3CQ1A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (tt1362) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
ARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB138
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (TT1362) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq1A00
3UX3A 2JNVA 2Z51A 1XHJA 2M5HA 3CQ3A 3UX2A 3CQ1A 3LNOA 1TH5A 2M5OA 3CQ2A 2CU6A 1UWDA 1WCJA 1VEHA
chains in the Genus database with same CATH superfamily
5T8SA 4DUZC 2Y27A 2F4VC 3UZ0A 4OXIA 1JOSA 3LGXA 1XMOC 4PROC 3VNRA 4LF6C 2D27A 5IWAC 1ML8A 1PG3A 4YHHC 2XR1A 4DCVA 2D1TA 1IBKC 2UXDC 4I9GA 3AF5A 2D7VA 3TR3A 1J5EC 2UUBC 3J80D 1USPA 3NI2A 1ZB8A 4R1LA 4BC7A 4MTNA 2E8FA 3A9UA 4JI3C 4JI8C 1WH9A 4JM1A 2P2MA 1HNZC 4ZLPA 2BJOA 4RVOA 5BSTA 3CW8X 3E7XA 3NYRA 1FLOA 1FJGC 3DLPX 1N34C 4DR5C 5JRHA 5KYTA 1RY2A 2ZZNA 2UXBC 4JI6C 1V60A 1MKYA 1V26A 3FCEA 3O2EA 3NYQA 4R0MA 4XX2A 4ZJZA 2D28C 1P4EC 1LCIA 4GKJC 4BBYA 2P20A 4LFBC 3UOWA 1P4EA 1XNQC 5FLXD 3CQ1A 2DHMA 1XRCA 3CQ3A 4RM3A 4JI4C 3K6RA 1O9TA 3GKUA 2JNVA 2QVYX 3AY0A 4DG8A 4DR3C 2UUCC 1IBLC 4X66C 4IR7A 5BURA 2OPLA 2P2FA 4I9FA 4D56A 3IPLA 4K0BA 4PZPA 4X65C 3SO4A 5IT9D 1HR0C 1FUGA 3C5EA 3J81D 4OX9C 4DR6C 2P02A 4FUQA 2Y4OA 3PESA 4JI2C 5DV9A 4R1MA 1VLAA 2ATWA 4D57A 4JI7C 4WS9A 4LFAC 1N2FA 4JYAC 2MM9A 2VZEA 1WCJA 2D1SA 1IB8A 1O92A 3TQIA 3EERA 1TH5A 5LCIA 4L2ZA 1PG4A 4L7IA 5KYVA 3R44A 1T5DX 1M6XC 1T5HX 4LF9C 1QWIA 5BR8C 2YWCA 5BSUA 4B3TC 1PA4A 3E7WA 5AE3A 2OO4A 1M6XA 4X62C 1XRAA 2YWBA 5A1GA 5A1IA 2UXCC 2WD9A 1NYEA 4LF8C 4G1IA 2M5OA 3RV2A 3UX2A 4KTVA 4WV3A 1P7LA 3KXWA 1MXCA 2HJGA 2HHHC 4BSZA 3L95X 1USPB 4KHPC 4DV5C 2D1QA 4DUYC 1XHJA 5BUSA 1V25A 3N2QA 3R9XA 4PUIA 4LF4C 3G7SA 1L2FA 2PROA 5BUQA 3T1YC 5H9UA 2QVXX 2Z51A 5BSWA 4DV6C 2YCBA 4NDNA 5T8TA 1K0RA 4DV7C 1KKGA 3DAYA 4DR7C 3I08A 4FTFA 4RVNA 2E0GA 5CZVA 3B7WA 2UUAC 4LF5C 4RLQA 2BH1X 1MDBA 2MCQA 2NCLA 4EATA 2ZM6C 1XMQC 3ETOA 3A4IA 3LNOA 2ONFA 5BSVA 4LE5A 3GR0A 4FUTA 3EQ6A 1IBMC 1MDFA 1BA3A 2ZZMA 4ISBA 5AE2A 2V7BA 4IZ6A 5GTDA 2MMAB 1YJ7A 2D1RA 5KEIA 1XS3A 4RLFA 3VNSA 4DV0C 2CU6A 1UWDA 3PROC 3VNQA 3A26A 1EGAA 5A19A 5A2QD 3IEUA 4MH4A 5BSRA 4KTTA 4X64C 1GPMA 3IMLA 5LMNC 4JI1C 1N36C 1HNWC 3IEVA 2YX1A 1WF3A 3FCCA 3LAXA 1MD9A 1UKKA 3N54B 3RG2A 2P2JA 4B3RC 3ETCA 4DG9A 3H2TA 4DCSA 3GR1A 3PBKA 2PN2A 3CW9A 3A9VA 4B3MC 2DPLA 4BCAA 4GXRA 4AQYC 2VQFC 2EGTA 2VQEC 4TPSB 1LQLA 1ULTA 4ODJA 2E8CA 3AF6A 5K8FA 2PT7G 5E7QA 4JI0C 2KZ0A 4YY3C 4L4QA 4K0KC 2QVZX 4D4IA 3I07A 4LFCC 4DR4C 2ASBA 2Y4NA 5LMUC 1XNRC 2CY1A 2E5LC 2KDNA 1N32C 1QM4A 4RM2A 1N33C 1I94C 5CZXA 1HH2P 3NPDA 4GXQA 3L8CA 1MXBA 2OBVA 1NY8A 4NXMC 1O93A 2QW0X 3TUFA 3CQ2A 2E7GA 2E8EA 4G36A 4GKKC 2KZFA 2P2QA 2OPLB 3GPCA 2JMPA 3OTOC 5BSMA 3S82A 5K85A 1O90A 2DYJA 4DR1C 4DCTA 4RMNA 4JV5C 4DV2C 2VSQA 3TDEA 3UX3A 1AMUA 1ZB9A 4NOZA 4OYCA 4PHTA 5IFIA 2WP0C 4LF7C 4HPVA 3R9WA 3LUSA 1MXAA 4JI5C 3JAMD 1VEHA 4GS5A 3LNVA 2CXCA 1PU1A 4BC9A 1XRBA 4DV4C 1HNXC 2M5HA 4PUHA 4DR2C 5ADZA 4PUGA 1RG9A 3UEBA 3A25A 5AE1A 4G37A 3DHVA 4B3SC 4DV1C 4U5YD 2QL8A 3T1HC 3CJEA 4DV3C 2P2BA 4DCUA 4NXNC 4D4GA 2UU9C 2AYAA
chains in the Genus database with same CATH topology
3UX3A 2JNVA 2Z51A 1XHJA 2M5HA 3CQ3A 3UX2A 3CQ1A 3LNOA 1TH5A 2M5OA 3CQ2A 2CU6A 1UWDA 1WCJA 1VEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UX3 A;  2JNV A;  2Z51 A;  1XHJ A;  2M5H A;  3CQ3 A;  3UX2 A;  3CQ1 A;  3LNO A;  1TH5 A;  2M5O A;  3CQ2 A;  2CU6 A;  1UWD A;  1WCJ A;  1VEH A; 
#chains in the Genus database with same CATH topology
 5T8S A;  4DUZ C;  2Y27 A;  2F4V C;  3UZ0 A;  4OXI A;  1JOS A;  3LGX A;  1XMO C;  4PRO C;  3VNR A;  4LF6 C;  2D27 A;  5IWA C;  1ML8 A;  1PG3 A;  4YHH C;  2XR1 A;  4DCV A;  2D1T A;  1IBK C;  2UXD C;  4I9G A;  3AF5 A;  2D7V A;  3TR3 A;  1J5E C;  2UUB C;  3J80 D;  1USP A;  3NI2 A;  1ZB8 A;  4R1L A;  4BC7 A;  4MTN A;  2E8F A;  3A9U A;  4JI3 C;  4JI8 C;  1WH9 A;  4JM1 A;  2P2M A;  1HNZ C;  4ZLP A;  2BJO A;  4RVO A;  5BST A;  3CW8 X;  3E7X A;  3NYR A;  1FLO A;  1FJG C;  3DLP X;  1N34 C;  4DR5 C;  5JRH A;  5KYT A;  1RY2 A;  2ZZN A;  2UXB C;  4JI6 C;  1V60 A;  1MKY A;  1V26 A;  3FCE A;  3O2E A;  3NYQ A;  4R0M A;  4XX2 A;  4ZJZ A;  2D28 C;  1P4E C;  1LCI A;  4GKJ C;  4BBY A;  2P20 A;  4LFB C;  3UOW A;  1P4E A;  1XNQ C;  5FLX D;  3CQ1 A;  2DHM A;  1XRC A;  3CQ3 A;  4RM3 A;  4JI4 C;  3K6R A;  1O9T A;  3GKU A;  2JNV A;  2QVY X;  3AY0 A;  4DG8 A;  4DR3 C;  2UUC C;  1IBL C;  4X66 C;  4IR7 A;  5BUR A;  2OPL A;  2P2F A;  4I9F A;  4D56 A;  3IPL A;  4K0B A;  4PZP A;  4X65 C;  3SO4 A;  5IT9 D;  1HR0 C;  1FUG A;  3C5E A;  3J81 D;  4OX9 C;  4DR6 C;  2P02 A;  4FUQ A;  2Y4O A;  3PES A;  4JI2 C;  5DV9 A;  4R1M A;  1VLA A;  2ATW A;  4D57 A;  4JI7 C;  4WS9 A;  4LFA C;  1N2F A;  4JYA C;  2MM9 A;  2VZE A;  1WCJ A;  2D1S A;  1IB8 A;  1O92 A;  3TQI A;  3EER A;  1TH5 A;  5LCI A;  4L2Z A;  1PG4 A;  4L7I A;  5KYV A;  3R44 A;  1T5D X;  1M6X C;  1T5H X;  4LF9 C;  1QWI A;  5BR8 C;  2YWC A;  5BSU A;  4B3T C;  1PA4 A;  3E7W A;  5AE3 A;  2OO4 A;  1M6X A;  4X62 C;  1XRA A;  2YWB A;  5A1G A;  5A1I A;  2UXC C;  2WD9 A;  1NYE A;  4LF8 C;  4G1I A;  2M5O A;  3RV2 A;  3UX2 A;  4KTV A;  4WV3 A;  1P7L A;  3KXW A;  1MXC A;  2HJG A;  2HHH C;  4BSZ A;  3L95 X;  1USP B;  4KHP C;  4DV5 C;  2D1Q A;  4DUY C;  1XHJ A;  5BUS A;  1V25 A;  3N2Q A;  3R9X A;  4PUI A;  4LF4 C;  3G7S A;  1L2F A;  2PRO A;  5BUQ A;  3T1Y C;  5H9U A;  2QVX X;  2Z51 A;  5BSW A;  4DV6 C;  2YCB A;  4NDN A;  5T8T A;  1K0R A;  4DV7 C;  1KKG A;  3DAY A;  4DR7 C;  3I08 A;  4FTF A;  4RVN A;  2E0G A;  5CZV A;  3B7W A;  2UUA C;  4LF5 C;  4RLQ A;  2BH1 X;  1MDB A;  2MCQ A;  2NCL A;  4EAT A;  2ZM6 C;  1XMQ C;  3ETO A;  3A4I A;  3LNO A;  2ONF A;  5BSV A;  4LE5 A;  3GR0 A;  4FUT A;  3EQ6 A;  1IBM C;  1MDF A;  1BA3 A;  2ZZM A;  4ISB A;  5AE2 A;  2V7B A;  4IZ6 A;  5GTD A;  2MMA B;  1YJ7 A;  2D1R A;  5KEI A;  1XS3 A;  4RLF A;  3VNS A;  4DV0 C;  2CU6 A;  1UWD A;  3PRO C;  3VNQ A;  3A26 A;  1EGA A;  5A19 A;  5A2Q D;  3IEU A;  4MH4 A;  5BSR A;  4KTT A;  4X64 C;  1GPM A;  3IML A;  5LMN C;  4JI1 C;  1N36 C;  1HNW C;  3IEV A;  2YX1 A;  1WF3 A;  3FCC A;  3LAX A;  1MD9 A;  1UKK A;  3N54 B;  3RG2 A;  2P2J A;  4B3R C;  3ETC A;  4DG9 A;  3H2T A;  4DCS A;  3GR1 A;  3PBK A;  2PN2 A;  3CW9 A;  3A9V A;  4B3M C;  2DPL A;  4BCA A;  4GXR A;  4AQY C;  2VQF C;  2EGT A;  2VQE C;  4TPS B;  1LQL A;  1ULT A;  4ODJ A;  2E8C A;  3AF6 A;  5K8F A;  2PT7 G;  5E7Q A;  4JI0 C;  2KZ0 A;  4YY3 C;  4L4Q A;  4K0K C;  2QVZ X;  4D4I A;  3I07 A;  4LFC C;  4DR4 C;  2ASB A;  2Y4N A;  5LMU C;  1XNR C;  2CY1 A;  2E5L C;  2KDN A;  1N32 C;  1QM4 A;  4RM2 A;  1N33 C;  1I94 C;  5CZX A;  1HH2 P;  3NPD A;  4GXQ A;  3L8C A;  1MXB A;  2OBV A;  1NY8 A;  4NXM C;  1O93 A;  2QW0 X;  3TUF A;  3CQ2 A;  2E7G A;  2E8E A;  4G36 A;  4GKK C;  2KZF A;  2P2Q A;  2OPL B;  3GPC A;  2JMP A;  3OTO C;  5BSM A;  3S82 A;  5K85 A;  1O90 A;  2DYJ A;  4DR1 C;  4DCT A;  4RMN A;  4JV5 C;  4DV2 C;  2VSQ A;  3TDE A;  3UX3 A;  1AMU A;  1ZB9 A;  4NOZ A;  4OYC A;  4PHT A;  5IFI A;  2WP0 C;  4LF7 C;  4HPV A;  3R9W A;  3LUS A;  1MXA A;  4JI5 C;  3JAM D;  1VEH A;  4GS5 A;  3LNV A;  2CXC A;  1PU1 A;  4BC9 A;  1XRB A;  4DV4 C;  1HNX C;  2M5H A;  4PUH A;  4DR2 C;  5ADZ A;  4PUG A;  1RG9 A;  3UEB A;  3A25 A;  5AE1 A;  4G37 A;  3DHV A;  4B3S C;  4DV1 C;  4U5Y D;  2QL8 A;  3T1H C;  3CJE A;  4DV3 C;  2P2B A;  4DCU A;  4NXN C;  4D4G A;  2UU9 C;  2AYA A; 
#chains in the Genus database with same CATH homology
 3UX3 A;  2JNV A;  2Z51 A;  1XHJ A;  2M5H A;  3CQ3 A;  3UX2 A;  3CQ1 A;  3LNO A;  1TH5 A;  2M5O A;  3CQ2 A;  2CU6 A;  1UWD A;  1WCJ A;  1VEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...