2JMPA

Structure for the n-terminus of chromosomal replication initiation protein dnaa from m. genitalium
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
MEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIHLAESLYEGIKSVNFVNEQDFFFNLAKLEENSRDTLYQNSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosomal replication initiator protein dnaA
publication title NMR structure of the N-terminal domain of the replication initiator protein DnaA.
pubmed doi rcsb
source organism Mycoplasma genitalium
molecule tags Dna binding protein
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2jmpA01
3OTOC 4DUYC 4JV5C 2JMPA 1HNWC 2PN2A 1WH9A 1N32C 2QL8A 2ATWA 2PT7G 3EERA 4LF9C 4JI1C 1HH2P 4LFBC 2HHHC 3I07A 4DV6C 1PA4A 5IT9D 2ASBA 1LQLA 4JI0C 4JYAC 1HR0C 4LF8C 4LF5C 1IBLC 4DV3C 1ML8A 4DR1C 4JI5C 3R9XA 1ZB8A 2OPLA 4DR2C 2UUBC 1MKYA 4DR7C 5FLXD 1N33C 4X66C 2UXCC 4DCSA 2UUAC 4MH4A 4X64C 1IBMC 1ZB9A 4LFCC 4OX9C 3T1HC 1XMOC 4DR5C 4GKJC 1NYEA 4JI4C 4DUZC 2YCBA 1XMQC 1HNXC 4DV0C 4DV2C 1USPA 5BR8C 2UXBC 4AQYC 4JI7C 3IEVA 1EGAA 1WF3A 4B3TC 3J81D 2CXCA 4LF7C 3GKUA 4YY3C 1I94C 2F4VC 4B3SC 2ONFA 2E7GA 2CY1A 4X65C 5LMUC 2UU9C 1XNQC 2BJOA 1KKGA 2UXDC 3AF6A 4DR4C 4DV1C 4KHPC 2DYJA 4DV5C 4LF6C 4JI3C 2E8CA 1VLAA 1L2FA 3JAMD 4YHHC 5A2QD 5IWAC 2EGTA 3R9WA 2E8EA 1IBKC 4JI6C 4XX2A 4GKKC 4BSZA 1XNRC 2D7VA 3LUSA 2UUCC 4DCVA 4LFAC 3T1YC 1N2FA 1N34C 1HNZC 4DCUA 2VQFC 1UKKA 3AF5A 1K0RA 1QWIA 2VQEC 2E5LC 4JI8C 4NXNC 2HJGA 4NOZA 1FJGC 4DCTA 4JI2C 1J5EC 2KZFA 4DV4C 4MTNA 3IEUA 1USPB 4DR6C 4K0KC 2ZM6C 2E8FA 4B3RC 1N36C 4B3MC 4DR3C 5LMNC 4DV7C 1JOSA 2OPLB 4NXMC 2XR1A 4LF4C 4X62C 3J80D 3CJEA
chains in the Genus database with same CATH superfamily
3TQIA 2OBVA 5BSWA 3OTOC 2JMPA 2PN2A 4RVOA 3N2QA 1WH9A 2PT7G 4RLFA 1O92A 2QW0X 3L95X 3FCCA 1HH2P 2M5OA 5IT9D 4JYAC 4LE5A 1ML8A 4DR1C 4OXIA 4RVNA 3CW8X 3LNVA 5KEIA 2OPLA 2VZEA 2UUBC 2UXCC 4PUGA 4RM3A 3NPDA 4MH4A 4GS5A 1V60A 2BH1X 4OX9C 1V25A 2CU6A 3TDEA 3A9UA 2P2FA 2YWBA 4GKJC 1NYEA 2VSQA 4PUIA 1XMQC 4HPVA 4RLQA 1EGAA 4B3TC 5BSTA 1YJ7A 2E0GA 3DHVA 2F4VC 4B3SC 5BUQA 2PROA 4I9FA 5LMUC 2UU9C 3G7SA 4K0BA 5CZVA 3A25A 2P20A 1TH5A 1RG9A 1IBKC 4JI6C 5GTDA 3PESA 2JNVA 3VNQA 2D1RA 1XNRC 1RY2A 4DCVA 1N34C 2MMAB 2VQFC 1QWIA 2VQEC 5K85A 4NXNC 2HJGA 5ADZA 1FJGC 1PG4A 2KZFA 1V26A 3NYQA 4DR6C 4K0KC 1N36C 2P2MA 4B3MC 4DV7C 5KYVA 4ODJA 1HR0C 2QVYX 3CJEA 3SO4A 4DUYC 4JM1A 3B7WA 1MXBA 5DV9A 4LF9C 4JI1C 5K8FA 1BA3A 3GPCA 1GPMA 3N54B 4DV6C 1PA4A 3RV2A 4GXQA 4JI0C 5E7QA 4BBYA 3VNRA 4RM2A 3L8CA 3R9XA 5H9UA 2AYAA 1MKYA 2OO4A 1O90A 4DR7C 5FLXD 3KXWA 4ZLPA 3VNSA 3EQ6A 1VEHA 5KYTA 1P4EA 4EATA 1MDFA 4R1LA 1WCJA 1USPA 3GR1A 3I08A 2P2QA 1MDBA 3UZ0A 4X65C 4G1IA 2UXDC 1UWDA 4DV1C 4KHPC 4RMNA 2ZZNA 1T5HX 3H2TA 2E8CA 1VLAA 3UX3A 2KDNA 4GKKC 3NYRA 5BURA 2KZ0A 4BSZA 2D7VA 5BSMA 4FTFA 2YWCA 3LUSA 4LFAC 1N2FA 2P2JA 4G37A 4DCTA 4FUQA 3PBKA 3IEUA 4IZ6A 3CQ2A 4TPSB 1XRCA 2Y4NA 4IR7A 4LF4C 4X62C 3UX2A 1ULTA 1NY8A 3S82A 4JV5C 1HNWC 3E7WA 3LNOA 1N32C 3IMLA 3UOWA 1O93A 3CQ3A 4D4IA 4PROC 1QM4A 1XRBA 4LFBC 2HHHC 3I07A 1O9TA 1P7LA 2ASBA 5BSRA 1LQLA 4LF8C 4LF5C 1IBLC 4DV3C 4JI5C 2NCLA 5LCIA 3CQ1A 1MD9A 4WS9A 1FUGA 3DLPX 4D4GA 1N33C 2UUAC 2M5HA 1P4EC 1XS3A 4LFCC 3T1HC 3DAYA 4DR5C 4NDNA 4JI4C 4DUZC 2YCBA 5CZXA 5A1GA 4DV0C 4FUTA 4DV2C 4ISBA 5JRHA 2Y27A 3TR3A 4BC9A 1T5DX 3IEVA 5IFIA 3AY0A 4U5YD 3J81D 3GKUA 4PZPA 4YY3C 1M6XA 5T8SA 5A1IA 2CY1A 3FCEA 4DR4C 2DYJA 2D1SA 2Z51A 4JI3C 4XX2A 4KTTA 4R1MA 2P2BA 2UUCC 2MM9A 3T1YC 1MXAA 1HNZC 4DCUA 1PG3A 3C5EA 1UKKA 3AF5A 1K0RA 2E5LC 3RG2A 2YX1A 4WV3A 4JI2C 4DV4C 4KTVA 2ZM6C 4B3RC 3CW9A 4D56A 2DHMA 4D57A 5LMNC 3LAXA 4NXMC 2XR1A 2P02A 3TUFA 4PUHA 3IPLA 4ZJZA 5A19A 3NI2A 2QL8A 2ATWA 3EERA 2D28C 1XRAA 4L4QA 3K6RA 4I9GA 5BUSA 2MCQA 2DPLA 4BC7A 4GXRA 3UEBA 1LCIA 1FLOA 1ZB8A 4DG8A 4DR2C 2D1TA 4DG9A 2D27A 4X66C 4DCSA 2QVXX 4R0MA 4X64C 1IBMC 1ZB9A 1XMOC 4PHTA 4OYCA 1M6XC 1HNXC 2WP0C 3GR0A 5BR8C 2UXBC 4AQYC 4JI7C 1MXCA 1WF3A 1AMUA 4LF7C 2CXCA 2V7BA 5BSVA 1I94C 2QVZX 1XHJA 3LGXA 2ONFA 3A4IA 2E7GA 3E7XA 2BJOA 1XNQC 2WD9A 1KKGA 3AF6A 3PROC 4DV5C 4LF6C 1L2FA 3JAMD 4YHHC 5T8TA 5A2QD 5IWAC 2ZZMA 2EGTA 3R9WA 2E8EA 4L7IA 1PU1A 4G36A 4L2ZA 3ETOA 3O2EA 5AE2A 5BSUA 3A26A 5AE3A 4BCAA 2D1QA 4JI8C 4NOZA 1IB8A 1J5EC 3R44A 4MTNA 1USPB 2E8FA 4DR3C 3A9VA 3ETCA 1JOSA 2OPLB 2Y4OA 5AE1A 3J80D
chains in the Genus database with same CATH topology
3TQIA 2OBVA 5BSWA 3OTOC 2JMPA 2PN2A 4RVOA 3N2QA 1WH9A 2PT7G 4RLFA 1O92A 2QW0X 3L95X 3FCCA 1HH2P 5IT9D 4JYAC 4LE5A 1ML8A 4DR1C 4OXIA 4RVNA 3CW8X 3LNVA 5KEIA 2OPLA 2VZEA 2UUBC 2UXCC 4RM3A 3NPDA 4MH4A 4GS5A 2BH1X 4OX9C 1V25A 3TDEA 3A9UA 2P2FA 2YWBA 4GKJC 1NYEA 2VSQA 1XMQC 4HPVA 4RLQA 1EGAA 4B3TC 5BSTA 1YJ7A 2E0GA 3DHVA 2F4VC 4B3SC 5BUQA 2PROA 4I9FA 5LMUC 2UU9C 3G7SA 4K0BA 5CZVA 2P20A 1RG9A 1IBKC 4JI6C 5GTDA 3PESA 3VNQA 2D1RA 1XNRC 1RY2A 4DCVA 1N34C 2VQFC 1QWIA 2VQEC 5K85A 4NXNC 2HJGA 5ADZA 1FJGC 1PG4A 2KZFA 1V26A 3NYQA 4DR6C 4K0KC 1N36C 2P2MA 4B3MC 4DV7C 5KYVA 4ODJA 1HR0C 2QVYX 3CJEA 3SO4A 4DUYC 4JM1A 3B7WA 1MXBA 5DV9A 4LF9C 4JI1C 5K8FA 1BA3A 3GPCA 1GPMA 3N54B 4DV6C 1PA4A 3RV2A 4GXQA 4JI0C 5E7QA 4BBYA 3VNRA 4RM2A 3L8CA 3R9XA 5H9UA 2AYAA 1MKYA 2OO4A 1O90A 4DR7C 5FLXD 3KXWA 4ZLPA 3VNSA 3EQ6A 5KYTA 4EATA 1MDFA 4R1LA 1USPA 3GR1A 3I08A 2P2QA 1MDBA 3UZ0A 4X65C 4G1IA 2UXDC 4DV1C 4KHPC 4RMNA 1T5HX 3H2TA 2E8CA 1VLAA 4GKKC 3NYRA 5BURA 4BSZA 2D7VA 5BSMA 4FTFA 2YWCA 3LUSA 4LFAC 1N2FA 2P2JA 4G37A 4DCTA 4FUQA 3PBKA 3IEUA 4IZ6A 4TPSB 1XRCA 2Y4NA 4IR7A 4LF4C 4X62C 1ULTA 3S82A 4JV5C 1HNWC 3E7WA 1N32C 3IMLA 3UOWA 1O93A 4D4IA 4PROC 1QM4A 1XRBA 4LFBC 2HHHC 3I07A 1O9TA 1P7LA 2ASBA 5BSRA 1LQLA 4LF8C 4LF5C 1IBLC 4DV3C 4JI5C 1MD9A 4WS9A 1FUGA 3DLPX 4D4GA 1N33C 2UUAC 4LFCC 3T1HC 3DAYA 4DR5C 4NDNA 4JI4C 4DUZC 2YCBA 5CZXA 5A1GA 4DV0C 4FUTA 4DV2C 4ISBA 5JRHA 2Y27A 4BC9A 1T5DX 3IEVA 5IFIA 4U5YD 3J81D 3GKUA 4PZPA 4YY3C 5T8SA 5A1IA 2CY1A 3FCEA 4DR4C 2DYJA 2D1SA 4JI3C 4XX2A 4KTTA 4R1MA 2P2BA 2UUCC 3T1YC 1MXAA 1HNZC 4DCUA 1PG3A 3C5EA 1UKKA 3AF5A 1K0RA 2E5LC 3RG2A 4WV3A 4JI2C 4DV4C 4KTVA 2ZM6C 4B3RC 3CW9A 4D56A 4D57A 5LMNC 3LAXA 4NXMC 2XR1A 2P02A 3TUFA 4ZJZA 3IPLA 5A19A 3NI2A 2QL8A 2ATWA 3EERA 2D28C 1XRAA 4L4QA 4I9GA 5BUSA 2DPLA 4BC7A 4GXRA 1LCIA 1ZB8A 4DG8A 4DR2C 2D1TA 4DG9A 2D27A 4X66C 4DCSA 2QVXX 4R0MA 4X64C 1IBMC 1ZB9A 1XMOC 4PHTA 4OYCA 1HNXC 2WP0C 3GR0A 5BR8C 2UXBC 4AQYC 4JI7C 1MXCA 1WF3A 1AMUA 4LF7C 2CXCA 2V7BA 5BSVA 1I94C 2QVZX 3LGXA 2ONFA 3A4IA 2E7GA 3E7XA 2BJOA 1XNQC 2WD9A 1KKGA 3AF6A 3PROC 4DV5C 4LF6C 1L2FA 3JAMD 4YHHC 5T8TA 5A2QD 5IWAC 2EGTA 3R9WA 2E8EA 4L7IA 4G36A 4L2ZA 3ETOA 5BSUA 5AE2A 5AE3A 4BCAA 2D1QA 4JI8C 4NOZA 1J5EC 3R44A 4MTNA 1USPB 2E8FA 4DR3C 3A9VA 3ETCA 1JOSA 2OPLB 2Y4OA 5AE1A 3J80D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO C;  4DUY C;  4JV5 C;  2JMP A;  1HNW C;  2PN2 A;  1WH9 A;  1N32 C;  2QL8 A;  2ATW A;  2PT7 G;  3EER A;  4LF9 C;  4JI1 C;  1HH2 P;  4LFB C;  2HHH C;  3I07 A;  4DV6 C;  1PA4 A;  5IT9 D;  2ASB A;  1LQL A;  4JI0 C;  4JYA C;  1HR0 C;  4LF8 C;  4LF5 C;  1IBL C;  4DV3 C;  1ML8 A;  4DR1 C;  4JI5 C;  3R9X A;  1ZB8 A;  2OPL A;  4DR2 C;  2UUB C;  1MKY A;  4DR7 C;  5FLX D;  1N33 C;  4X66 C;  2UXC C;  4DCS A;  2UUA C;  4MH4 A;  4X64 C;  1IBM C;  1ZB9 A;  4LFC C;  4OX9 C;  3T1H C;  1XMO C;  4DR5 C;  4GKJ C;  1NYE A;  4JI4 C;  4DUZ C;  2YCB A;  1XMQ C;  1HNX C;  4DV0 C;  4DV2 C;  1USP A;  5BR8 C;  2UXB C;  4AQY C;  4JI7 C;  3IEV A;  1EGA A;  1WF3 A;  4B3T C;  3J81 D;  2CXC A;  4LF7 C;  3GKU A;  4YY3 C;  1I94 C;  2F4V C;  4B3S C;  2ONF A;  2E7G A;  2CY1 A;  4X65 C;  5LMU C;  2UU9 C;  1XNQ C;  2BJO A;  1KKG A;  2UXD C;  3AF6 A;  4DR4 C;  4DV1 C;  4KHP C;  2DYJ A;  4DV5 C;  4LF6 C;  4JI3 C;  2E8C A;  1VLA A;  1L2F A;  3JAM D;  4YHH C;  5A2Q D;  5IWA C;  2EGT A;  3R9W A;  2E8E A;  1IBK C;  4JI6 C;  4XX2 A;  4GKK C;  4BSZ A;  1XNR C;  2D7V A;  3LUS A;  2UUC C;  4DCV A;  4LFA C;  3T1Y C;  1N2F A;  1N34 C;  1HNZ C;  4DCU A;  2VQF C;  1UKK A;  3AF5 A;  1K0R A;  1QWI A;  2VQE C;  2E5L C;  4JI8 C;  4NXN C;  2HJG A;  4NOZ A;  1FJG C;  4DCT A;  4JI2 C;  1J5E C;  2KZF A;  4DV4 C;  4MTN A;  3IEU A;  1USP B;  4DR6 C;  4K0K C;  2ZM6 C;  2E8F A;  4B3R C;  1N36 C;  4B3M C;  4DR3 C;  5LMN C;  4DV7 C;  1JOS A;  2OPL B;  4NXM C;  2XR1 A;  4LF4 C;  4X62 C;  3J80 D;  3CJE A; 
#chains in the Genus database with same CATH topology
 3TQI A;  2OBV A;  5BSW A;  3OTO C;  2JMP A;  2PN2 A;  4RVO A;  3N2Q A;  1WH9 A;  2PT7 G;  4RLF A;  1O92 A;  2QW0 X;  3L95 X;  3FCC A;  1HH2 P;  2M5O A;  5IT9 D;  4JYA C;  4LE5 A;  1ML8 A;  4DR1 C;  4OXI A;  4RVN A;  3CW8 X;  3LNV A;  5KEI A;  2OPL A;  2VZE A;  2UUB C;  2UXC C;  4PUG A;  4RM3 A;  3NPD A;  4MH4 A;  4GS5 A;  1V60 A;  2BH1 X;  4OX9 C;  1V25 A;  2CU6 A;  3TDE A;  3A9U A;  2P2F A;  2YWB A;  4GKJ C;  1NYE A;  2VSQ A;  4PUI A;  1XMQ C;  4HPV A;  4RLQ A;  1EGA A;  4B3T C;  5BST A;  1YJ7 A;  2E0G A;  3DHV A;  2F4V C;  4B3S C;  5BUQ A;  2PRO A;  4I9F A;  5LMU C;  2UU9 C;  3G7S A;  4K0B A;  5CZV A;  3A25 A;  2P20 A;  1TH5 A;  1RG9 A;  1IBK C;  4JI6 C;  5GTD A;  3PES A;  2JNV A;  3VNQ A;  2D1R A;  1XNR C;  1RY2 A;  4DCV A;  1N34 C;  2MMA B;  2VQF C;  1QWI A;  2VQE C;  5K85 A;  4NXN C;  2HJG A;  5ADZ A;  1FJG C;  1PG4 A;  2KZF A;  1V26 A;  3NYQ A;  4DR6 C;  4K0K C;  1N36 C;  2P2M A;  4B3M C;  4DV7 C;  5KYV A;  4ODJ A;  1HR0 C;  2QVY X;  3CJE A;  3SO4 A;  4DUY C;  4JM1 A;  3B7W A;  1MXB A;  5DV9 A;  4LF9 C;  4JI1 C;  5K8F A;  1BA3 A;  3GPC A;  1GPM A;  3N54 B;  4DV6 C;  1PA4 A;  3RV2 A;  4GXQ A;  4JI0 C;  5E7Q A;  4BBY A;  3VNR A;  4RM2 A;  3L8C A;  3R9X A;  5H9U A;  2AYA A;  1MKY A;  2OO4 A;  1O90 A;  4DR7 C;  5FLX D;  3KXW A;  4ZLP A;  3VNS A;  3EQ6 A;  1VEH A;  5KYT A;  1P4E A;  4EAT A;  1MDF A;  4R1L A;  1WCJ A;  1USP A;  3GR1 A;  3I08 A;  2P2Q A;  1MDB A;  3UZ0 A;  4X65 C;  4G1I A;  2UXD C;  1UWD A;  4DV1 C;  4KHP C;  4RMN A;  2ZZN A;  1T5H X;  3H2T A;  2E8C A;  1VLA A;  3UX3 A;  2KDN A;  4GKK C;  3NYR A;  5BUR A;  2KZ0 A;  4BSZ A;  2D7V A;  5BSM A;  4FTF A;  2YWC A;  3LUS A;  4LFA C;  1N2F A;  2P2J A;  4G37 A;  4DCT A;  4FUQ A;  3PBK A;  3IEU A;  4IZ6 A;  3CQ2 A;  4TPS B;  1XRC A;  2Y4N A;  4IR7 A;  4LF4 C;  4X62 C;  3UX2 A;  1ULT A;  1NY8 A;  3S82 A;  4JV5 C;  1HNW C;  3E7W A;  3LNO A;  1N32 C;  3IML A;  3UOW A;  1O93 A;  3CQ3 A;  4D4I A;  4PRO C;  1QM4 A;  1XRB A;  4LFB C;  2HHH C;  3I07 A;  1O9T A;  1P7L A;  2ASB A;  5BSR A;  1LQL A;  4LF8 C;  4LF5 C;  1IBL C;  4DV3 C;  4JI5 C;  2NCL A;  5LCI A;  3CQ1 A;  1MD9 A;  4WS9 A;  1FUG A;  3DLP X;  4D4G A;  1N33 C;  2UUA C;  2M5H A;  1P4E C;  1XS3 A;  4LFC C;  3T1H C;  3DAY A;  4DR5 C;  4NDN A;  4JI4 C;  4DUZ C;  2YCB A;  5CZX A;  5A1G A;  4DV0 C;  4FUT A;  4DV2 C;  4ISB A;  5JRH A;  2Y27 A;  3TR3 A;  4BC9 A;  1T5D X;  3IEV A;  5IFI A;  3AY0 A;  4U5Y D;  3J81 D;  3GKU A;  4PZP A;  4YY3 C;  1M6X A;  5T8S A;  5A1I A;  2CY1 A;  3FCE A;  4DR4 C;  2DYJ A;  2D1S A;  2Z51 A;  4JI3 C;  4XX2 A;  4KTT A;  4R1M A;  2P2B A;  2UUC C;  2MM9 A;  3T1Y C;  1MXA A;  1HNZ C;  4DCU A;  1PG3 A;  3C5E A;  1UKK A;  3AF5 A;  1K0R A;  2E5L C;  3RG2 A;  2YX1 A;  4WV3 A;  4JI2 C;  4DV4 C;  4KTV A;  2ZM6 C;  4B3R C;  3CW9 A;  4D56 A;  2DHM A;  4D57 A;  5LMN C;  3LAX A;  4NXM C;  2XR1 A;  2P02 A;  3TUF A;  4PUH A;  3IPL A;  4ZJZ A;  5A19 A;  3NI2 A;  2QL8 A;  2ATW A;  3EER A;  2D28 C;  1XRA A;  4L4Q A;  3K6R A;  4I9G A;  5BUS A;  2MCQ A;  2DPL A;  4BC7 A;  4GXR A;  3UEB A;  1LCI A;  1FLO A;  1ZB8 A;  4DG8 A;  4DR2 C;  2D1T A;  4DG9 A;  2D27 A;  4X66 C;  4DCS A;  2QVX X;  4R0M A;  4X64 C;  1IBM C;  1ZB9 A;  1XMO C;  4PHT A;  4OYC A;  1M6X C;  1HNX C;  2WP0 C;  3GR0 A;  5BR8 C;  2UXB C;  4AQY C;  4JI7 C;  1MXC A;  1WF3 A;  1AMU A;  4LF7 C;  2CXC A;  2V7B A;  5BSV A;  1I94 C;  2QVZ X;  1XHJ A;  3LGX A;  2ONF A;  3A4I A;  2E7G A;  3E7X A;  2BJO A;  1XNQ C;  2WD9 A;  1KKG A;  3AF6 A;  3PRO C;  4DV5 C;  4LF6 C;  1L2F A;  3JAM D;  4YHH C;  5T8T A;  5A2Q D;  5IWA C;  2ZZM A;  2EGT A;  3R9W A;  2E8E A;  4L7I A;  1PU1 A;  4G36 A;  4L2Z A;  3ETO A;  3O2E A;  5AE2 A;  5BSU A;  3A26 A;  5AE3 A;  4BCA A;  2D1Q A;  4JI8 C;  4NOZ A;  1IB8 A;  1J5E C;  3R44 A;  4MTN A;  1USP B;  2E8F A;  4DR3 C;  3A9V A;  3ETC A;  1JOS A;  2OPL B;  2Y4O A;  5AE1 A;  3J80 D; 
#chains in the Genus database with same CATH homology
 3TQI A;  2OBV A;  5BSW A;  3OTO C;  2JMP A;  2PN2 A;  4RVO A;  3N2Q A;  1WH9 A;  2PT7 G;  4RLF A;  1O92 A;  2QW0 X;  3L95 X;  3FCC A;  1HH2 P;  5IT9 D;  4JYA C;  4LE5 A;  1ML8 A;  4DR1 C;  4OXI A;  4RVN A;  3CW8 X;  3LNV A;  5KEI A;  2OPL A;  2VZE A;  2UUB C;  2UXC C;  4RM3 A;  3NPD A;  4MH4 A;  4GS5 A;  2BH1 X;  4OX9 C;  1V25 A;  3TDE A;  3A9U A;  2P2F A;  2YWB A;  4GKJ C;  1NYE A;  2VSQ A;  1XMQ C;  4HPV A;  4RLQ A;  1EGA A;  4B3T C;  5BST A;  1YJ7 A;  2E0G A;  3DHV A;  2F4V C;  4B3S C;  5BUQ A;  2PRO A;  4I9F A;  5LMU C;  2UU9 C;  3G7S A;  4K0B A;  5CZV A;  2P20 A;  1RG9 A;  1IBK C;  4JI6 C;  5GTD A;  3PES A;  3VNQ A;  2D1R A;  1XNR C;  1RY2 A;  4DCV A;  1N34 C;  2VQF C;  1QWI A;  2VQE C;  5K85 A;  4NXN C;  2HJG A;  5ADZ A;  1FJG C;  1PG4 A;  2KZF A;  1V26 A;  3NYQ A;  4DR6 C;  4K0K C;  1N36 C;  2P2M A;  4B3M C;  4DV7 C;  5KYV A;  4ODJ A;  1HR0 C;  2QVY X;  3CJE A;  3SO4 A;  4DUY C;  4JM1 A;  3B7W A;  1MXB A;  5DV9 A;  4LF9 C;  4JI1 C;  5K8F A;  1BA3 A;  3GPC A;  1GPM A;  3N54 B;  4DV6 C;  1PA4 A;  3RV2 A;  4GXQ A;  4JI0 C;  5E7Q A;  4BBY A;  3VNR A;  4RM2 A;  3L8C A;  3R9X A;  5H9U A;  2AYA A;  1MKY A;  2OO4 A;  1O90 A;  4DR7 C;  5FLX D;  3KXW A;  4ZLP A;  3VNS A;  3EQ6 A;  5KYT A;  4EAT A;  1MDF A;  4R1L A;  1USP A;  3GR1 A;  3I08 A;  2P2Q A;  1MDB A;  3UZ0 A;  4X65 C;  4G1I A;  2UXD C;  4DV1 C;  4KHP C;  4RMN A;  1T5H X;  3H2T A;  2E8C A;  1VLA A;  4GKK C;  3NYR A;  5BUR A;  4BSZ A;  2D7V A;  5BSM A;  4FTF A;  2YWC A;  3LUS A;  4LFA C;  1N2F A;  2P2J A;  4G37 A;  4DCT A;  4FUQ A;  3PBK A;  3IEU A;  4IZ6 A;  4TPS B;  1XRC A;  2Y4N A;  4IR7 A;  4LF4 C;  4X62 C;  1ULT A;  3S82 A;  4JV5 C;  1HNW C;  3E7W A;  1N32 C;  3IML A;  3UOW A;  1O93 A;  4D4I A;  4PRO C;  1QM4 A;  1XRB A;  4LFB C;  2HHH C;  3I07 A;  1O9T A;  1P7L A;  2ASB A;  5BSR A;  1LQL A;  4LF8 C;  4LF5 C;  1IBL C;  4DV3 C;  4JI5 C;  1MD9 A;  4WS9 A;  1FUG A;  3DLP X;  4D4G A;  1N33 C;  2UUA C;  4LFC C;  3T1H C;  3DAY A;  4DR5 C;  4NDN A;  4JI4 C;  4DUZ C;  2YCB A;  5CZX A;  5A1G A;  4DV0 C;  4FUT A;  4DV2 C;  4ISB A;  5JRH A;  2Y27 A;  4BC9 A;  1T5D X;  3IEV A;  5IFI A;  4U5Y D;  3J81 D;  3GKU A;  4PZP A;  4YY3 C;  5T8S A;  5A1I A;  2CY1 A;  3FCE A;  4DR4 C;  2DYJ A;  2D1S A;  4JI3 C;  4XX2 A;  4KTT A;  4R1M A;  2P2B A;  2UUC C;  3T1Y C;  1MXA A;  1HNZ C;  4DCU A;  1PG3 A;  3C5E A;  1UKK A;  3AF5 A;  1K0R A;  2E5L C;  3RG2 A;  4WV3 A;  4JI2 C;  4DV4 C;  4KTV A;  2ZM6 C;  4B3R C;  3CW9 A;  4D56 A;  4D57 A;  5LMN C;  3LAX A;  4NXM C;  2XR1 A;  2P02 A;  3TUF A;  4ZJZ A;  3IPL A;  5A19 A;  3NI2 A;  2QL8 A;  2ATW A;  3EER A;  2D28 C;  1XRA A;  4L4Q A;  4I9G A;  5BUS A;  2DPL A;  4BC7 A;  4GXR A;  1LCI A;  1ZB8 A;  4DG8 A;  4DR2 C;  2D1T A;  4DG9 A;  2D27 A;  4X66 C;  4DCS A;  2QVX X;  4R0M A;  4X64 C;  1IBM C;  1ZB9 A;  1XMO C;  4PHT A;  4OYC A;  1HNX C;  2WP0 C;  3GR0 A;  5BR8 C;  2UXB C;  4AQY C;  4JI7 C;  1MXC A;  1WF3 A;  1AMU A;  4LF7 C;  2CXC A;  2V7B A;  5BSV A;  1I94 C;  2QVZ X;  3LGX A;  2ONF A;  3A4I A;  2E7G A;  3E7X A;  2BJO A;  1XNQ C;  2WD9 A;  1KKG A;  3AF6 A;  3PRO C;  4DV5 C;  4LF6 C;  1L2F A;  3JAM D;  4YHH C;  5T8T A;  5A2Q D;  5IWA C;  2EGT A;  3R9W A;  2E8E A;  4L7I A;  4G36 A;  4L2Z A;  3ETO A;  5BSU A;  5AE2 A;  5AE3 A;  4BCA A;  2D1Q A;  4JI8 C;  4NOZ A;  1J5E C;  3R44 A;  4MTN A;  1USP B;  2E8F A;  4DR3 C;  3A9V A;  3ETC A;  1JOS A;  2OPL B;  2Y4O A;  5AE1 A;  3J80 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...