB7A 3MS4A 3TKYA 3MJDA 3FGPA 2G9NA 1NXVA 4G0XA 3C3PA 1G64A 1DIOB 3OPMA 1FNNA 3KWFA 5HJEA 3TGPA 2CUTA 4G09A 2CHQA 1Y5LA 1X94A 4RK6A 2ODTX 4L5YA 2C1ZA 4KR7A 1DGQA 1T91A 4O5AA 4ZCRA 5KYXB 5ADZA 2C7VA 1PFGA 2PT7G 3I83A 4D26A 3ZJVA 4FZ3A 2EG9A 3DLTA 3N2ZB 1TEHA 4KC0A 3PU6A 1RHKA 3ELYA 3I1YA 3KU1A 4LYAA 5DLEA 4FB5A 4RMNA 2ZTVA 2C59A 2B7CA 1NUAA 4R3NA 4MRRA 3L2OB 4NCKA 1R0SA 1SC1A 3HBNA 5F7ZA 5GJVC 4YX9A 2OTCA 3WYAA 1L2FA 3WB1A 1ADFA 4L8LA 2BKAA 4QPCA 5AD1A 5J5CA 1U0SY 4LYHA 2C9ZA 1PVVA 4F86A 3WMXA 3G9TA 3V1UA 2QRPA 1IN4A 4MKGA 3IXQA 1ZZGA 3DHNA 4MINA 2D6FA 2RBEA 3GFPA 1R37A 1AZSC 3BICA 2R6AA 3JARA 4TV9B 3OX4A 4AWBA 4MCAA 2R1TA 5CITA 3FFTA 3LW7A 3P19A 3IVAA 5AOAA 3MTQA 1RJDA 3R8XA 3B85A 5IABA 2YIDA 3EGXB 4DV2B 1DC8A 1UOQA 1SKUA 1QE3A 1IXZA 3RJZA 1TH5A 5JDCC 3DWFA 1U3CA 4AWAA 4GF5A 1XNJA 3FCSB 1C3VA 1G0NA 2NU7A 3KYDA 1DG3A 2RHGB 2WWGA 5KCMA 1E4YA 1SCBA 2QM7A 4AB1A 3GCGA 2HEGA 3LSYA 4JC0A 2P2JA 4UMDA 1Z4NA 1SUPA 2JW5A 3R20A 4KHZA