3CQ1A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (tt1362) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
ARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (TT1362) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein TTHB138
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq1A00
2CU6A 3CQ1A 3CQ3A 3LNOA 1VEHA 1TH5A 3CQ2A 2M5HA 2M5OA 2Z51A 3UX3A 1WCJA 1UWDA 2JNVA 1XHJA 3UX2A
chains in the Genus database with same CATH superfamily
2P2QA 4RLFA 4DR6C 4X66C 4B3TC 3UX3A 1P4EA 4BC9A 1WH9A 3CW9A 5LCIA 2QL8A 4HPVA 1M6XC 1IBLC 4WV3A 2MCQA 3FCEA 1IBMC 5H9UA 2BJOA 1NY8A 2AYAA 2E0GA 3R9XA 2KDNA 3C5EA 1N36C 2ZM6C 4KTVA 4I9FA 4ISBA 3UZ0A 4FTFA 5BR8C 1USPB 1I94C 5KEIA 4RLQA 4LFAC 4AQYC 3K6RA 1N33C 2YX1A 4GKKC 5BSMA 3AF5A 2ASBA 4FUTA 2E8EA 4LF7C 4PHTA 2CXCA 3N2QA 4G37A 4X64C 2OO4A 5A2QD 1PG4A 2UU9C 4TPSB 3LAXA 4R1MA 2P02A 1BA3A 4LF6C 4RVOA 4EATA 4GXQA 2KZFA 5ADZA 3CJEA 1V25A 4G36A 3LUSA 1MD9A 2VQEC 3E7XA 2OPLA 3OTOC 1P4EC 1XNQC 1ULTA 2P20A 2QVXX 3LNOA 4LF9C 5BURA 4DV1C 2HHHC 2ZZMA 4GS5A 1PU1A 2UXBC 5CZXA 1VLAA 4DV0C 3KXWA 5KYVA 1N34C 3FCCA 2DYJA 3PBKA 3A26A 3DLPX 1RY2A 1O93A 2F4VC 4YY3C 4MH4A 2E8CA 3AY0A 2BH1X 3CQ1A 2M5HA 3TDEA 2P2MA 2MMAB 4NXNC 4X62C 1QWIA 2NCLA 1PG3A 4U5YD 4JM1A 4IZ6A 4RM2A 3VNRA 2YCBA 2OPLB 5IFIA 3JAMD 2QW0X 1XMOC 3A9UA 5DV9A 2EGTA 4MTNA 4DUYC 1HNXC 2WP0C 1GPMA 1FLOA 4ZLPA 4JV5C 2D27A 4PZPA 5IT9D 1XRCA 4DV3C 1NYEA 3L8CA 5GTDA 5A1IA 2P2BA 2Z51A 2D1TA 3I07A 5BSTA 4PROC 4DR7C 4LFCC 3SO4A 3UEBA 2D1QA 4D57A 5A1GA 2E5LC 4LF8C 5BUQA 3J80D 4DV4C 4PUGA 4B3MC 3DHVA 1O92A 2CU6A 1XRBA 3O2EA 4L2ZA 5LMUC 4OYCA 4L7IA 4LE5A 4DG8A 2UUCC 3RV2A 2VQFC 3GKUA 4K0KC 4LFBC 4ODJA 3N54B 3GR1A 2UXCC 4JI7C 5AE2A 4WS9A 2UXDC 3UOWA 3J81D 4BC7A 3GPCA 2P2JA 1MXCA 1O90A 5A19A 1FUGA 4D56A 3RG2A 4DCSA 2Y27A 4JI8C 4JYAC 3LNVA 4NXMC 3IMLA 2D7VA 3ETOA 4JI3C 3VNQA 4DCTA 2D1SA 4DR4C 2ATWA 4PUIA 3NI2A 1EGAA 1MKYA 1T5HX 3IEUA 3R44A 2UUBC 5BUSA 4I9GA 5JRHA 1LQLA 4K0BA 2ONFA 1AMUA 2PT7G 3H2TA 2M5OA 1ZB8A 1XRAA 3EERA 1LCIA 4KTTA 4R1LA 4DV5C 4GKJC 4JI4C 1HNZC 3ETCA 3R9WA 4X65C 3EQ6A 5BSUA 4DCUA 2OBVA 1HR0C 4NOZA 5BSRA 3T1YC 4G1IA 4LF4C 3E7WA 1P7LA 1N2FA 4DR3C 4OX9C 1WCJA 4RM3A 1MDFA 4JI1C 4DV7C 4B3SC 5E7QA 4ZJZA 3LGXA 4BSZA 2DPLA 3PROC 3AF6A 5K85A 3L95X 4DV2C 2QVZX 1XHJA 4DCVA 1T5DX 2YWBA 4D4GA 1V26A 1UWDA 3UX2A 5BSWA 2WD9A 4JI0C 3NPDA 4BBYA 5CZVA 2DHMA 3GR0A 1UKKA 3CW8X 1ML8A 3G7SA 5K8FA 3IEVA 3A4IA 4JI2C 1JOSA 5T8TA 3NYQA 4OXIA 2E7GA 1RG9A 4NDNA 3CQ3A 3TR3A 5FLXD 2V7BA 2VSQA 3VNSA 4PUHA 4DR1C 1WF3A 4DV6C 2E8FA 4KHPC 1IB8A 4RVNA 2YWCA 2Y4OA 3DAYA 2JNVA 3S82A 1MDBA 5AE1A 4DR2C 1O9TA 4GXRA 2CY1A 4JI6C 2HJGA 3TQIA 4FUQA 5T8SA 1N32C 2D28C 3A25A 4YHHC 1QM4A 4BCAA 1HNWC 5AE3A 3CQ2A 1K0RA 2D1RA 1ZB9A 5IWAC 3T1HC 4DG9A 1VEHA 1V60A 1KKGA 4B3RC 1L2FA 2PROA 2VZEA 2UUAC 2JMPA 4JI5C 3TUFA 1YJ7A 1XMQC 4L4QA 2ZZNA 1FJGC 3NYRA 3A9VA 2P2FA 5LMNC 4XX2A 2PN2A 1XNRC 3IPLA 5BSVA 2XR1A 4RMNA 4DR5C 3B7WA 4DUZC 1PA4A 2MM9A 3I08A 1TH5A 3PESA 1IBKC 5KYTA 4D4IA 2Y4NA 4R0MA 1HH2P 1J5EC 1M6XA 2KZ0A 4LF5C 1XS3A 2QVYX 4IR7A 1MXAA 1MXBA 1USPA
chains in the Genus database with same CATH topology
2CU6A 3CQ1A 3CQ3A 3LNOA 1VEHA 1TH5A 3CQ2A 2M5HA 2M5OA 2Z51A 3UX3A 1WCJA 1UWDA 2JNVA 1XHJA 3UX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU6 A;  3CQ1 A;  3CQ3 A;  3LNO A;  1VEH A;  1TH5 A;  3CQ2 A;  2M5H A;  2M5O A;  2Z51 A;  3UX3 A;  1WCJ A;  1UWD A;  2JNV A;  1XHJ A;  3UX2 A; 
#chains in the Genus database with same CATH topology
 2P2Q A;  4RLF A;  4DR6 C;  4X66 C;  4B3T C;  3UX3 A;  1P4E A;  4BC9 A;  1WH9 A;  3CW9 A;  5LCI A;  2QL8 A;  4HPV A;  1M6X C;  1IBL C;  4WV3 A;  2MCQ A;  3FCE A;  1IBM C;  5H9U A;  2BJO A;  1NY8 A;  2AYA A;  2E0G A;  3R9X A;  2KDN A;  3C5E A;  1N36 C;  2ZM6 C;  4KTV A;  4I9F A;  4ISB A;  3UZ0 A;  4FTF A;  5BR8 C;  1USP B;  1I94 C;  5KEI A;  4RLQ A;  4LFA C;  4AQY C;  3K6R A;  1N33 C;  2YX1 A;  4GKK C;  5BSM A;  3AF5 A;  2ASB A;  4FUT A;  2E8E A;  4LF7 C;  4PHT A;  2CXC A;  3N2Q A;  4G37 A;  4X64 C;  2OO4 A;  5A2Q D;  1PG4 A;  2UU9 C;  4TPS B;  3LAX A;  4R1M A;  2P02 A;  1BA3 A;  4LF6 C;  4RVO A;  4EAT A;  4GXQ A;  2KZF A;  5ADZ A;  3CJE A;  1V25 A;  4G36 A;  3LUS A;  1MD9 A;  2VQE C;  3E7X A;  2OPL A;  3OTO C;  1P4E C;  1XNQ C;  1ULT A;  2P20 A;  2QVX X;  3LNO A;  4LF9 C;  5BUR A;  4DV1 C;  2HHH C;  2ZZM A;  4GS5 A;  1PU1 A;  2UXB C;  5CZX A;  1VLA A;  4DV0 C;  3KXW A;  5KYV A;  1N34 C;  3FCC A;  2DYJ A;  3PBK A;  3A26 A;  3DLP X;  1RY2 A;  1O93 A;  2F4V C;  4YY3 C;  4MH4 A;  2E8C A;  3AY0 A;  2BH1 X;  3CQ1 A;  2M5H A;  3TDE A;  2P2M A;  2MMA B;  4NXN C;  4X62 C;  1QWI A;  2NCL A;  1PG3 A;  4U5Y D;  4JM1 A;  4IZ6 A;  4RM2 A;  3VNR A;  2YCB A;  2OPL B;  5IFI A;  3JAM D;  2QW0 X;  1XMO C;  3A9U A;  5DV9 A;  2EGT A;  4MTN A;  4DUY C;  1HNX C;  2WP0 C;  1GPM A;  1FLO A;  4ZLP A;  4JV5 C;  2D27 A;  4PZP A;  5IT9 D;  1XRC A;  4DV3 C;  1NYE A;  3L8C A;  5GTD A;  5A1I A;  2P2B A;  2Z51 A;  2D1T A;  3I07 A;  5BST A;  4PRO C;  4DR7 C;  4LFC C;  3SO4 A;  3UEB A;  2D1Q A;  4D57 A;  5A1G A;  2E5L C;  4LF8 C;  5BUQ A;  3J80 D;  4DV4 C;  4PUG A;  4B3M C;  3DHV A;  1O92 A;  2CU6 A;  1XRB A;  3O2E A;  4L2Z A;  5LMU C;  4OYC A;  4L7I A;  4LE5 A;  4DG8 A;  2UUC C;  3RV2 A;  2VQF C;  3GKU A;  4K0K C;  4LFB C;  4ODJ A;  3N54 B;  3GR1 A;  2UXC C;  4JI7 C;  5AE2 A;  4WS9 A;  2UXD C;  3UOW A;  3J81 D;  4BC7 A;  3GPC A;  2P2J A;  1MXC A;  1O90 A;  5A19 A;  1FUG A;  4D56 A;  3RG2 A;  4DCS A;  2Y27 A;  4JI8 C;  4JYA C;  3LNV A;  4NXM C;  3IML A;  2D7V A;  3ETO A;  4JI3 C;  3VNQ A;  4DCT A;  2D1S A;  4DR4 C;  2ATW A;  4PUI A;  3NI2 A;  1EGA A;  1MKY A;  1T5H X;  3IEU A;  3R44 A;  2UUB C;  5BUS A;  4I9G A;  5JRH A;  1LQL A;  4K0B A;  2ONF A;  1AMU A;  2PT7 G;  3H2T A;  2M5O A;  1ZB8 A;  1XRA A;  3EER A;  1LCI A;  4KTT A;  4R1L A;  4DV5 C;  4GKJ C;  4JI4 C;  1HNZ C;  3ETC A;  3R9W A;  4X65 C;  3EQ6 A;  5BSU A;  4DCU A;  2OBV A;  1HR0 C;  4NOZ A;  5BSR A;  3T1Y C;  4G1I A;  4LF4 C;  3E7W A;  1P7L A;  1N2F A;  4DR3 C;  4OX9 C;  1WCJ A;  4RM3 A;  1MDF A;  4JI1 C;  4DV7 C;  4B3S C;  5E7Q A;  4ZJZ A;  3LGX A;  4BSZ A;  2DPL A;  3PRO C;  3AF6 A;  5K85 A;  3L95 X;  4DV2 C;  2QVZ X;  1XHJ A;  4DCV A;  1T5D X;  2YWB A;  4D4G A;  1V26 A;  1UWD A;  3UX2 A;  5BSW A;  2WD9 A;  4JI0 C;  3NPD A;  4BBY A;  5CZV A;  2DHM A;  3GR0 A;  1UKK A;  3CW8 X;  1ML8 A;  3G7S A;  5K8F A;  3IEV A;  3A4I A;  4JI2 C;  1JOS A;  5T8T A;  3NYQ A;  4OXI A;  2E7G A;  1RG9 A;  4NDN A;  3CQ3 A;  3TR3 A;  5FLX D;  2V7B A;  2VSQ A;  3VNS A;  4PUH A;  4DR1 C;  1WF3 A;  4DV6 C;  2E8F A;  4KHP C;  1IB8 A;  4RVN A;  2YWC A;  2Y4O A;  3DAY A;  2JNV A;  3S82 A;  1MDB A;  5AE1 A;  4DR2 C;  1O9T A;  4GXR A;  2CY1 A;  4JI6 C;  2HJG A;  3TQI A;  4FUQ A;  5T8S A;  1N32 C;  2D28 C;  3A25 A;  4YHH C;  1QM4 A;  4BCA A;  1HNW C;  5AE3 A;  3CQ2 A;  1K0R A;  2D1R A;  1ZB9 A;  5IWA C;  3T1H C;  4DG9 A;  1VEH A;  1V60 A;  1KKG A;  4B3R C;  1L2F A;  2PRO A;  2VZE A;  2UUA C;  2JMP A;  4JI5 C;  3TUF A;  1YJ7 A;  1XMQ C;  4L4Q A;  2ZZN A;  1FJG C;  3NYR A;  3A9V A;  2P2F A;  5LMN C;  4XX2 A;  2PN2 A;  1XNR C;  3IPL A;  5BSV A;  2XR1 A;  4RMN A;  4DR5 C;  3B7W A;  4DUZ C;  1PA4 A;  2MM9 A;  3I08 A;  1TH5 A;  3PES A;  1IBK C;  5KYT A;  4D4I A;  2Y4N A;  4R0M A;  1HH2 P;  1J5E C;  1M6X A;  2KZ0 A;  4LF5 C;  1XS3 A;  2QVY X;  4IR7 A;  1MXA A;  1MXB A;  1USP A; 
#chains in the Genus database with same CATH homology
 2CU6 A;  3CQ1 A;  3CQ3 A;  3LNO A;  1VEH A;  1TH5 A;  3CQ2 A;  2M5H A;  2M5O A;  2Z51 A;  3UX3 A;  1WCJ A;  1UWD A;  2JNV A;  1XHJ A;  3UX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...