2JMPA

Structure for the n-terminus of chromosomal replication initiation protein dnaa from m. genitalium
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
b'MEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRDTLYQNSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosomal replication initiator protein dnaA
publication title NMR structure of the N-terminal domain of the replication initiator protein DnaA.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Dna binding protein
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2jmpA01
2VQEC 2UXBC 1EGAA 1XMOC 4LFCC 2UUAC 4DR2C 4JV5C 4XX2A 1JOSA 4DV5C 3AF5A 2YCBA 4JI2C 4KHPC 2E8FA 4AQYC 1IBKC 5FLXD 2BJOA 2UUBC 2UUCC 1XNRC 4DV1C 4LF5C 4LF7C 4OX9C 4LFBC 2ASBA 4JI3C 1ZB8A 1VLAA 1KKGA 1LQLA 4DR7C 2UXCC 2UU9C 4DV4C 4JI6C 4LF4C 1ZB9A 4DR1C 3AF6A 3IEVA 2DYJA 4GKJC 3JAMD 2OPLA 5IWAC 1WH9A 2JMPA 2ONFA 4DUZC 2XR1A 5LMNC 3R9WA 3T1HC 1J5EC 1HR0C 4DV6C 4DR3C 1N36C 4JI4C 5BR8C 1FJGC 4DCVA 4JI1C 3GKUA 1I94C 1USPA 1ML8A 4X66C 2E5LC 4K0KC 4DCTA 4X62C 2QL8A 4X65C 1PA4A 1WF3A 1N2FA 1IBLC 5IT9D 4LF6C 4B3MC 4BSZA 2E8CA 1XNQC 4X64C 1UKKA 3I07A 2ZM6C 2F4VC 1HNWC 4DCUA 4DR6C 4DCSA 4DUYC 1L2FA 4NXMC 2OPLB 3T1YC 1MKYA 4DR4C 1N32C 4MTNA 2E7GA 4YHHC 1QWIA 4DV2C 3EERA 2CY1A 3LUSA 3CJEA 4DR5C 5LMUC 2UXDC 4GKKC 4DV0C 1HH2P 4MH4A 4JI5C 2ATWA 4DV7C 3IEUA 1N34C 4LFAC 1N33C 1HNZC 1USPB 2HHHC 1K0RA 3OTOC 4LF8C 4B3TC 1IBMC 5A2QD 2HJGA 3R9XA 3J80D 4JYAC 2E8EA 4DV3C 2D7VA 4JI7C 4LF9C 2EGTA 2KZFA 2VQFC 4JI0C 2PT7G 2PN2A 1XMQC 2CXCA 1HNXC 4YY3C 4JI8C 3J81D 4B3SC 1NYEA 4B3RC 4NOZA 4NXNC
chains in the Genus database with same CATH superfamily
2VQEC 5AE3A 1XMOC 2YWBA 3CW8X 4XX2A 4JI2C 2E8FA 3LGXA 2BJOA 1MXBA 3H2TA 4DV1C 2P2JA 4LF7C 2M5OA 4IZ6A 4OX9C 2DPLA 4RMNA 2UXCC 1RG9A 2OO4A 3UEBA 1ZB9A 3IEVA 2DYJA 2V7BA 5AE2A 2JMPA 3LAXA 1J5EC 1HR0C 2D1TA 5BSUA 1FJGC 4GS5A 4JI1C 2P2BA 1I94C 1USPA 3C5EA 4G36A 3UX2A 4HPVA 1LCIA 4DCTA 4L7IA 2VSQA 4X65C 3E7WA 4LF6C 2E8CA 4X64C 3K6RA 2ZM6C 2YX1A 3A9UA 4DR6C 4DUYC 1WCJA 1L2FA 1MKYA 1N32C 1QWIA 4DV2C 4DR5C 5A1IA 3DAYA 4PUGA 4GKKC 3I08A 1HH2P 3IEUA 1N34C 3TQIA 4BBYA 2D1RA 3NPDA 1HNZC 2Z51A 1K0RA 3GR1A 1XRAA 5T8TA 3J80D 3O2EA 4DV3C 3FCEA 4LF9C 3GR0A 3A9VA 1P4EA 2KZFA 2VQFC 4JI0C 1FLOA 1V60A 1VEHA 1HNXC 4YY3C 4D4IA 4I9FA 4RLFA 4NOZA 3DLPX 1NY8A 4DR2C 3AF5A 5CZVA 5IFIA 2P2FA 4OYCA 5E7QA 4AQYC 3AY0A 4LF5C 1MD9A 3VNSA 2D1QA 4DV4C 2UU9C 1XRCA 4DR1C 3AF6A 4GKJC 1MXAA 2KDNA 4EATA 3JAMD 5IWAC 5K8FA 4NDNA 2ONFA 2XR1A 2D27A 3T1HC 1XHJA 4PZPA 5CZXA 1N36C 5BR8C 5ADZA 4DCVA 1M6XC 3GKUA 4ODJA 3UX3A 4X66C 4TPSB 2MCQA 1T5HX 1IBLC 4KTTA 5IT9D 1XNQC 4BC7A 1HNWC 1PU1A 5H9UA 1MDBA 1O93A 2OPLB 4R1MA 3VNQA 3EERA 3LUSA 3A26A 3L8CA 2UXDC 4MH4A 3VNRA 2MM9A 1N33C 2HHHC 5BSMA 2WD9A 4PUHA 3A25A 4B3TC 1IBMC 4D56A 4JYAC 5BSTA 2PROA 2JNVA 1P7LA 3DHVA 4RVNA 1XMQC 2QVXX 3N2QA 4JI8C 4B3SC 1GPMA 1UWDA 1YJ7A 1EGAA 4LFCC 2MMAB 2ZZMA 1JOSA 4KHPC 4K0BA 1IBKC 3CW9A 5FLXD 2VZEA 2WP0C 4LFBC 4JI3C 1VLAA 1KKGA 1LQLA 3E7XA 5KYVA 4DG9A 1WH9A 4LE5A 1P4EC 3R9WA 5LMNC 3ETCA 4DV6C 4DR3C 3NI2A 4RVOA 1O90A 4I9GA 4PUIA 2E5LC 3LNVA 4K0KC 4X62C 2D28C 2QL8A 2P20A 3EQ6A 5BSWA 3UZ0A 5KYTA 3B7WA 4U5YD 1PA4A 3LNOA 1WF3A 1N2FA 5A19A 5T8SA 4KTVA 4B3MC 4BSZA 3I07A 4PROC 3TR3A 1FUGA 4ZLPA 1MDFA 1BA3A 3T1YC 4DR4C 4MTNA 2E7GA 4YHHC 1T5DX 4IR7A 5K85A 2YWCA 1O92A 2D1SA 4LFAC 1MXCA 4D57A 3RG2A 1USPB 3OTOC 2CU6A 2ZZNA 5LCIA 5A2QD 2QW0X 4FUTA 4G1IA 2E8EA 3SO4A 1AMUA 2EGTA 4BC9A 1IB8A 2QVZX 3G7SA 1XRBA 2CXCA 4BCAA 3TDEA 2OBVA 1NYEA 3CQ2A 5DV9A 4OXIA 5BURA 2UXBC 1TH5A 2Y4NA 2UUAC 4JV5C 4DV5C 3R44A 2YCBA 3L95X 1PG3A 2Y27A 2UUBC 2UUCC 1XNRC 4FTFA 4L4QA 2ASBA 5BUSA 1XS3A 1ZB8A 4DR7C 2M5HA 4LF4C 2P02A 3ETOA 4ISBA 4GXQA 1O9TA 2OPLA 3CQ1A 5BSRA 2BH1X 4WS9A 2KZ0A 4DUZC 4RLQA 3TUFA 4PHTA 4JI4C 5JRHA 3GPCA 1ULTA 5BSVA 2P2QA 2P2MA 4ZJZA 1ML8A 4R1LA 4RM3A 2NCLA 4D4GA 4JM1A 3A4IA 3RV2A 2F4VC 1UKKA 3PESA 4DCUA 4DCSA 3UOWA 3FCCA 4NXMC 4RM2A 4DG8A 3CQ3A 4R0MA 4FUQA 5GTDA 2E0GA 2CY1A 3S82A 3CJEA 5LMUC 1PG4A 2AYAA 4DV0C 3N54B 4JI5C 2ATWA 4DV7C 4GXRA 4LF8C 3PROC 3NYRA 2HJGA 4WV3A 5AE1A 3R9XA 1RY2A 1V25A 2Y4OA 1QM4A 4L2ZA 2D7VA 2QVYX 4JI7C 5BUQA 3PBKA 4G37A 2PT7G 2PN2A 3IMLA 3IPLA 3KXWA 1M6XA 2DHMA 3J81D 1V26A 5A1GA 4B3RC 3NYQA 4JI6C 4NXNC 5KEIA
chains in the Genus database with same CATH topology
2VQEC 5AE3A 1XMOC 2YWBA 3CW8X 4XX2A 4JI2C 2E8FA 3LGXA 2BJOA 1MXBA 3H2TA 4DV1C 2P2JA 4LF7C 4IZ6A 4OX9C 2DPLA 4RMNA 2UXCC 1RG9A 2OO4A 1ZB9A 3IEVA 2DYJA 2V7BA 5AE2A 2JMPA 3LAXA 1J5EC 1HR0C 2D1TA 5BSUA 1FJGC 4GS5A 4JI1C 2P2BA 1I94C 1USPA 3C5EA 4G36A 4HPVA 1LCIA 4DCTA 4L7IA 2VSQA 4X65C 3E7WA 4LF6C 2E8CA 4X64C 2ZM6C 3A9UA 4DR6C 4DUYC 1L2FA 1MKYA 1N32C 1QWIA 4DV2C 4DR5C 5A1IA 3DAYA 4GKKC 3I08A 1HH2P 3IEUA 1N34C 3TQIA 4BBYA 2D1RA 3NPDA 1HNZC 1K0RA 3GR1A 1XRAA 5T8TA 3J80D 4DV3C 3FCEA 4LF9C 3GR0A 3A9VA 2KZFA 2VQFC 4JI0C 1HNXC 4YY3C 4D4IA 4I9FA 4RLFA 4NOZA 3DLPX 4DR2C 3AF5A 5CZVA 5IFIA 2P2FA 4OYCA 5E7QA 4AQYC 4LF5C 1MD9A 3VNSA 2D1QA 4DV4C 2UU9C 1XRCA 4DR1C 3AF6A 4GKJC 1MXAA 4EATA 3JAMD 5IWAC 5K8FA 4NDNA 2ONFA 2XR1A 2D27A 3T1HC 4PZPA 5CZXA 1N36C 5BR8C 5ADZA 4DCVA 3GKUA 4ODJA 4X66C 4TPSB 1T5HX 1IBLC 4KTTA 5IT9D 1XNQC 4BC7A 1HNWC 5H9UA 1MDBA 1O93A 2OPLB 4R1MA 3VNQA 3EERA 3LUSA 3L8CA 2UXDC 4MH4A 3VNRA 1N33C 2HHHC 5BSMA 2WD9A 4B3TC 1IBMC 4D56A 4JYAC 5BSTA 2PROA 1P7LA 3DHVA 4RVNA 1XMQC 2QVXX 3N2QA 4JI8C 4B3SC 1GPMA 1YJ7A 1EGAA 4LFCC 1JOSA 4KHPC 4K0BA 1IBKC 3CW9A 5FLXD 2VZEA 2WP0C 4LFBC 4JI3C 1VLAA 1KKGA 1LQLA 3E7XA 5KYVA 4DG9A 1WH9A 4LE5A 3R9WA 5LMNC 3ETCA 4DV6C 4DR3C 3NI2A 4RVOA 1O90A 4I9GA 2E5LC 3LNVA 4K0KC 4X62C 2D28C 2QL8A 2P20A 3EQ6A 5BSWA 3UZ0A 5KYTA 3B7WA 4U5YD 1PA4A 5T8SA 1WF3A 1N2FA 5A19A 4KTVA 4B3MC 4BSZA 3I07A 4PROC 1FUGA 4ZLPA 1MDFA 1BA3A 3T1YC 4DR4C 4MTNA 2E7GA 4YHHC 1T5DX 4IR7A 5K85A 2YWCA 1O92A 2D1SA 4LFAC 1MXCA 4D57A 3RG2A 1USPB 3OTOC 5A2QD 2QW0X 4FUTA 4G1IA 2E8EA 3SO4A 1AMUA 2EGTA 4BC9A 2QVZX 3G7SA 1XRBA 2CXCA 4BCAA 3TDEA 2OBVA 1NYEA 5DV9A 4OXIA 5BURA 2UXBC 2Y4NA 2UUAC 4JV5C 4DV5C 3R44A 2YCBA 3L95X 1PG3A 2Y27A 2UUBC 2UUCC 1XNRC 4FTFA 4L4QA 2ASBA 5BUSA 1ZB8A 4DR7C 4LF4C 2P02A 3ETOA 4ISBA 4GXQA 1O9TA 2OPLA 5BSRA 2BH1X 4WS9A 4DUZC 4RLQA 3TUFA 4PHTA 4JI4C 5JRHA 3GPCA 1ULTA 5BSVA 2P2QA 2P2MA 4ZJZA 1ML8A 4R1LA 4RM3A 4D4GA 4JM1A 3A4IA 3RV2A 2F4VC 1UKKA 3PESA 4DCUA 4DCSA 3UOWA 3FCCA 4NXMC 4RM2A 4DG8A 4R0MA 4FUQA 5GTDA 2E0GA 2CY1A 3S82A 3CJEA 5LMUC 1PG4A 2AYAA 4DV0C 3N54B 4JI5C 2ATWA 4DV7C 4GXRA 4LF8C 3PROC 3NYRA 2HJGA 4WV3A 5AE1A 3R9XA 1RY2A 1V25A 2Y4OA 1QM4A 4L2ZA 2D7VA 2QVYX 4JI7C 5BUQA 3PBKA 4G37A 2PT7G 2PN2A 3IMLA 3IPLA 3KXWA 3J81D 1V26A 5A1GA 4B3RC 3NYQA 4JI6C 4NXNC 5KEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE C;  2UXB C;  1EGA A;  1XMO C;  4LFC C;  2UUA C;  4DR2 C;  4JV5 C;  4XX2 A;  1JOS A;  4DV5 C;  3AF5 A;  2YCB A;  4JI2 C;  4KHP C;  2E8F A;  4AQY C;  1IBK C;  5FLX D;  2BJO A;  2UUB C;  2UUC C;  1XNR C;  4DV1 C;  4LF5 C;  4LF7 C;  4OX9 C;  4LFB C;  2ASB A;  4JI3 C;  1ZB8 A;  1VLA A;  1KKG A;  1LQL A;  4DR7 C;  2UXC C;  2UU9 C;  4DV4 C;  4JI6 C;  4LF4 C;  1ZB9 A;  4DR1 C;  3AF6 A;  3IEV A;  2DYJ A;  4GKJ C;  3JAM D;  2OPL A;  5IWA C;  1WH9 A;  2JMP A;  2ONF A;  4DUZ C;  2XR1 A;  5LMN C;  3R9W A;  3T1H C;  1J5E C;  1HR0 C;  4DV6 C;  4DR3 C;  1N36 C;  4JI4 C;  5BR8 C;  1FJG C;  4DCV A;  4JI1 C;  3GKU A;  1I94 C;  1USP A;  1ML8 A;  4X66 C;  2E5L C;  4K0K C;  4DCT A;  4X62 C;  2QL8 A;  4X65 C;  1PA4 A;  1WF3 A;  1N2F A;  1IBL C;  5IT9 D;  4LF6 C;  4B3M C;  4BSZ A;  2E8C A;  1XNQ C;  4X64 C;  1UKK A;  3I07 A;  2ZM6 C;  2F4V C;  1HNW C;  4DCU A;  4DR6 C;  4DCS A;  4DUY C;  1L2F A;  4NXM C;  2OPL B;  3T1Y C;  1MKY A;  4DR4 C;  1N32 C;  4MTN A;  2E7G A;  4YHH C;  1QWI A;  4DV2 C;  3EER A;  2CY1 A;  3LUS A;  3CJE A;  4DR5 C;  5LMU C;  2UXD C;  4GKK C;  4DV0 C;  1HH2 P;  4MH4 A;  4JI5 C;  2ATW A;  4DV7 C;  3IEU A;  1N34 C;  4LFA C;  1N33 C;  1HNZ C;  1USP B;  2HHH C;  1K0R A;  3OTO C;  4LF8 C;  4B3T C;  1IBM C;  5A2Q D;  2HJG A;  3R9X A;  3J80 D;  4JYA C;  2E8E A;  4DV3 C;  2D7V A;  4JI7 C;  4LF9 C;  2EGT A;  2KZF A;  2VQF C;  4JI0 C;  2PT7 G;  2PN2 A;  1XMQ C;  2CXC A;  1HNX C;  4YY3 C;  4JI8 C;  3J81 D;  4B3S C;  1NYE A;  4B3R C;  4NOZ A;  4NXN C; 
#chains in the Genus database with same CATH topology
 2VQE C;  5AE3 A;  1XMO C;  2YWB A;  3CW8 X;  4XX2 A;  4JI2 C;  2E8F A;  3LGX A;  2BJO A;  1MXB A;  3H2T A;  4DV1 C;  2P2J A;  4LF7 C;  2M5O A;  4IZ6 A;  4OX9 C;  2DPL A;  4RMN A;  2UXC C;  1RG9 A;  2OO4 A;  3UEB A;  1ZB9 A;  3IEV A;  2DYJ A;  2V7B A;  5AE2 A;  2JMP A;  3LAX A;  1J5E C;  1HR0 C;  2D1T A;  5BSU A;  1FJG C;  4GS5 A;  4JI1 C;  2P2B A;  1I94 C;  1USP A;  3C5E A;  4G36 A;  3UX2 A;  4HPV A;  1LCI A;  4DCT A;  4L7I A;  2VSQ A;  4X65 C;  3E7W A;  4LF6 C;  2E8C A;  4X64 C;  3K6R A;  2ZM6 C;  2YX1 A;  3A9U A;  4DR6 C;  4DUY C;  1WCJ A;  1L2F A;  1MKY A;  1N32 C;  1QWI A;  4DV2 C;  4DR5 C;  5A1I A;  3DAY A;  4PUG A;  4GKK C;  3I08 A;  1HH2 P;  3IEU A;  1N34 C;  3TQI A;  4BBY A;  2D1R A;  3NPD A;  1HNZ C;  2Z51 A;  1K0R A;  3GR1 A;  1XRA A;  5T8T A;  3J80 D;  3O2E A;  4DV3 C;  3FCE A;  4LF9 C;  3GR0 A;  3A9V A;  1P4E A;  2KZF A;  2VQF C;  4JI0 C;  1FLO A;  1V60 A;  1VEH A;  1HNX C;  4YY3 C;  4D4I A;  4I9F A;  4RLF A;  4NOZ A;  3DLP X;  1NY8 A;  4DR2 C;  3AF5 A;  5CZV A;  5IFI A;  2P2F A;  4OYC A;  5E7Q A;  4AQY C;  3AY0 A;  4LF5 C;  1MD9 A;  3VNS A;  2D1Q A;  4DV4 C;  2UU9 C;  1XRC A;  4DR1 C;  3AF6 A;  4GKJ C;  1MXA A;  2KDN A;  4EAT A;  3JAM D;  5IWA C;  5K8F A;  4NDN A;  2ONF A;  2XR1 A;  2D27 A;  3T1H C;  1XHJ A;  4PZP A;  5CZX A;  1N36 C;  5BR8 C;  5ADZ A;  4DCV A;  1M6X C;  3GKU A;  4ODJ A;  3UX3 A;  4X66 C;  4TPS B;  2MCQ A;  1T5H X;  1IBL C;  4KTT A;  5IT9 D;  1XNQ C;  4BC7 A;  1HNW C;  1PU1 A;  5H9U A;  1MDB A;  1O93 A;  2OPL B;  4R1M A;  3VNQ A;  3EER A;  3LUS A;  3A26 A;  3L8C A;  2UXD C;  4MH4 A;  3VNR A;  2MM9 A;  1N33 C;  2HHH C;  5BSM A;  2WD9 A;  4PUH A;  3A25 A;  4B3T C;  1IBM C;  4D56 A;  4JYA C;  5BST A;  2PRO A;  2JNV A;  1P7L A;  3DHV A;  4RVN A;  1XMQ C;  2QVX X;  3N2Q A;  4JI8 C;  4B3S C;  1GPM A;  1UWD A;  1YJ7 A;  1EGA A;  4LFC C;  2MMA B;  2ZZM A;  1JOS A;  4KHP C;  4K0B A;  1IBK C;  3CW9 A;  5FLX D;  2VZE A;  2WP0 C;  4LFB C;  4JI3 C;  1VLA A;  1KKG A;  1LQL A;  3E7X A;  5KYV A;  4DG9 A;  1WH9 A;  4LE5 A;  1P4E C;  3R9W A;  5LMN C;  3ETC A;  4DV6 C;  4DR3 C;  3NI2 A;  4RVO A;  1O90 A;  4I9G A;  4PUI A;  2E5L C;  3LNV A;  4K0K C;  4X62 C;  2D28 C;  2QL8 A;  2P20 A;  3EQ6 A;  5BSW A;  3UZ0 A;  5KYT A;  3B7W A;  4U5Y D;  1PA4 A;  3LNO A;  1WF3 A;  1N2F A;  5A19 A;  5T8S A;  4KTV A;  4B3M C;  4BSZ A;  3I07 A;  4PRO C;  3TR3 A;  1FUG A;  4ZLP A;  1MDF A;  1BA3 A;  3T1Y C;  4DR4 C;  4MTN A;  2E7G A;  4YHH C;  1T5D X;  4IR7 A;  5K85 A;  2YWC A;  1O92 A;  2D1S A;  4LFA C;  1MXC A;  4D57 A;  3RG2 A;  1USP B;  3OTO C;  2CU6 A;  2ZZN A;  5LCI A;  5A2Q D;  2QW0 X;  4FUT A;  4G1I A;  2E8E A;  3SO4 A;  1AMU A;  2EGT A;  4BC9 A;  1IB8 A;  2QVZ X;  3G7S A;  1XRB A;  2CXC A;  4BCA A;  3TDE A;  2OBV A;  1NYE A;  3CQ2 A;  5DV9 A;  4OXI A;  5BUR A;  2UXB C;  1TH5 A;  2Y4N A;  2UUA C;  4JV5 C;  4DV5 C;  3R44 A;  2YCB A;  3L95 X;  1PG3 A;  2Y27 A;  2UUB C;  2UUC C;  1XNR C;  4FTF A;  4L4Q A;  2ASB A;  5BUS A;  1XS3 A;  1ZB8 A;  4DR7 C;  2M5H A;  4LF4 C;  2P02 A;  3ETO A;  4ISB A;  4GXQ A;  1O9T A;  2OPL A;  3CQ1 A;  5BSR A;  2BH1 X;  4WS9 A;  2KZ0 A;  4DUZ C;  4RLQ A;  3TUF A;  4PHT A;  4JI4 C;  5JRH A;  3GPC A;  1ULT A;  5BSV A;  2P2Q A;  2P2M A;  4ZJZ A;  1ML8 A;  4R1L A;  4RM3 A;  2NCL A;  4D4G A;  4JM1 A;  3A4I A;  3RV2 A;  2F4V C;  1UKK A;  3PES A;  4DCU A;  4DCS A;  3UOW A;  3FCC A;  4NXM C;  4RM2 A;  4DG8 A;  3CQ3 A;  4R0M A;  4FUQ A;  5GTD A;  2E0G A;  2CY1 A;  3S82 A;  3CJE A;  5LMU C;  1PG4 A;  2AYA A;  4DV0 C;  3N54 B;  4JI5 C;  2ATW A;  4DV7 C;  4GXR A;  4LF8 C;  3PRO C;  3NYR A;  2HJG A;  4WV3 A;  5AE1 A;  3R9X A;  1RY2 A;  1V25 A;  2Y4O A;  1QM4 A;  4L2Z A;  2D7V A;  2QVY X;  4JI7 C;  5BUQ A;  3PBK A;  4G37 A;  2PT7 G;  2PN2 A;  3IML A;  3IPL A;  3KXW A;  1M6X A;  2DHM A;  3J81 D;  1V26 A;  5A1G A;  4B3R C;  3NYQ A;  4JI6 C;  4NXN C;  5KEI A; 
#chains in the Genus database with same CATH homology
 2VQE C;  5AE3 A;  1XMO C;  2YWB A;  3CW8 X;  4XX2 A;  4JI2 C;  2E8F A;  3LGX A;  2BJO A;  1MXB A;  3H2T A;  4DV1 C;  2P2J A;  4LF7 C;  4IZ6 A;  4OX9 C;  2DPL A;  4RMN A;  2UXC C;  1RG9 A;  2OO4 A;  1ZB9 A;  3IEV A;  2DYJ A;  2V7B A;  5AE2 A;  2JMP A;  3LAX A;  1J5E C;  1HR0 C;  2D1T A;  5BSU A;  1FJG C;  4GS5 A;  4JI1 C;  2P2B A;  1I94 C;  1USP A;  3C5E A;  4G36 A;  4HPV A;  1LCI A;  4DCT A;  4L7I A;  2VSQ A;  4X65 C;  3E7W A;  4LF6 C;  2E8C A;  4X64 C;  2ZM6 C;  3A9U A;  4DR6 C;  4DUY C;  1L2F A;  1MKY A;  1N32 C;  1QWI A;  4DV2 C;  4DR5 C;  5A1I A;  3DAY A;  4GKK C;  3I08 A;  1HH2 P;  3IEU A;  1N34 C;  3TQI A;  4BBY A;  2D1R A;  3NPD A;  1HNZ C;  1K0R A;  3GR1 A;  1XRA A;  5T8T A;  3J80 D;  4DV3 C;  3FCE A;  4LF9 C;  3GR0 A;  3A9V A;  2KZF A;  2VQF C;  4JI0 C;  1HNX C;  4YY3 C;  4D4I A;  4I9F A;  4RLF A;  4NOZ A;  3DLP X;  4DR2 C;  3AF5 A;  5CZV A;  5IFI A;  2P2F A;  4OYC A;  5E7Q A;  4AQY C;  4LF5 C;  1MD9 A;  3VNS A;  2D1Q A;  4DV4 C;  2UU9 C;  1XRC A;  4DR1 C;  3AF6 A;  4GKJ C;  1MXA A;  4EAT A;  3JAM D;  5IWA C;  5K8F A;  4NDN A;  2ONF A;  2XR1 A;  2D27 A;  3T1H C;  4PZP A;  5CZX A;  1N36 C;  5BR8 C;  5ADZ A;  4DCV A;  3GKU A;  4ODJ A;  4X66 C;  4TPS B;  1T5H X;  1IBL C;  4KTT A;  5IT9 D;  1XNQ C;  4BC7 A;  1HNW C;  5H9U A;  1MDB A;  1O93 A;  2OPL B;  4R1M A;  3VNQ A;  3EER A;  3LUS A;  3L8C A;  2UXD C;  4MH4 A;  3VNR A;  1N33 C;  2HHH C;  5BSM A;  2WD9 A;  4B3T C;  1IBM C;  4D56 A;  4JYA C;  5BST A;  2PRO A;  1P7L A;  3DHV A;  4RVN A;  1XMQ C;  2QVX X;  3N2Q A;  4JI8 C;  4B3S C;  1GPM A;  1YJ7 A;  1EGA A;  4LFC C;  1JOS A;  4KHP C;  4K0B A;  1IBK C;  3CW9 A;  5FLX D;  2VZE A;  2WP0 C;  4LFB C;  4JI3 C;  1VLA A;  1KKG A;  1LQL A;  3E7X A;  5KYV A;  4DG9 A;  1WH9 A;  4LE5 A;  3R9W A;  5LMN C;  3ETC A;  4DV6 C;  4DR3 C;  3NI2 A;  4RVO A;  1O90 A;  4I9G A;  2E5L C;  3LNV A;  4K0K C;  4X62 C;  2D28 C;  2QL8 A;  2P20 A;  3EQ6 A;  5BSW A;  3UZ0 A;  5KYT A;  3B7W A;  4U5Y D;  1PA4 A;  5T8S A;  1WF3 A;  1N2F A;  5A19 A;  4KTV A;  4B3M C;  4BSZ A;  3I07 A;  4PRO C;  1FUG A;  4ZLP A;  1MDF A;  1BA3 A;  3T1Y C;  4DR4 C;  4MTN A;  2E7G A;  4YHH C;  1T5D X;  4IR7 A;  5K85 A;  2YWC A;  1O92 A;  2D1S A;  4LFA C;  1MXC A;  4D57 A;  3RG2 A;  1USP B;  3OTO C;  5A2Q D;  2QW0 X;  4FUT A;  4G1I A;  2E8E A;  3SO4 A;  1AMU A;  2EGT A;  4BC9 A;  2QVZ X;  3G7S A;  1XRB A;  2CXC A;  4BCA A;  3TDE A;  2OBV A;  1NYE A;  5DV9 A;  4OXI A;  5BUR A;  2UXB C;  2Y4N A;  2UUA C;  4JV5 C;  4DV5 C;  3R44 A;  2YCB A;  3L95 X;  1PG3 A;  2Y27 A;  2UUB C;  2UUC C;  1XNR C;  4FTF A;  4L4Q A;  2ASB A;  5BUS A;  1ZB8 A;  4DR7 C;  4LF4 C;  2P02 A;  3ETO A;  4ISB A;  4GXQ A;  1O9T A;  2OPL A;  5BSR A;  2BH1 X;  4WS9 A;  4DUZ C;  4RLQ A;  3TUF A;  4PHT A;  4JI4 C;  5JRH A;  3GPC A;  1ULT A;  5BSV A;  2P2Q A;  2P2M A;  4ZJZ A;  1ML8 A;  4R1L A;  4RM3 A;  4D4G A;  4JM1 A;  3A4I A;  3RV2 A;  2F4V C;  1UKK A;  3PES A;  4DCU A;  4DCS A;  3UOW A;  3FCC A;  4NXM C;  4RM2 A;  4DG8 A;  4R0M A;  4FUQ A;  5GTD A;  2E0G A;  2CY1 A;  3S82 A;  3CJE A;  5LMU C;  1PG4 A;  2AYA A;  4DV0 C;  3N54 B;  4JI5 C;  2ATW A;  4DV7 C;  4GXR A;  4LF8 C;  3PRO C;  3NYR A;  2HJG A;  4WV3 A;  5AE1 A;  3R9X A;  1RY2 A;  1V25 A;  2Y4O A;  1QM4 A;  4L2Z A;  2D7V A;  2QVY X;  4JI7 C;  5BUQ A;  3PBK A;  4G37 A;  2PT7 G;  2PN2 A;  3IML A;  3IPL A;  3KXW A;  3J81 D;  1V26 A;  5A1G A;  4B3R C;  3NYQ A;  4JI6 C;  4NXN C;  5KEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...