3CQ1A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (tt1362) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
ARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (TT1362) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein TTHB138
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq1A00
1WCJA 2M5OA 1TH5A 2JNVA 3LNOA 1UWDA 3CQ2A 1VEHA 2M5HA 3UX2A 3CQ3A 3UX3A 1XHJA 3CQ1A 2Z51A 2CU6A
chains in the Genus database with same CATH superfamily
1IB8A 2Y4NA 3TUFA 4MTNA 4GKKC 2BH1X 4DG9A 3IPLA 5ADZA 4WS9A 2OPLA 2Y27A 4DR1C 3GR0A 1VEHA 4NDNA 3A9VA 3TR3A 4DCTA 1PG3A 3DHVA 2QL8A 3CQ3A 4KHPC 5AE3A 4GS5A 2KDNA 2E7GA 3FCCA 5BSWA 4D56A 4LF7C 1M6XC 4LF6C 5LMNC 3JAMD 2UXDC 2D1SA 4R0MA 4G37A 4ZLPA 5AE1A 4DUZC 4KTTA 2D1RA 5IWAC 3A9UA 3I07A 2YX1A 4DV7C 1MDFA 3PESA 2P02A 5BUQA 4FUQA 2ONFA 3IMLA 4LF4C 2D28C 4LFCC 4AQYC 1LCIA 1XMQC 1XNQC 1J5EC 4FTFA 4DR7C 5BSRA 3T1HC 2EGTA 3TDEA 1QM4A 4IZ6A 2JNVA 1O90A 1RY2A 1XRCA 3J81D 4DR5C 2P2QA 5BUSA 4DUYC 2DYJA 4RLFA 4RLQA 5BSVA 5A2QD 1KKGA 3CQ2A 2HHHC 1FUGA 4DG8A 3VNSA 4JI3C 4JI6C 2Y4OA 4JYAC 4D57A 5K85A 3CW8X 4RMNA 3RV2A 2QW0X 2JMPA 2CY1A 4DCVA 4ZJZA 4PZPA 5E7QA 2WP0C 4XX2A 1USPB 1I94C 1WCJA 2E5LC 1FJGC 2UXBC 4DV5C 2P2MA 2D1QA 2QVYX 2WD9A 3PROC 1NY8A 3G7SA 5KYVA 5JRHA 4LFBC 1O93A 2PROA 2VQFC 3A26A 4D4GA 1ML8A 4NXMC 4BBYA 2PT7G 1K0RA 5IT9D 3L95X 4IR7A 4DCUA 3A25A 2P20A 3S82A 1IBMC 3UX2A 4DR6C 4X62C 5LMUC 1QWIA 2E8CA 5CZXA 4DR2C 2DPLA 1P7LA 3H2TA 2MMAB 4K0BA 4NOZA 5A1IA 3DLPX 4DCSA 3AF6A 4KTVA 5KEIA 2QVXX 2ZZMA 4PUIA 4GXQA 3B7WA 4OX9C 4L2ZA 4LF5C 5FLXD 2ZM6C 1IBLC 1PG4A 3ETCA 1PA4A 4DV3C 5T8TA 4PUGA 3NYRA 4I9FA 4JI0C 1LQLA 3IEUA 3L8CA 3K6RA 3UX3A 4B3RC 1MXCA 2UUCC 3LNOA 4X64C 1P4EA 1HH2P 2XR1A 1WH9A 5BSTA 4PHTA 5T8SA 4GKJC 1O92A 3T1YC 1XNRC 4ODJA 3KXWA 4B3MC 3DAYA 3R9WA 1JOSA 3J80D 4X65C 2OBVA 4DR3C 1YJ7A 1UWDA 4JI2C 1WF3A 1MXBA 2P2FA 3O2EA 4BCAA 1V60A 1AMUA 2MCQA 1N33C 1N2FA 4WV3A 4DV6C 4YHHC 4JM1A 4GXRA 4G36A 4B3SC 4B3TC 3ETOA 2D1TA 2PN2A 3VNRA 2YWCA 4RM2A 3GPCA 1HNZC 4JI8C 4PUHA 2UUAC 3CW9A 4YY3C 5BSUA 1M6XA 2ZZNA 4DV2C 5LCIA 1XS3A 2DHMA 1XRAA 3PBKA 1V25A 1N36C 4MH4A 4OXIA 2D27A 1BA3A 4BSZA 4X66C 2VQEC 4G1IA 3R44A 3AF5A 4JI4C 3OTOC 4DV0C 1GPMA 1N32C 4K0KC 4RVNA 3LUSA 1T5HX 4R1MA 2AYAA 1L2FA 3SO4A 2F4VC 1HNXC 2MM9A 3AY0A 1MKYA 4OYCA 1FLOA 4DV1C 4D4IA 1XMOC 1USPA 3N2QA 2BJOA 5IFIA 1XRBA 2HJGA 4JV5C 1HR0C 1EGAA 3EQ6A 2D7VA 5BURA 3NPDA 3A4IA 5DV9A 2VZEA 3NI2A 4U5YD 4BC7A 3EERA 5BSMA 3I08A 2ATWA 1V26A 1RG9A 5K8FA 4LE5A 2OPLB 5A1GA 4JI5C 4DR4C 3N54B 4R1LA 3LNVA 5CZVA 2CU6A 3TQIA 2NCLA 2KZFA 2M5HA 4L4QA 2P2BA 5H9UA 2OO4A 4I9GA 4JI7C 4NXNC 4LF9C 4LFAC 3CJEA 3GR1A 4LF8C 3LGXA 2CXCA 1ZB8A 3RG2A 2UXCC 1IBKC 1ZB9A 5AE2A 5A19A 4RM3A 1UKKA 3E7WA 4FUTA 2V7BA 3NYQA 3UZ0A 5GTDA 4DV4C 4TPSB 4HPVA 2Z51A 2M5OA 1HNWC 1MDBA 3UEBA 4ISBA 3CQ1A 4RVOA 1O9TA 3E7XA 2E8FA 3GKUA 3UOWA 2UU9C 5KYTA 3R9XA 2E0GA 4EATA 1VLAA 2UUBC 1ULTA 3LAXA 3FCEA 2YWBA 2YCBA 4BC9A 2KZ0A 1NYEA 4PROC 1PU1A 5BR8C 2P2JA 1XHJA 3C5EA 4L7IA 3VNQA 1P4EC 1N34C 1T5DX 4JI1C 3IEVA 2E8EA 1MD9A 2ASBA 1TH5A 1MXAA 2QVZX 2VSQA
chains in the Genus database with same CATH topology
1WCJA 2M5OA 1TH5A 2JNVA 3LNOA 1UWDA 3CQ2A 1VEHA 2M5HA 3UX2A 3CQ3A 3UX3A 1XHJA 3CQ1A 2Z51A 2CU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCJ A;  2M5O A;  1TH5 A;  2JNV A;  3LNO A;  1UWD A;  3CQ2 A;  1VEH A;  2M5H A;  3UX2 A;  3CQ3 A;  3UX3 A;  1XHJ A;  3CQ1 A;  2Z51 A;  2CU6 A; 
#chains in the Genus database with same CATH topology
 1IB8 A;  2Y4N A;  3TUF A;  4MTN A;  4GKK C;  2BH1 X;  4DG9 A;  3IPL A;  5ADZ A;  4WS9 A;  2OPL A;  2Y27 A;  4DR1 C;  3GR0 A;  1VEH A;  4NDN A;  3A9V A;  3TR3 A;  4DCT A;  1PG3 A;  3DHV A;  2QL8 A;  3CQ3 A;  4KHP C;  5AE3 A;  4GS5 A;  2KDN A;  2E7G A;  3FCC A;  5BSW A;  4D56 A;  4LF7 C;  1M6X C;  4LF6 C;  5LMN C;  3JAM D;  2UXD C;  2D1S A;  4R0M A;  4G37 A;  4ZLP A;  5AE1 A;  4DUZ C;  4KTT A;  2D1R A;  5IWA C;  3A9U A;  3I07 A;  2YX1 A;  4DV7 C;  1MDF A;  3PES A;  2P02 A;  5BUQ A;  4FUQ A;  2ONF A;  3IML A;  4LF4 C;  2D28 C;  4LFC C;  4AQY C;  1LCI A;  1XMQ C;  1XNQ C;  1J5E C;  4FTF A;  4DR7 C;  5BSR A;  3T1H C;  2EGT A;  3TDE A;  1QM4 A;  4IZ6 A;  2JNV A;  1O90 A;  1RY2 A;  1XRC A;  3J81 D;  4DR5 C;  2P2Q A;  5BUS A;  4DUY C;  2DYJ A;  4RLF A;  4RLQ A;  5BSV A;  5A2Q D;  1KKG A;  3CQ2 A;  2HHH C;  1FUG A;  4DG8 A;  3VNS A;  4JI3 C;  4JI6 C;  2Y4O A;  4JYA C;  4D57 A;  5K85 A;  3CW8 X;  4RMN A;  3RV2 A;  2QW0 X;  2JMP A;  2CY1 A;  4DCV A;  4ZJZ A;  4PZP A;  5E7Q A;  2WP0 C;  4XX2 A;  1USP B;  1I94 C;  1WCJ A;  2E5L C;  1FJG C;  2UXB C;  4DV5 C;  2P2M A;  2D1Q A;  2QVY X;  2WD9 A;  3PRO C;  1NY8 A;  3G7S A;  5KYV A;  5JRH A;  4LFB C;  1O93 A;  2PRO A;  2VQF C;  3A26 A;  4D4G A;  1ML8 A;  4NXM C;  4BBY A;  2PT7 G;  1K0R A;  5IT9 D;  3L95 X;  4IR7 A;  4DCU A;  3A25 A;  2P20 A;  3S82 A;  1IBM C;  3UX2 A;  4DR6 C;  4X62 C;  5LMU C;  1QWI A;  2E8C A;  5CZX A;  4DR2 C;  2DPL A;  1P7L A;  3H2T A;  2MMA B;  4K0B A;  4NOZ A;  5A1I A;  3DLP X;  4DCS A;  3AF6 A;  4KTV A;  5KEI A;  2QVX X;  2ZZM A;  4PUI A;  4GXQ A;  3B7W A;  4OX9 C;  4L2Z A;  4LF5 C;  5FLX D;  2ZM6 C;  1IBL C;  1PG4 A;  3ETC A;  1PA4 A;  4DV3 C;  5T8T A;  4PUG A;  3NYR A;  4I9F A;  4JI0 C;  1LQL A;  3IEU A;  3L8C A;  3K6R A;  3UX3 A;  4B3R C;  1MXC A;  2UUC C;  3LNO A;  4X64 C;  1P4E A;  1HH2 P;  2XR1 A;  1WH9 A;  5BST A;  4PHT A;  5T8S A;  4GKJ C;  1O92 A;  3T1Y C;  1XNR C;  4ODJ A;  3KXW A;  4B3M C;  3DAY A;  3R9W A;  1JOS A;  3J80 D;  4X65 C;  2OBV A;  4DR3 C;  1YJ7 A;  1UWD A;  4JI2 C;  1WF3 A;  1MXB A;  2P2F A;  3O2E A;  4BCA A;  1V60 A;  1AMU A;  2MCQ A;  1N33 C;  1N2F A;  4WV3 A;  4DV6 C;  4YHH C;  4JM1 A;  4GXR A;  4G36 A;  4B3S C;  4B3T C;  3ETO A;  2D1T A;  2PN2 A;  3VNR A;  2YWC A;  4RM2 A;  3GPC A;  1HNZ C;  4JI8 C;  4PUH A;  2UUA C;  3CW9 A;  4YY3 C;  5BSU A;  1M6X A;  2ZZN A;  4DV2 C;  5LCI A;  1XS3 A;  2DHM A;  1XRA A;  3PBK A;  1V25 A;  1N36 C;  4MH4 A;  4OXI A;  2D27 A;  1BA3 A;  4BSZ A;  4X66 C;  2VQE C;  4G1I A;  3R44 A;  3AF5 A;  4JI4 C;  3OTO C;  4DV0 C;  1GPM A;  1N32 C;  4K0K C;  4RVN A;  3LUS A;  1T5H X;  4R1M A;  2AYA A;  1L2F A;  3SO4 A;  2F4V C;  1HNX C;  2MM9 A;  3AY0 A;  1MKY A;  4OYC A;  1FLO A;  4DV1 C;  4D4I A;  1XMO C;  1USP A;  3N2Q A;  2BJO A;  5IFI A;  1XRB A;  2HJG A;  4JV5 C;  1HR0 C;  1EGA A;  3EQ6 A;  2D7V A;  5BUR A;  3NPD A;  3A4I A;  5DV9 A;  2VZE A;  3NI2 A;  4U5Y D;  4BC7 A;  3EER A;  5BSM A;  3I08 A;  2ATW A;  1V26 A;  1RG9 A;  5K8F A;  4LE5 A;  2OPL B;  5A1G A;  4JI5 C;  4DR4 C;  3N54 B;  4R1L A;  3LNV A;  5CZV A;  2CU6 A;  3TQI A;  2NCL A;  2KZF A;  2M5H A;  4L4Q A;  2P2B A;  5H9U A;  2OO4 A;  4I9G A;  4JI7 C;  4NXN C;  4LF9 C;  4LFA C;  3CJE A;  3GR1 A;  4LF8 C;  3LGX A;  2CXC A;  1ZB8 A;  3RG2 A;  2UXC C;  1IBK C;  1ZB9 A;  5AE2 A;  5A19 A;  4RM3 A;  1UKK A;  3E7W A;  4FUT A;  2V7B A;  3NYQ A;  3UZ0 A;  5GTD A;  4DV4 C;  4TPS B;  4HPV A;  2Z51 A;  2M5O A;  1HNW C;  1MDB A;  3UEB A;  4ISB A;  3CQ1 A;  4RVO A;  1O9T A;  3E7X A;  2E8F A;  3GKU A;  3UOW A;  2UU9 C;  5KYT A;  3R9X A;  2E0G A;  4EAT A;  1VLA A;  2UUB C;  1ULT A;  3LAX A;  3FCE A;  2YWB A;  2YCB A;  4BC9 A;  2KZ0 A;  1NYE A;  4PRO C;  1PU1 A;  5BR8 C;  2P2J A;  1XHJ A;  3C5E A;  4L7I A;  3VNQ A;  1P4E C;  1N34 C;  1T5D X;  4JI1 C;  3IEV A;  2E8E A;  1MD9 A;  2ASB A;  1TH5 A;  1MXA A;  2QVZ X;  2VSQ A; 
#chains in the Genus database with same CATH homology
 1WCJ A;  2M5O A;  1TH5 A;  2JNV A;  3LNO A;  1UWD A;  3CQ2 A;  1VEH A;  2M5H A;  3UX2 A;  3CQ3 A;  3UX3 A;  1XHJ A;  3CQ1 A;  2Z51 A;  2CU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...