3CQ1A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (tt1362) from thermus thermophilus hb8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
ARNPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB138
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (TT1362) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq1A00
2M5OA 2M5HA 2Z51A 2JNVA 1VEHA 1TH5A 3UX3A 1WCJA 3CQ2A 3UX2A 3CQ1A 3CQ3A 3LNOA 1XHJA 2CU6A 1UWDA
chains in the Genus database with same CATH superfamily
4D4IA 5T8TA 2PT7G 1P4EA 1MXBA 1XS3A 5K85A 2E8CA 3TDEA 3O2EA 1LQLA 4GXRA 1TH5A 2NCLA 5KEIA 4PUGA 1O9TA 2P2FA 1AMUA 4DR5C 5AE2A 2P2MA 3GR0A 2M5HA 1HNXC 3A26A 2UUAC 2EGTA 4I9GA 2QVYX 2QL8A 5CZVA 2E8EA 1HNWC 2P02A 3CW9A 3ETOA 5T8SA 4TPSB 5IT9D 2ATWA 5A19A 1IBKC 1N2FA 4JI2C 1USPA 1ULTA 3FCEA 4DCUA 1NY8A 2YCBA 2ONFA 5GTDA 2P2BA 4FUQA 5LCIA 4BBYA 1MXCA 1VEHA 1M6XA 3GPCA 4K0KC 4IZ6A 4RM2A 4GS5A 1N34C 2E0GA 1USPB 4JI3C 5BURA 2E5LC 3IMLA 4FUTA 2KDNA 4AQYC 4JI6C 3RG2A 4L2ZA 4NDNA 5DV9A 2JMPA 1MDBA 3TR3A 2QW0X 4ZLPA 4PUHA 3T1YC 2E7GA 1O90A 4L4QA 1PG4A 4B3TC 1IBLC 1UWDA 1I94C 1GPMA 1V25A 1PG3A 1PU1A 1EGAA 1NYEA 1P4EC 4D57A 3N2QA 2WP0C 1XRBA 1K0RA 2VQEC 1L2FA 4LF6C 2ZM6C 4NXMC 5JRHA 2CU6A 2ZZNA 2AYAA 4BC9A 5K8FA 3CQ1A 1XMOC 4DV0C 4XX2A 3SO4A 5BSRA 2Z51A 4NXNC 1O93A 1KKGA 4I9FA 4RMNA 4X65C 2D1TA 1M6XC 2QVZX 4JI4C 4JYAC 2D7VA 3FCCA 4DR1C 2WD9A 4RLQA 4WS9A 4PUIA 4LF7C 3PROC 1XHJA 1MKYA 5IFIA 1HNZC 4X62C 1T5HX 3DLPX 4ZJZA 1RG9A 5CZXA 2JNVA 4DV7C 1WCJA 2V7BA 3I08A 3NPDA 3N54B 4EATA 2OBVA 4JI7C 3LUSA 4G1IA 4JM1A 4DV3C 4DR4C 4BCAA 4L7IA 2VZEA 3DAYA 3UEBA 5FLXD 1PA4A 3T1HC 3EERA 5BSTA 3EQ6A 1ZB9A 1ZB8A 3CJEA 1JOSA 1N36C 4G37A 3B7WA 2QVXX 2Y4OA 3DHVA 2D27A 4GXQA 4JI8C 3TUFA 2D1RA 2KZFA 4B3MC 5LMUC 1FUGA 4LF4C 4JV5C 2E8FA 4DCSA 3TQIA 4X64C 3NYQA 3LNOA 4MTNA 4WV3A 3LGXA 4DV2C 1BA3A 3VNRA 4LE5A 5BSUA 1HR0C 4ODJA 2ZZMA 2D1QA 5H9UA 5ADZA 1J5EC 4PROC 5BSMA 3L8CA 3VNSA 2MCQA 1FLOA 5A1GA 1XRAA 1MXAA 3IEUA 1IB8A 1V60A 1XRCA 2BH1X 2HHHC 2XR1A 3CQ2A 5A2QD 3LAXA 3S82A 2HJGA 2P2QA 3VNQA 1N33C 2UXBC 4YY3C 3OTOC 3NYRA 5IWAC 3E7XA 3RV2A 3J80D 2P2JA 2Y27A 2YX1A 4B3SC 4JI5C 3CQ3A 2UUBC 4DUYC 4LF9C 3K6RA 4OYCA 2YWCA 2P20A 4U5YD 3GR1A 4G36A 3C5EA 4YHHC 2VSQA 2M5OA 4RM3A 2F4VC 4DV5C 1MD9A 3GKUA 5A1IA 1XNQC 4GKKC 2PN2A 2OPLA 4DV4C 2DYJA 3AY0A 1XNRC 5BSVA 3R9WA 4R1MA 4RLFA 4DR2C 1VLAA 3A25A 5BSWA 4DV1C 2UUCC 1LCIA 1O92A 2UXCC 1WF3A 3CW8X 3A4IA 4ISBA 1MDFA 2OPLB 2UU9C 1FJGC 1QWIA 2MM9A 4RVOA 4PHTA 2UXDC 4FTFA 4JI1C 4DV6C 3AF5A 3PESA 4LFBC 2PROA 2DHMA 4LFAC 1RY2A 5BR8C 4IR7A 4DR7C 2KZ0A 2Y4NA 3LNVA 1V26A 3E7WA 1XMQC 1T5DX 4R1LA 4B3RC 4LFCC 1YJ7A 3J81D 2BJOA 4NOZA 3R9XA 5E7QA 1IBMC 3I07A 1P7LA 3ETCA 1N32C 4JI0C 3UOWA 2MMAB 1WH9A 2YWBA 3UZ0A 3L95X 4OX9C 2D1SA 3JAMD 4LF5C 4OXIA 2VQFC 2ASBA 4LF8C 3NI2A 3PBKA 4X66C 4D4GA 4D56A 3KXWA 4DG9A 3R44A 1ML8A 3G7SA 3A9VA 3IEVA 4DG8A 2CY1A 5KYTA 4DCTA 4DR3C 3A9UA 3UX3A 5AE1A 3AF6A 4BSZA 4PZPA 4KTTA 2DPLA 3UX2A 1HH2P 3IPLA 4K0BA 4DUZC 4HPVA 4DCVA 4BC7A 3H2TA 2D28C 4GKJC 4KTVA 2CXCA 5AE3A 1UKKA 5BUQA 4DR6C 4R0MA 5BUSA 4KHPC 4MH4A 1QM4A 5KYVA 4RVNA 2OO4A 5LMNC
chains in the Genus database with same CATH topology
2M5OA 2M5HA 2Z51A 2JNVA 1VEHA 1TH5A 3UX3A 1WCJA 3CQ2A 3UX2A 3CQ1A 3CQ3A 3LNOA 1XHJA 2CU6A 1UWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5O A;  2M5H A;  2Z51 A;  2JNV A;  1VEH A;  1TH5 A;  3UX3 A;  1WCJ A;  3CQ2 A;  3UX2 A;  3CQ1 A;  3CQ3 A;  3LNO A;  1XHJ A;  2CU6 A;  1UWD A; 
#chains in the Genus database with same CATH topology
 4D4I A;  5T8T A;  2PT7 G;  1P4E A;  1MXB A;  1XS3 A;  5K85 A;  2E8C A;  3TDE A;  3O2E A;  1LQL A;  4GXR A;  1TH5 A;  2NCL A;  5KEI A;  4PUG A;  1O9T A;  2P2F A;  1AMU A;  4DR5 C;  5AE2 A;  2P2M A;  3GR0 A;  2M5H A;  1HNX C;  3A26 A;  2UUA C;  2EGT A;  4I9G A;  2QVY X;  2QL8 A;  5CZV A;  2E8E A;  1HNW C;  2P02 A;  3CW9 A;  3ETO A;  5T8S A;  4TPS B;  5IT9 D;  2ATW A;  5A19 A;  1IBK C;  1N2F A;  4JI2 C;  1USP A;  1ULT A;  3FCE A;  4DCU A;  1NY8 A;  2YCB A;  2ONF A;  5GTD A;  2P2B A;  4FUQ A;  5LCI A;  4BBY A;  1MXC A;  1VEH A;  1M6X A;  3GPC A;  4K0K C;  4IZ6 A;  4RM2 A;  4GS5 A;  1N34 C;  2E0G A;  1USP B;  4JI3 C;  5BUR A;  2E5L C;  3IML A;  4FUT A;  2KDN A;  4AQY C;  4JI6 C;  3RG2 A;  4L2Z A;  4NDN A;  5DV9 A;  2JMP A;  1MDB A;  3TR3 A;  2QW0 X;  4ZLP A;  4PUH A;  3T1Y C;  2E7G A;  1O90 A;  4L4Q A;  1PG4 A;  4B3T C;  1IBL C;  1UWD A;  1I94 C;  1GPM A;  1V25 A;  1PG3 A;  1PU1 A;  1EGA A;  1NYE A;  1P4E C;  4D57 A;  3N2Q A;  2WP0 C;  1XRB A;  1K0R A;  2VQE C;  1L2F A;  4LF6 C;  2ZM6 C;  4NXM C;  5JRH A;  2CU6 A;  2ZZN A;  2AYA A;  4BC9 A;  5K8F A;  3CQ1 A;  1XMO C;  4DV0 C;  4XX2 A;  3SO4 A;  5BSR A;  2Z51 A;  4NXN C;  1O93 A;  1KKG A;  4I9F A;  4RMN A;  4X65 C;  2D1T A;  1M6X C;  2QVZ X;  4JI4 C;  4JYA C;  2D7V A;  3FCC A;  4DR1 C;  2WD9 A;  4RLQ A;  4WS9 A;  4PUI A;  4LF7 C;  3PRO C;  1XHJ A;  1MKY A;  5IFI A;  1HNZ C;  4X62 C;  1T5H X;  3DLP X;  4ZJZ A;  1RG9 A;  5CZX A;  2JNV A;  4DV7 C;  1WCJ A;  2V7B A;  3I08 A;  3NPD A;  3N54 B;  4EAT A;  2OBV A;  4JI7 C;  3LUS A;  4G1I A;  4JM1 A;  4DV3 C;  4DR4 C;  4BCA A;  4L7I A;  2VZE A;  3DAY A;  3UEB A;  5FLX D;  1PA4 A;  3T1H C;  3EER A;  5BST A;  3EQ6 A;  1ZB9 A;  1ZB8 A;  3CJE A;  1JOS A;  1N36 C;  4G37 A;  3B7W A;  2QVX X;  2Y4O A;  3DHV A;  2D27 A;  4GXQ A;  4JI8 C;  3TUF A;  2D1R A;  2KZF A;  4B3M C;  5LMU C;  1FUG A;  4LF4 C;  4JV5 C;  2E8F A;  4DCS A;  3TQI A;  4X64 C;  3NYQ A;  3LNO A;  4MTN A;  4WV3 A;  3LGX A;  4DV2 C;  1BA3 A;  3VNR A;  4LE5 A;  5BSU A;  1HR0 C;  4ODJ A;  2ZZM A;  2D1Q A;  5H9U A;  5ADZ A;  1J5E C;  4PRO C;  5BSM A;  3L8C A;  3VNS A;  2MCQ A;  1FLO A;  5A1G A;  1XRA A;  1MXA A;  3IEU A;  1IB8 A;  1V60 A;  1XRC A;  2BH1 X;  2HHH C;  2XR1 A;  3CQ2 A;  5A2Q D;  3LAX A;  3S82 A;  2HJG A;  2P2Q A;  3VNQ A;  1N33 C;  2UXB C;  4YY3 C;  3OTO C;  3NYR A;  5IWA C;  3E7X A;  3RV2 A;  3J80 D;  2P2J A;  2Y27 A;  2YX1 A;  4B3S C;  4JI5 C;  3CQ3 A;  2UUB C;  4DUY C;  4LF9 C;  3K6R A;  4OYC A;  2YWC A;  2P20 A;  4U5Y D;  3GR1 A;  4G36 A;  3C5E A;  4YHH C;  2VSQ A;  2M5O A;  4RM3 A;  2F4V C;  4DV5 C;  1MD9 A;  3GKU A;  5A1I A;  1XNQ C;  4GKK C;  2PN2 A;  2OPL A;  4DV4 C;  2DYJ A;  3AY0 A;  1XNR C;  5BSV A;  3R9W A;  4R1M A;  4RLF A;  4DR2 C;  1VLA A;  3A25 A;  5BSW A;  4DV1 C;  2UUC C;  1LCI A;  1O92 A;  2UXC C;  1WF3 A;  3CW8 X;  3A4I A;  4ISB A;  1MDF A;  2OPL B;  2UU9 C;  1FJG C;  1QWI A;  2MM9 A;  4RVO A;  4PHT A;  2UXD C;  4FTF A;  4JI1 C;  4DV6 C;  3AF5 A;  3PES A;  4LFB C;  2PRO A;  2DHM A;  4LFA C;  1RY2 A;  5BR8 C;  4IR7 A;  4DR7 C;  2KZ0 A;  2Y4N A;  3LNV A;  1V26 A;  3E7W A;  1XMQ C;  1T5D X;  4R1L A;  4B3R C;  4LFC C;  1YJ7 A;  3J81 D;  2BJO A;  4NOZ A;  3R9X A;  5E7Q A;  1IBM C;  3I07 A;  1P7L A;  3ETC A;  1N32 C;  4JI0 C;  3UOW A;  2MMA B;  1WH9 A;  2YWB A;  3UZ0 A;  3L95 X;  4OX9 C;  2D1S A;  3JAM D;  4LF5 C;  4OXI A;  2VQF C;  2ASB A;  4LF8 C;  3NI2 A;  3PBK A;  4X66 C;  4D4G A;  4D56 A;  3KXW A;  4DG9 A;  3R44 A;  1ML8 A;  3G7S A;  3A9V A;  3IEV A;  4DG8 A;  2CY1 A;  5KYT A;  4DCT A;  4DR3 C;  3A9U A;  3UX3 A;  5AE1 A;  3AF6 A;  4BSZ A;  4PZP A;  4KTT A;  2DPL A;  3UX2 A;  1HH2 P;  3IPL A;  4K0B A;  4DUZ C;  4HPV A;  4DCV A;  4BC7 A;  3H2T A;  2D28 C;  4GKJ C;  4KTV A;  2CXC A;  5AE3 A;  1UKK A;  5BUQ A;  4DR6 C;  4R0M A;  5BUS A;  4KHP C;  4MH4 A;  1QM4 A;  5KYV A;  4RVN A;  2OO4 A;  5LMN C; 
#chains in the Genus database with same CATH homology
 2M5O A;  2M5H A;  2Z51 A;  2JNV A;  1VEH A;  1TH5 A;  3UX3 A;  1WCJ A;  3CQ2 A;  3UX2 A;  3CQ1 A;  3CQ3 A;  3LNO A;  1XHJ A;  2CU6 A;  1UWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...