2JMPA

Structure for the n-terminus of chromosomal replication initiation protein dnaa from m. genitalium
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
MEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRDTLYQNSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the N-terminal domain of the replication initiator protein DnaA.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Dna binding protein
molecule keywords Chromosomal replication initiator protein dnaA
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2jmpA01
4LFBC 4DUZC 4DR4C 1XNRC 1K0RA 4JI6C 1FJGC 4GKKC 2UXDC 2PN2A 2XR1A 4OX9C 1LQLA 2DYJA 1WF3A 2BJOA 4DR6C 2UXBC 1UKKA 2UUCC 4DCSA 2HJGA 4NOZA 4JI7C 4B3SC 4DV1C 4DV4C 2E8CA 4LF9C 4DV7C 1IBLC 4LFAC 4DCVA 1QWIA 4LF6C 4DR7C 2OPLB 1N33C 1VLAA 4JI3C 2QL8A 3AF6A 4X65C 1IBKC 1J5EC 2UUAC 1IBMC 4MTNA 4DR1C 4BSZA 1HR0C 4JI4C 4DV2C 4JV5C 5LMUC 5IWAC 1HNWC 4X62C 1L2FA 3J80D 2OPLA 4JYAC 1MKYA 3LUSA 2EGTA 3CJEA 1XMQC 1N36C 4LF8C 2JMPA 2CXCA 2E8EA 4JI1C 2F4VC 1USPB 2KZFA 3IEUA 1JOSA 4DR3C 1ML8A 1ZB9A 2E8FA 3I07A 5LMNC 1NYEA 4DCUA 2E7GA 1XNQC 4XX2A 2UXCC 3R9WA 4NXNC 4JI2C 4B3TC 1PA4A 2ONFA 1EGAA 2UU9C 3GKUA 1HNZC 4K0KC 2YCBA 4DV0C 4JI0C 4LF7C 1HNXC 5FLXD 4AQYC 3OTOC 2D7VA 4JI8C 4DR2C 4GKJC 4DV6C 2CY1A 2ATWA 4NXMC 1I94C 1WH9A 3R9XA 3J81D 3EERA 5A2QD 4LFCC 4B3RC 5BR8C 5IT9D 3T1HC 4MH4A 1N34C 4DUYC 4X64C 3T1YC 4YY3C 1HH2P 1N2FA 2ZM6C 4JI5C 3JAMD 3IEVA 1USPA 1N32C 4KHPC 1XMOC 4DCTA 2HHHC 2PT7G 4DV3C 2VQEC 4LF4C 4DR5C 2E5LC 4LF5C 2VQFC 4YHHC 3AF5A 2ASBA 2UUBC 1KKGA 4DV5C 1ZB8A 4X66C 4B3MC
chains in the Genus database with same CATH superfamily
4LFBC 5GTDA 3CW9A 4JI6C 2UXDC 1MXBA 2CU6A 1WF3A 2BJOA 1T5HX 1T5DX 4BC9A 3L95X 1MXAA 4DV7C 1IBLC 4DCVA 1N33C 4LF6C 2OPLB 3KXWA 3SO4A 3DLPX 3H2TA 5BSRA 4PUHA 2QL8A 4JI3C 2WP0C 4RM3A 1VEHA 2Z51A 3AY0A 4JV5C 3NI2A 2OPLA 1V60A 2AYAA 3DAYA 3G7SA 3A9VA 3A4IA 2KZ0A 4PHTA 1XRAA 2QVYX 4JI1C 5AE2A 1RG9A 2M5HA 4OYCA 1JOSA 2Y4NA 2E8FA 5KEIA 1XNQC 3VNQA 4XX2A 1M6XA 4JI2C 4B3TC 2ONFA 2MM9A 3NPDA 1XRBA 2UU9C 4HPVA 4D57A 1O92A 2P2JA 4U5YD 4FTFA 1BA3A 4L4QA 4RMNA 4ODJA 5BURA 4NXMC 2ATWA 4RVNA 3DHVA 4K0BA 4ISBA 4LFCC 4WV3A 4B3RC 2P2FA 4OXIA 4MH4A 3PBKA 1HH2P 5A1IA 3JAMD 3RV2A 2PT7G 5K8FA 5BUQA 1V25A 3NYQA 1ZB8A 3L8CA 1XNRC 5DV9A 5A19A 2XR1A 1LQLA 4FUQA 1LCIA 3A26A 1UKKA 2MCQA 4DCSA 4DV1C 4DV4C 4G1IA 2YX1A 4LF9C 4LFAC 5E7QA 1P4EC 1FLOA 3VNSA 1IBKC 3TQIA 1IBMC 3I08A 2QW0X 4BSZA 1HR0C 3NYRA 4FUTA 4PUIA 4JI4C 4G36A 4DV2C 3GR1A 5BSWA 4WS9A 1XRCA 4EATA 1MKYA 3LUSA 4KTVA 3S82A 1N36C 4LF8C 5KYTA 3E7XA 3PROC 1ULTA 3B7WA 4D4GA 3RG2A 3IEUA 4IR7A 2DHMA 4DR3C 2DPLA 2D27A 3K6RA 1ML8A 2M5OA 2JNVA 5A1GA 1NYEA 3VNRA 2E0GA 2E7GA 4DCUA 2UXCC 2P2MA 3R9WA 3FCCA 4PUGA 1PA4A 2PROA 2P02A 4RVOA 1EGAA 3CQ3A 3LGXA 4DG9A 1HNZC 5LCIA 2YCBA 5IFIA 4LF7C 3UX2A 5JRHA 5FLXD 3ETCA 3R9XA 3J81D 3CQ1A 3T1HC 1UWDA 1N34C 3IMLA 4X64C 4YY3C 4L7IA 3IPLA 2P2BA 1XMOC 2Y4OA 4KTTA 3R44A 4DV3C 2VQEC 4LF4C 4LF5C 2VQFC 4GS5A 2KDNA 4X66C 2VSQA 4DUZC 4IZ6A 5BSVA 1K0RA 4ZLPA 3FCEA 2PN2A 4NDNA 4DG8A 1RY2A 2DYJA 2VZEA 3O2EA 1TH5A 5BUSA 3TUFA 2UXBC 2UUCC 4PZPA 1O90A 2P2QA 1PU1A 2QVXX 4JI7C 2E8CA 4R0MA 1VLAA 5T8SA 4RM2A 3E7WA 4G37A 2UUAC 4MTNA 4I9GA 1MXCA 5AE1A 5LMUC 2WD9A 5CZVA 1HNWC 4RLFA 5K85A 1L2FA 2MMAB 4JYAC 1XMQC 3LNOA 2OO4A 2CXCA 5BSMA 2E8EA 3N54B 1MDBA 2KZFA 1QM4A 5ADZA 4JM1A 1XS3A 1ZB9A 2YWCA 3CW8X 3LNVA 2QVZX 4NXNC 2D28C 1FUGA 3GKUA 4L2ZA 4K0KC 2D1RA 4JI0C 4BBYA 3OTOC 2D7VA 4GKJC 2D1SA 4DV6C 2CY1A 1I94C 1WH9A 5IT9D 4I9FA 1N2FA 2ZM6C 1USPA 3UEBA 3PESA 3N2QA 4KHPC 2V7BA 4DCTA 2HHHC 4R1LA 2Y27A 2BH1X 3A25A 4YHHC 3AF5A 2ASBA 4DV5C 4R1MA 4B3MC 4DR4C 1FJGC 4GKKC 1PG3A 3TDEA 4OX9C 2NCLA 3TR3A 5T8TA 1GPMA 1PG4A 4LE5A 4DR6C 4BC7A 2D1TA 2HJGA 4NOZA 4B3SC 1QWIA 4DR7C 4RLQA 5CZXA 1YJ7A 3AF6A 4X65C 1J5EC 1V26A 3C5EA 4DR1C 1O9TA 4GXQA 4D56A 5IWAC 4X62C 3J80D 2EGTA 3A9UA 3CJEA 5KYVA 1O93A 1M6XC 2JMPA 2D1QA 3ETOA 2F4VC 4D4IA 1USPB 3GR0A 3GPCA 4TPSB 4BCAA 5H9UA 4ZJZA 3CQ2A 4PROC 1IB8A 3I07A 5LMNC 3LAXA 1AMUA 1P7LA 1NY8A 2P20A 4DV0C 2YWBA 1HNXC 5AE3A 1P4EA 4AQYC 4JI8C 4DR2C 5BSTA 2ZZMA 3UZ0A 3EQ6A 3EERA 5A2QD 1WCJA 5BR8C 4GXRA 2ZZNA 4DUYC 3T1YC 4JI5C 3IEVA 2OBVA 1N32C 1MD9A 3UOWA 1XHJA 4DR5C 2E5LC 3UX3A 5BSUA 1MDFA 2UUBC 1KKGA
chains in the Genus database with same CATH topology
4LFBC 5GTDA 3CW9A 4JI6C 2UXDC 1MXBA 1WF3A 2BJOA 1T5HX 1T5DX 4BC9A 3L95X 1MXAA 4DV7C 1IBLC 4DCVA 1N33C 4LF6C 2OPLB 3KXWA 3SO4A 3DLPX 3H2TA 5BSRA 2QL8A 4JI3C 2WP0C 4RM3A 4JV5C 3NI2A 2OPLA 2AYAA 3DAYA 3G7SA 3A9VA 3A4IA 4PHTA 1XRAA 2QVYX 4JI1C 5AE2A 1RG9A 4OYCA 1JOSA 2Y4NA 2E8FA 5KEIA 1XNQC 3VNQA 4XX2A 4JI2C 4B3TC 2ONFA 3NPDA 1XRBA 2UU9C 4HPVA 1O92A 4D57A 2P2JA 4U5YD 4FTFA 1BA3A 4L4QA 4RMNA 4ODJA 5BURA 4NXMC 2ATWA 4RVNA 3DHVA 4K0BA 4ISBA 4LFCC 4WV3A 4B3RC 2P2FA 4OXIA 4MH4A 3PBKA 1HH2P 5A1IA 3JAMD 3RV2A 2PT7G 5K8FA 5BUQA 1V25A 3NYQA 1ZB8A 3L8CA 1XNRC 5DV9A 5A19A 2XR1A 1LQLA 4FUQA 1LCIA 1UKKA 4DCSA 4DV1C 4DV4C 4G1IA 4LF9C 4LFAC 5E7QA 3VNSA 1IBKC 3TQIA 1IBMC 3I08A 2QW0X 4BSZA 1HR0C 3NYRA 4FUTA 4JI4C 4DV2C 4G36A 3GR1A 5BSWA 4WS9A 1XRCA 4EATA 1MKYA 3LUSA 4KTVA 3S82A 1N36C 4LF8C 5KYTA 3E7XA 3PROC 1ULTA 3B7WA 4D4GA 3RG2A 3IEUA 4IR7A 4DR3C 2DPLA 2D27A 1ML8A 5A1GA 1NYEA 3VNRA 2E0GA 2E7GA 4DCUA 2UXCC 2P2MA 3R9WA 3FCCA 1PA4A 2PROA 2P02A 4RVOA 1EGAA 3LGXA 4DG9A 1HNZC 2YCBA 5IFIA 4LF7C 5JRHA 5FLXD 3ETCA 3R9XA 3J81D 3T1HC 1N34C 3IMLA 4X64C 4YY3C 4L7IA 3IPLA 2P2BA 1XMOC 2Y4OA 4KTTA 3R44A 4DV3C 2VQEC 4LF4C 4LF5C 2VQFC 4GS5A 4X66C 2VSQA 4DUZC 4IZ6A 5BSVA 1K0RA 4ZLPA 3FCEA 2PN2A 4NDNA 4DG8A 1RY2A 2DYJA 2VZEA 5BUSA 3TUFA 2UXBC 2UUCC 4PZPA 1O90A 2P2QA 2QVXX 4JI7C 2E8CA 4R0MA 1VLAA 5T8SA 4RM2A 3E7WA 4G37A 2UUAC 4MTNA 4I9GA 1MXCA 5AE1A 5LMUC 2WD9A 5CZVA 1HNWC 4RLFA 5K85A 1L2FA 4JYAC 1XMQC 2OO4A 2CXCA 5BSMA 2E8EA 3N54B 1MDBA 2KZFA 1QM4A 5ADZA 4JM1A 1ZB9A 2YWCA 3CW8X 3LNVA 2QVZX 4NXNC 2D28C 1FUGA 3GKUA 4L2ZA 4K0KC 2D1RA 4JI0C 4BBYA 3OTOC 2D7VA 4GKJC 2D1SA 4DV6C 2CY1A 1I94C 1WH9A 5IT9D 4I9FA 1N2FA 2ZM6C 1USPA 3PESA 3N2QA 4KHPC 2V7BA 4DCTA 2HHHC 4R1LA 2Y27A 2BH1X 4YHHC 3AF5A 2ASBA 4DV5C 4R1MA 4B3MC 4DR4C 1FJGC 4GKKC 1PG3A 3TDEA 4OX9C 5T8TA 1GPMA 1PG4A 4LE5A 4DR6C 4BC7A 2D1TA 2HJGA 4NOZA 4B3SC 1QWIA 4DR7C 4RLQA 5CZXA 1YJ7A 3AF6A 4X65C 1J5EC 1V26A 3C5EA 4DR1C 1O9TA 4GXQA 4D56A 5IWAC 4X62C 3J80D 2EGTA 3A9UA 3CJEA 5KYVA 1O93A 2JMPA 2D1QA 3ETOA 2F4VC 4D4IA 1USPB 3GR0A 3GPCA 4TPSB 4BCAA 5H9UA 4ZJZA 4PROC 3I07A 5LMNC 3LAXA 1AMUA 1P7LA 2P20A 4DV0C 2YWBA 1HNXC 5AE3A 4AQYC 4JI8C 4DR2C 5BSTA 3UZ0A 3EQ6A 3EERA 5A2QD 5BR8C 4GXRA 4DUYC 3T1YC 4JI5C 3IEVA 2OBVA 1N32C 1MD9A 3UOWA 4DR5C 2E5LC 5BSUA 1MDFA 2UUBC 1KKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB C;  4DUZ C;  4DR4 C;  1XNR C;  1K0R A;  4JI6 C;  1FJG C;  4GKK C;  2UXD C;  2PN2 A;  2XR1 A;  4OX9 C;  1LQL A;  2DYJ A;  1WF3 A;  2BJO A;  4DR6 C;  2UXB C;  1UKK A;  2UUC C;  4DCS A;  2HJG A;  4NOZ A;  4JI7 C;  4B3S C;  4DV1 C;  4DV4 C;  2E8C A;  4LF9 C;  4DV7 C;  1IBL C;  4LFA C;  4DCV A;  1QWI A;  4LF6 C;  4DR7 C;  2OPL B;  1N33 C;  1VLA A;  4JI3 C;  2QL8 A;  3AF6 A;  4X65 C;  1IBK C;  1J5E C;  2UUA C;  1IBM C;  4MTN A;  4DR1 C;  4BSZ A;  1HR0 C;  4JI4 C;  4DV2 C;  4JV5 C;  5LMU C;  5IWA C;  1HNW C;  4X62 C;  1L2F A;  3J80 D;  2OPL A;  4JYA C;  1MKY A;  3LUS A;  2EGT A;  3CJE A;  1XMQ C;  1N36 C;  4LF8 C;  2JMP A;  2CXC A;  2E8E A;  4JI1 C;  2F4V C;  1USP B;  2KZF A;  3IEU A;  1JOS A;  4DR3 C;  1ML8 A;  1ZB9 A;  2E8F A;  3I07 A;  5LMN C;  1NYE A;  4DCU A;  2E7G A;  1XNQ C;  4XX2 A;  2UXC C;  3R9W A;  4NXN C;  4JI2 C;  4B3T C;  1PA4 A;  2ONF A;  1EGA A;  2UU9 C;  3GKU A;  1HNZ C;  4K0K C;  2YCB A;  4DV0 C;  4JI0 C;  4LF7 C;  1HNX C;  5FLX D;  4AQY C;  3OTO C;  2D7V A;  4JI8 C;  4DR2 C;  4GKJ C;  4DV6 C;  2CY1 A;  2ATW A;  4NXM C;  1I94 C;  1WH9 A;  3R9X A;  3J81 D;  3EER A;  5A2Q D;  4LFC C;  4B3R C;  5BR8 C;  5IT9 D;  3T1H C;  4MH4 A;  1N34 C;  4DUY C;  4X64 C;  3T1Y C;  4YY3 C;  1HH2 P;  1N2F A;  2ZM6 C;  4JI5 C;  3JAM D;  3IEV A;  1USP A;  1N32 C;  4KHP C;  1XMO C;  4DCT A;  2HHH C;  2PT7 G;  4DV3 C;  2VQE C;  4LF4 C;  4DR5 C;  2E5L C;  4LF5 C;  2VQF C;  4YHH C;  3AF5 A;  2ASB A;  2UUB C;  1KKG A;  4DV5 C;  1ZB8 A;  4X66 C;  4B3M C; 
#chains in the Genus database with same CATH topology
 4LFB C;  5GTD A;  3CW9 A;  4JI6 C;  2UXD C;  1MXB A;  2CU6 A;  1WF3 A;  2BJO A;  1T5H X;  1T5D X;  4BC9 A;  3L95 X;  1MXA A;  4DV7 C;  1IBL C;  4DCV A;  1N33 C;  4LF6 C;  2OPL B;  3KXW A;  3SO4 A;  3DLP X;  3H2T A;  5BSR A;  4PUH A;  2QL8 A;  4JI3 C;  2WP0 C;  4RM3 A;  1VEH A;  2Z51 A;  3AY0 A;  4JV5 C;  3NI2 A;  2OPL A;  1V60 A;  2AYA A;  3DAY A;  3G7S A;  3A9V A;  3A4I A;  2KZ0 A;  4PHT A;  1XRA A;  2QVY X;  4JI1 C;  5AE2 A;  1RG9 A;  2M5H A;  4OYC A;  1JOS A;  2Y4N A;  2E8F A;  5KEI A;  1XNQ C;  3VNQ A;  4XX2 A;  1M6X A;  4JI2 C;  4B3T C;  2ONF A;  2MM9 A;  3NPD A;  1XRB A;  2UU9 C;  4HPV A;  4D57 A;  1O92 A;  2P2J A;  4U5Y D;  4FTF A;  1BA3 A;  4L4Q A;  4RMN A;  4ODJ A;  5BUR A;  4NXM C;  2ATW A;  4RVN A;  3DHV A;  4K0B A;  4ISB A;  4LFC C;  4WV3 A;  4B3R C;  2P2F A;  4OXI A;  4MH4 A;  3PBK A;  1HH2 P;  5A1I A;  3JAM D;  3RV2 A;  2PT7 G;  5K8F A;  5BUQ A;  1V25 A;  3NYQ A;  1ZB8 A;  3L8C A;  1XNR C;  5DV9 A;  5A19 A;  2XR1 A;  1LQL A;  4FUQ A;  1LCI A;  3A26 A;  1UKK A;  2MCQ A;  4DCS A;  4DV1 C;  4DV4 C;  4G1I A;  2YX1 A;  4LF9 C;  4LFA C;  5E7Q A;  1P4E C;  1FLO A;  3VNS A;  1IBK C;  3TQI A;  1IBM C;  3I08 A;  2QW0 X;  4BSZ A;  1HR0 C;  3NYR A;  4FUT A;  4PUI A;  4JI4 C;  4G36 A;  4DV2 C;  3GR1 A;  5BSW A;  4WS9 A;  1XRC A;  4EAT A;  1MKY A;  3LUS A;  4KTV A;  3S82 A;  1N36 C;  4LF8 C;  5KYT A;  3E7X A;  3PRO C;  1ULT A;  3B7W A;  4D4G A;  3RG2 A;  3IEU A;  4IR7 A;  2DHM A;  4DR3 C;  2DPL A;  2D27 A;  3K6R A;  1ML8 A;  2M5O A;  2JNV A;  5A1G A;  1NYE A;  3VNR A;  2E0G A;  2E7G A;  4DCU A;  2UXC C;  2P2M A;  3R9W A;  3FCC A;  4PUG A;  1PA4 A;  2PRO A;  2P02 A;  4RVO A;  1EGA A;  3CQ3 A;  3LGX A;  4DG9 A;  1HNZ C;  5LCI A;  2YCB A;  5IFI A;  4LF7 C;  3UX2 A;  5JRH A;  5FLX D;  3ETC A;  3R9X A;  3J81 D;  3CQ1 A;  3T1H C;  1UWD A;  1N34 C;  3IML A;  4X64 C;  4YY3 C;  4L7I A;  3IPL A;  2P2B A;  1XMO C;  2Y4O A;  4KTT A;  3R44 A;  4DV3 C;  2VQE C;  4LF4 C;  4LF5 C;  2VQF C;  4GS5 A;  2KDN A;  4X66 C;  2VSQ A;  4DUZ C;  4IZ6 A;  5BSV A;  1K0R A;  4ZLP A;  3FCE A;  2PN2 A;  4NDN A;  4DG8 A;  1RY2 A;  2DYJ A;  2VZE A;  3O2E A;  1TH5 A;  5BUS A;  3TUF A;  2UXB C;  2UUC C;  4PZP A;  1O90 A;  2P2Q A;  1PU1 A;  2QVX X;  4JI7 C;  2E8C A;  4R0M A;  1VLA A;  5T8S A;  4RM2 A;  3E7W A;  4G37 A;  2UUA C;  4MTN A;  4I9G A;  1MXC A;  5AE1 A;  5LMU C;  2WD9 A;  5CZV A;  1HNW C;  4RLF A;  5K85 A;  1L2F A;  2MMA B;  4JYA C;  1XMQ C;  3LNO A;  2OO4 A;  2CXC A;  5BSM A;  2E8E A;  3N54 B;  1MDB A;  2KZF A;  1QM4 A;  5ADZ A;  4JM1 A;  1XS3 A;  1ZB9 A;  2YWC A;  3CW8 X;  3LNV A;  2QVZ X;  4NXN C;  2D28 C;  1FUG A;  3GKU A;  4L2Z A;  4K0K C;  2D1R A;  4JI0 C;  4BBY A;  3OTO C;  2D7V A;  4GKJ C;  2D1S A;  4DV6 C;  2CY1 A;  1I94 C;  1WH9 A;  5IT9 D;  4I9F A;  1N2F A;  2ZM6 C;  1USP A;  3UEB A;  3PES A;  3N2Q A;  4KHP C;  2V7B A;  4DCT A;  2HHH C;  4R1L A;  2Y27 A;  2BH1 X;  3A25 A;  4YHH C;  3AF5 A;  2ASB A;  4DV5 C;  4R1M A;  4B3M C;  4DR4 C;  1FJG C;  4GKK C;  1PG3 A;  3TDE A;  4OX9 C;  2NCL A;  3TR3 A;  5T8T A;  1GPM A;  1PG4 A;  4LE5 A;  4DR6 C;  4BC7 A;  2D1T A;  2HJG A;  4NOZ A;  4B3S C;  1QWI A;  4DR7 C;  4RLQ A;  5CZX A;  1YJ7 A;  3AF6 A;  4X65 C;  1J5E C;  1V26 A;  3C5E A;  4DR1 C;  1O9T A;  4GXQ A;  4D56 A;  5IWA C;  4X62 C;  3J80 D;  2EGT A;  3A9U A;  3CJE A;  5KYV A;  1O93 A;  1M6X C;  2JMP A;  2D1Q A;  3ETO A;  2F4V C;  4D4I A;  1USP B;  3GR0 A;  3GPC A;  4TPS B;  4BCA A;  5H9U A;  4ZJZ A;  3CQ2 A;  4PRO C;  1IB8 A;  3I07 A;  5LMN C;  3LAX A;  1AMU A;  1P7L A;  1NY8 A;  2P20 A;  4DV0 C;  2YWB A;  1HNX C;  5AE3 A;  1P4E A;  4AQY C;  4JI8 C;  4DR2 C;  5BST A;  2ZZM A;  3UZ0 A;  3EQ6 A;  3EER A;  5A2Q D;  1WCJ A;  5BR8 C;  4GXR A;  2ZZN A;  4DUY C;  3T1Y C;  4JI5 C;  3IEV A;  2OBV A;  1N32 C;  1MD9 A;  3UOW A;  1XHJ A;  4DR5 C;  2E5L C;  3UX3 A;  5BSU A;  1MDF A;  2UUB C;  1KKG A; 
#chains in the Genus database with same CATH homology
 4LFB C;  5GTD A;  3CW9 A;  4JI6 C;  2UXD C;  1MXB A;  1WF3 A;  2BJO A;  1T5H X;  1T5D X;  4BC9 A;  3L95 X;  1MXA A;  4DV7 C;  1IBL C;  4DCV A;  1N33 C;  4LF6 C;  2OPL B;  3KXW A;  3SO4 A;  3DLP X;  3H2T A;  5BSR A;  2QL8 A;  4JI3 C;  2WP0 C;  4RM3 A;  4JV5 C;  3NI2 A;  2OPL A;  2AYA A;  3DAY A;  3G7S A;  3A9V A;  3A4I A;  4PHT A;  1XRA A;  2QVY X;  4JI1 C;  5AE2 A;  1RG9 A;  4OYC A;  1JOS A;  2Y4N A;  2E8F A;  5KEI A;  1XNQ C;  3VNQ A;  4XX2 A;  4JI2 C;  4B3T C;  2ONF A;  3NPD A;  1XRB A;  2UU9 C;  4HPV A;  1O92 A;  4D57 A;  2P2J A;  4U5Y D;  4FTF A;  1BA3 A;  4L4Q A;  4RMN A;  4ODJ A;  5BUR A;  4NXM C;  2ATW A;  4RVN A;  3DHV A;  4K0B A;  4ISB A;  4LFC C;  4WV3 A;  4B3R C;  2P2F A;  4OXI A;  4MH4 A;  3PBK A;  1HH2 P;  5A1I A;  3JAM D;  3RV2 A;  2PT7 G;  5K8F A;  5BUQ A;  1V25 A;  3NYQ A;  1ZB8 A;  3L8C A;  1XNR C;  5DV9 A;  5A19 A;  2XR1 A;  1LQL A;  4FUQ A;  1LCI A;  1UKK A;  4DCS A;  4DV1 C;  4DV4 C;  4G1I A;  4LF9 C;  4LFA C;  5E7Q A;  3VNS A;  1IBK C;  3TQI A;  1IBM C;  3I08 A;  2QW0 X;  4BSZ A;  1HR0 C;  3NYR A;  4FUT A;  4JI4 C;  4DV2 C;  4G36 A;  3GR1 A;  5BSW A;  4WS9 A;  1XRC A;  4EAT A;  1MKY A;  3LUS A;  4KTV A;  3S82 A;  1N36 C;  4LF8 C;  5KYT A;  3E7X A;  3PRO C;  1ULT A;  3B7W A;  4D4G A;  3RG2 A;  3IEU A;  4IR7 A;  4DR3 C;  2DPL A;  2D27 A;  1ML8 A;  5A1G A;  1NYE A;  3VNR A;  2E0G A;  2E7G A;  4DCU A;  2UXC C;  2P2M A;  3R9W A;  3FCC A;  1PA4 A;  2PRO A;  2P02 A;  4RVO A;  1EGA A;  3LGX A;  4DG9 A;  1HNZ C;  2YCB A;  5IFI A;  4LF7 C;  5JRH A;  5FLX D;  3ETC A;  3R9X A;  3J81 D;  3T1H C;  1N34 C;  3IML A;  4X64 C;  4YY3 C;  4L7I A;  3IPL A;  2P2B A;  1XMO C;  2Y4O A;  4KTT A;  3R44 A;  4DV3 C;  2VQE C;  4LF4 C;  4LF5 C;  2VQF C;  4GS5 A;  4X66 C;  2VSQ A;  4DUZ C;  4IZ6 A;  5BSV A;  1K0R A;  4ZLP A;  3FCE A;  2PN2 A;  4NDN A;  4DG8 A;  1RY2 A;  2DYJ A;  2VZE A;  5BUS A;  3TUF A;  2UXB C;  2UUC C;  4PZP A;  1O90 A;  2P2Q A;  2QVX X;  4JI7 C;  2E8C A;  4R0M A;  1VLA A;  5T8S A;  4RM2 A;  3E7W A;  4G37 A;  2UUA C;  4MTN A;  4I9G A;  1MXC A;  5AE1 A;  5LMU C;  2WD9 A;  5CZV A;  1HNW C;  4RLF A;  5K85 A;  1L2F A;  4JYA C;  1XMQ C;  2OO4 A;  2CXC A;  5BSM A;  2E8E A;  3N54 B;  1MDB A;  2KZF A;  1QM4 A;  5ADZ A;  4JM1 A;  1ZB9 A;  2YWC A;  3CW8 X;  3LNV A;  2QVZ X;  4NXN C;  2D28 C;  1FUG A;  3GKU A;  4L2Z A;  4K0K C;  2D1R A;  4JI0 C;  4BBY A;  3OTO C;  2D7V A;  4GKJ C;  2D1S A;  4DV6 C;  2CY1 A;  1I94 C;  1WH9 A;  5IT9 D;  4I9F A;  1N2F A;  2ZM6 C;  1USP A;  3PES A;  3N2Q A;  4KHP C;  2V7B A;  4DCT A;  2HHH C;  4R1L A;  2Y27 A;  2BH1 X;  4YHH C;  3AF5 A;  2ASB A;  4DV5 C;  4R1M A;  4B3M C;  4DR4 C;  1FJG C;  4GKK C;  1PG3 A;  3TDE A;  4OX9 C;  5T8T A;  1GPM A;  1PG4 A;  4LE5 A;  4DR6 C;  4BC7 A;  2D1T A;  2HJG A;  4NOZ A;  4B3S C;  1QWI A;  4DR7 C;  4RLQ A;  5CZX A;  1YJ7 A;  3AF6 A;  4X65 C;  1J5E C;  1V26 A;  3C5E A;  4DR1 C;  1O9T A;  4GXQ A;  4D56 A;  5IWA C;  4X62 C;  3J80 D;  2EGT A;  3A9U A;  3CJE A;  5KYV A;  1O93 A;  2JMP A;  2D1Q A;  3ETO A;  2F4V C;  4D4I A;  1USP B;  3GR0 A;  3GPC A;  4TPS B;  4BCA A;  5H9U A;  4ZJZ A;  4PRO C;  3I07 A;  5LMN C;  3LAX A;  1AMU A;  1P7L A;  2P20 A;  4DV0 C;  2YWB A;  1HNX C;  5AE3 A;  4AQY C;  4JI8 C;  4DR2 C;  5BST A;  3UZ0 A;  3EQ6 A;  3EER A;  5A2Q D;  5BR8 C;  4GXR A;  4DUY C;  3T1Y C;  4JI5 C;  3IEV A;  2OBV A;  1N32 C;  1MD9 A;  3UOW A;  4DR5 C;  2E5L C;  5BSU A;  1MDF A;  2UUB C;  1KKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...