3CQ1A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (tt1362) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
ARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein TTHB138
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (TT1362) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq1A00
1VEHA 1TH5A 2JNVA 1XHJA 3CQ1A 3CQ2A 3LNOA 2CU6A 2M5OA 2Z51A 3CQ3A 3UX3A 1UWDA 2M5HA 1WCJA 3UX2A
chains in the Genus database with same CATH superfamily
4BC7A 2UUAC 4RLQA 1P4EA 4LFBC 2OO4A 2MM9A 1L2FA 3GPCA 1WCJA 4D56A 2NCLA 2D1SA 1FUGA 2D1TA 1HNXC 4PZPA 4DCUA 3EERA 1HNWC 5BSMA 5BSUA 3IEVA 5K85A 1PG4A 3GR1A 4D4IA 4MH4A 2P2JA 3C5EA 1TH5A 1PU1A 2P02A 4OXIA 1VLAA 3AY0A 1O9TA 4IR7A 2MCQA 4LF7C 4DR3C 3LAXA 5BSVA 4GXQA 2Y27A 3FCCA 3R9XA 1ML8A 2UXDC 1J5EC 4NDNA 4DR4C 2UU9C 4JI2C 1XMQC 4D57A 1V60A 4JI8C 3CQ2A 4G37A 4JV5C 2BH1X 5FLXD 3ETCA 3K6RA 4NXNC 1ZB8A 4DR5C 4G1IA 4GKJC 5ADZA 4DCSA 4RVNA 3ETOA 2WP0C 3A25A 2M5OA 2EGTA 4R1LA 3JAMD 5CZXA 2D1QA 5KEIA 2CY1A 3CQ3A 2BJOA 2QL8A 2V7BA 4BCAA 5K8FA 4KTVA 1USPB 2CU6A 1IBMC 1N33C 4FTFA 3IEUA 1V25A 2UUBC 2E8EA 2ONFA 2HHHC 4K0KC 3DHVA 2D1RA 5AE2A 1N34C 1NY8A 1MXBA 1YJ7A 2YX1A 3N2QA 2AYAA 4DV2C 1BA3A 4YHHC 2VQFC 2D28C 4JI3C 3R9WA 1NYEA 3UX2A 3DAYA 1PA4A 3A4IA 3E7XA 1XMOC 2P2BA 5BUSA 2YWCA 1K0RA 3J81D 1IB8A 3G7SA 4PUIA 5BSWA 2ZZMA 1M6XA 4RM3A 5JRHA 3SO4A 4R0MA 1N36C 1KKGA 2VZEA 4B3MC 5H9UA 3N54B 4RVOA 4KTTA 4BBYA 4L7IA 2CXCA 3VNQA 2D7VA 2QVZX 3PESA 1O93A 5KYTA 4NOZA 3CJEA 4DV3C 1ZB9A 4L2ZA 5BUQA 1WH9A 4LF9C 2JMPA 4RLFA 4DR2C 1MXCA 4RM2A 1RY2A 1T5DX 4PHTA 2JNVA 2OPLA 4JI5C 5KYVA 5IWAC 4JYAC 3LNOA 3B7WA 4JI4C 4OX9C 2KZFA 3J80D 4I9FA 3O2EA 4MTNA 5CZVA 5BR8C 5IT9D 3IMLA 4WV3A 1WF3A 4BC9A 1FJGC 2Y4OA 3CW9A 4LF5C 2QVYX 3VNSA 1MDFA 3CQ1A 4B3SC 4LF6C 4DV1C 2P2MA 1XHJA 1GPMA 3FCEA 3NPDA 5A2QD 3UOWA 3CW8X 4DR6C 4TPSB 4L4QA 4YY3C 2P2QA 3AF5A 4PROC 4BSZA 2OPLB 4KHPC 2ZZNA 3T1YC 1P4EC 4GS5A 1AMUA 4X65C 1UWDA 1JOSA 4JI7C 5A1GA 2WD9A 4DV7C 4LE5A 1UKKA 4ZJZA 4DR7C 2VSQA 1MKYA 4ISBA 3R44A 1XNRC 3GR0A 4HPVA 4DCVA 3A9UA 1T5HX 2PROA 3A26A 2VQEC 3T1HC 1I94C 4X62C 4ODJA 4GXRA 4JM1A 2UXBC 4DG9A 1EGAA 3OTOC 2DPLA 1MD9A 3DLPX 5E7QA 2OBVA 4RMNA 1RG9A 1HR0C 4LF4C 4G36A 2P20A 1O92A 4DCTA 4AQYC 3I08A 4EATA 2HJGA 1IBLC 3H2TA 3I07A 1LCIA 2DYJA 4DV0C 4ZLPA 1MXAA 4DG8A 2E5LC 3GKUA 2F4VC 4IZ6A 1XNQC 5LMUC 2KZ0A 2E0GA 4JI1C 2MMAB 1ULTA 5BSTA 5DV9A 4JI0C 2D27A 4FUTA 1LQLA 4DUYC 2PN2A 4I9GA 4K0BA 2ASBA 4X64C 4U5YD 2ZM6C 4D4GA 3KXWA 3UZ0A 3TR3A 1USPA 1IBKC 3E7WA 1O90A 1P7LA 4WS9A 3PBKA 2QVXX 4XX2A 1QM4A 1PG3A 3TQIA 4DV5C 4DV6C 1HNZC 1V26A 3PROC 3L95X 3UEBA 4DV4C 2PT7G 5A1IA 2Y4NA 4FUQA 5IFIA 1N2FA 3AF6A 3EQ6A 3LGXA 1HH2P 2XR1A 4OYCA 2YWBA 4NXMC 2Z51A 5BSRA 2UUCC 4PUGA 4LFAC 2E7GA 3RV2A 1N32C 3NI2A 4GKKC 5A19A 5LCIA 3A9VA 4X66C 2E8CA 3UX3A 3LUSA 2KDNA 1XRCA 1QWIA 1XRBA 4LF8C 3NYQA 4JI6C 1VEHA 4B3RC 5AE3A 3IPLA 2M5HA 3LNVA 3TUFA 2DHMA 5BURA 2P2FA 3S82A 1M6XC 3TDEA 1XRAA 4PUHA 2QW0X 3RG2A 2ATWA 2UXCC 1MDBA 4DUZC 2YCBA 5T8SA 1XS3A 4R1MA 4LFCC 5AE1A 2E8FA 3NYRA 4B3TC 1FLOA 5LMNC 5GTDA 5T8TA 3L8CA 3VNRA 4DR1C
chains in the Genus database with same CATH topology
1VEHA 1TH5A 2JNVA 1XHJA 3CQ1A 3CQ2A 3LNOA 2CU6A 2M5OA 2Z51A 3CQ3A 3UX3A 1UWDA 2M5HA 1WCJA 3UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEH A;  1TH5 A;  2JNV A;  1XHJ A;  3CQ1 A;  3CQ2 A;  3LNO A;  2CU6 A;  2M5O A;  2Z51 A;  3CQ3 A;  3UX3 A;  1UWD A;  2M5H A;  1WCJ A;  3UX2 A; 
#chains in the Genus database with same CATH topology
 4BC7 A;  2UUA C;  4RLQ A;  1P4E A;  4LFB C;  2OO4 A;  2MM9 A;  1L2F A;  3GPC A;  1WCJ A;  4D56 A;  2NCL A;  2D1S A;  1FUG A;  2D1T A;  1HNX C;  4PZP A;  4DCU A;  3EER A;  1HNW C;  5BSM A;  5BSU A;  3IEV A;  5K85 A;  1PG4 A;  3GR1 A;  4D4I A;  4MH4 A;  2P2J A;  3C5E A;  1TH5 A;  1PU1 A;  2P02 A;  4OXI A;  1VLA A;  3AY0 A;  1O9T A;  4IR7 A;  2MCQ A;  4LF7 C;  4DR3 C;  3LAX A;  5BSV A;  4GXQ A;  2Y27 A;  3FCC A;  3R9X A;  1ML8 A;  2UXD C;  1J5E C;  4NDN A;  4DR4 C;  2UU9 C;  4JI2 C;  1XMQ C;  4D57 A;  1V60 A;  4JI8 C;  3CQ2 A;  4G37 A;  4JV5 C;  2BH1 X;  5FLX D;  3ETC A;  3K6R A;  4NXN C;  1ZB8 A;  4DR5 C;  4G1I A;  4GKJ C;  5ADZ A;  4DCS A;  4RVN A;  3ETO A;  2WP0 C;  3A25 A;  2M5O A;  2EGT A;  4R1L A;  3JAM D;  5CZX A;  2D1Q A;  5KEI A;  2CY1 A;  3CQ3 A;  2BJO A;  2QL8 A;  2V7B A;  4BCA A;  5K8F A;  4KTV A;  1USP B;  2CU6 A;  1IBM C;  1N33 C;  4FTF A;  3IEU A;  1V25 A;  2UUB C;  2E8E A;  2ONF A;  2HHH C;  4K0K C;  3DHV A;  2D1R A;  5AE2 A;  1N34 C;  1NY8 A;  1MXB A;  1YJ7 A;  2YX1 A;  3N2Q A;  2AYA A;  4DV2 C;  1BA3 A;  4YHH C;  2VQF C;  2D28 C;  4JI3 C;  3R9W A;  1NYE A;  3UX2 A;  3DAY A;  1PA4 A;  3A4I A;  3E7X A;  1XMO C;  2P2B A;  5BUS A;  2YWC A;  1K0R A;  3J81 D;  1IB8 A;  3G7S A;  4PUI A;  5BSW A;  2ZZM A;  1M6X A;  4RM3 A;  5JRH A;  3SO4 A;  4R0M A;  1N36 C;  1KKG A;  2VZE A;  4B3M C;  5H9U A;  3N54 B;  4RVO A;  4KTT A;  4BBY A;  4L7I A;  2CXC A;  3VNQ A;  2D7V A;  2QVZ X;  3PES A;  1O93 A;  5KYT A;  4NOZ A;  3CJE A;  4DV3 C;  1ZB9 A;  4L2Z A;  5BUQ A;  1WH9 A;  4LF9 C;  2JMP A;  4RLF A;  4DR2 C;  1MXC A;  4RM2 A;  1RY2 A;  1T5D X;  4PHT A;  2JNV A;  2OPL A;  4JI5 C;  5KYV A;  5IWA C;  4JYA C;  3LNO A;  3B7W A;  4JI4 C;  4OX9 C;  2KZF A;  3J80 D;  4I9F A;  3O2E A;  4MTN A;  5CZV A;  5BR8 C;  5IT9 D;  3IML A;  4WV3 A;  1WF3 A;  4BC9 A;  1FJG C;  2Y4O A;  3CW9 A;  4LF5 C;  2QVY X;  3VNS A;  1MDF A;  3CQ1 A;  4B3S C;  4LF6 C;  4DV1 C;  2P2M A;  1XHJ A;  1GPM A;  3FCE A;  3NPD A;  5A2Q D;  3UOW A;  3CW8 X;  4DR6 C;  4TPS B;  4L4Q A;  4YY3 C;  2P2Q A;  3AF5 A;  4PRO C;  4BSZ A;  2OPL B;  4KHP C;  2ZZN A;  3T1Y C;  1P4E C;  4GS5 A;  1AMU A;  4X65 C;  1UWD A;  1JOS A;  4JI7 C;  5A1G A;  2WD9 A;  4DV7 C;  4LE5 A;  1UKK A;  4ZJZ A;  4DR7 C;  2VSQ A;  1MKY A;  4ISB A;  3R44 A;  1XNR C;  3GR0 A;  4HPV A;  4DCV A;  3A9U A;  1T5H X;  2PRO A;  3A26 A;  2VQE C;  3T1H C;  1I94 C;  4X62 C;  4ODJ A;  4GXR A;  4JM1 A;  2UXB C;  4DG9 A;  1EGA A;  3OTO C;  2DPL A;  1MD9 A;  3DLP X;  5E7Q A;  2OBV A;  4RMN A;  1RG9 A;  1HR0 C;  4LF4 C;  4G36 A;  2P20 A;  1O92 A;  4DCT A;  4AQY C;  3I08 A;  4EAT A;  2HJG A;  1IBL C;  3H2T A;  3I07 A;  1LCI A;  2DYJ A;  4DV0 C;  4ZLP A;  1MXA A;  4DG8 A;  2E5L C;  3GKU A;  2F4V C;  4IZ6 A;  1XNQ C;  5LMU C;  2KZ0 A;  2E0G A;  4JI1 C;  2MMA B;  1ULT A;  5BST A;  5DV9 A;  4JI0 C;  2D27 A;  4FUT A;  1LQL A;  4DUY C;  2PN2 A;  4I9G A;  4K0B A;  2ASB A;  4X64 C;  4U5Y D;  2ZM6 C;  4D4G A;  3KXW A;  3UZ0 A;  3TR3 A;  1USP A;  1IBK C;  3E7W A;  1O90 A;  1P7L A;  4WS9 A;  3PBK A;  2QVX X;  4XX2 A;  1QM4 A;  1PG3 A;  3TQI A;  4DV5 C;  4DV6 C;  1HNZ C;  1V26 A;  3PRO C;  3L95 X;  3UEB A;  4DV4 C;  2PT7 G;  5A1I A;  2Y4N A;  4FUQ A;  5IFI A;  1N2F A;  3AF6 A;  3EQ6 A;  3LGX A;  1HH2 P;  2XR1 A;  4OYC A;  2YWB A;  4NXM C;  2Z51 A;  5BSR A;  2UUC C;  4PUG A;  4LFA C;  2E7G A;  3RV2 A;  1N32 C;  3NI2 A;  4GKK C;  5A19 A;  5LCI A;  3A9V A;  4X66 C;  2E8C A;  3UX3 A;  3LUS A;  2KDN A;  1XRC A;  1QWI A;  1XRB A;  4LF8 C;  3NYQ A;  4JI6 C;  1VEH A;  4B3R C;  5AE3 A;  3IPL A;  2M5H A;  3LNV A;  3TUF A;  2DHM A;  5BUR A;  2P2F A;  3S82 A;  1M6X C;  3TDE A;  1XRA A;  4PUH A;  2QW0 X;  3RG2 A;  2ATW A;  2UXC C;  1MDB A;  4DUZ C;  2YCB A;  5T8S A;  1XS3 A;  4R1M A;  4LFC C;  5AE1 A;  2E8F A;  3NYR A;  4B3T C;  1FLO A;  5LMN C;  5GTD A;  5T8T A;  3L8C A;  3VNR A;  4DR1 C; 
#chains in the Genus database with same CATH homology
 1VEH A;  1TH5 A;  2JNV A;  1XHJ A;  3CQ1 A;  3CQ2 A;  3LNO A;  2CU6 A;  2M5O A;  2Z51 A;  3CQ3 A;  3UX3 A;  1UWD A;  2M5H A;  1WCJ A;  3UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...