4XX2A

Ohr from xylella fastidiosa in oxidized state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
141
Chain Sequence
MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Organic hydroperoxide resistance protein
publication title Ohr from Xylella fastidiosa in oxidized state
rcsb
source organism Xylella fastidiosa (strain 9a5c)
molecule tags Oxidoreductase
total genus 32
structure length 141
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4xx2A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4xx2A02
2NVQI 1X3WA 2P3YA 4B3SC 3S1MI 2ONFA 2F4OA 4MH4A 1WH9A 3GTJI 4NXMC 2DYJA 3VMGA 4JI1C 4MTNA 4OX9C 3M4OI 4Y7NI 1USPB 3GTKI 1R9TI 3HOWI 5C44I 3IEVA 2CXCA 4A3II 1N36C 3T1YC 1PFTA 4BY1I 1L2FA 4DV3C 2UUBC 5IWAC 4X65C 1ML8A 1WW9A 2JNYA 2E2II 4B3RC 1ZB8A 2QL8A 3HOVI 1TWHI 4NBEA 2HHHC 2F4MA 1USPA 4A3FI 1ZB9A 3S15I 3LUSA 4AQYC 3I07A 4LFCC 3H0GI 2DE6A 1UKKA 3GTOI 2UU9C 4JI7C 4NBAA 3S2DI 1I94C 2B63I 4BSZA 3H3VJ 1QYPA 4LF9C 2ASBA 2JR6A 3S16I 5C3EI 2DE7A 1HH2P 5BR8C 1HNXC 4X64C 1I50I 4DCVA 4JI0C 5LMUC 2UUCC 1K83I 3I4MI 4Y52I 4NBCA 4A93I 4DCSA 2F4VC 2JA6I 4LFBC 1RO4A 3OTOC 3HOZI 1XNRC 4X6AI 4BXXI 4BY7I 4DR6C 3CJEA 2D7VA 4DV2C 2E8CA 3S2HI 2ATWA 4QTUA 4KHPC 4B3TC 2EGTA 1HNWC 4DV6C 4A3KI 2XR1A 4LF4C 2E5LC 1WCMI 2J6AA 1SFOI 4GKJC 4DUZC 3PO2I 4X66C 3S1NI 3S17I 2E8EA 1XNQC 5IP9I 3CQZI 3RZOI 4YY3C 3U50C 2YU9I 4A3MI 4BBRI 2DE5A 4NXNC 4LFAC 2JA7I 4A3BI 4NB9A 2JA8I 4JYAC 2CY1A 4X62C 3GTGI 3GTPI 4DUYC 2BJOA 4A3JI 1XMQC 1JOSA 1IBKC 1N33C 3AF6A 2PN2A 4LF5C 4JI3C 1IBMC 1TWGI 5FLMI 1K0RA 3I4NI 4DV4C 2UXDC 2NVXI 1I3QI 3J80D 3AF5A 1HR0C 3FKII 4YHHC 4DCTA 3PO3I 1LQLA 3GTMI 2R93I 4JI2C 2PK7A 3JAMD 5IP7I 2HF1A 4XX2A 1Y1WI 2ZM6C 4LF6C 1MKYA 3VB9A 3J81D 2VQFC 3VMHA 4JI4C 1X3ZA 4QTTA 4A3CI 4LF8C 3Q87A 3PO3S 2E2JI 2UXBC 5FLXD 2KPIA 4GKKC 3VMIA 2HJGA 1QWIA 4B3MC 1TWCI 3HOYI 5LMNC 3M3YI 1IBLC 4NOZA 4NBGA 1FJGC 3R9WA 4DR5C 3HOUI 1TFIA 5C4XI 2K5RA 1N2FA 4JV5C 2R92I 3GKQA 1XMOC 4DV5C 1Y1VI 1TWFI 1N32C 1WF3A 4JI6C 5A2QD 2VQEC 2JMPA 3GTQI 2KZFA 3ESWA 1HNZC 1L1OC 1TWAI 3GTLI 2RBLA 3S1QI 4DR2C 1RLYA 4DR7C 2NVTI 4BBSI 2JA5I 4DR1C 1N34C 1KKGA 4NBFA 1Y1VS 2E7GA 3IEUA 4DCUA 3D6WA 2R7ZI 5C4JI 4LF7C 2OPLB 1VLAA 4NBHA 4DV7C 4DR4C 3S14I 3GKUA 2YCBA 1YUAA 4K0KC 1J5EC 2UUAC 4NB8A 2JS4A 4NBBA 3HOXI 4A3GI 4JI8C 3RZDI 2E2HI 4DV1C 3EERA 3R9XA 2OPLA 1NUIA 4DR3C 1PA4A 2AKLA 5IT9D 3GCFA 4A3DI 4DV0C 2VUMI 3S1RI 4JI5C 2E8FA 3GTMS 2PT7G 1NYEA 4NBDA 1DL6A 2UXCC 5CM2M 3K7AI 3T1HC 4A3EI 1I6HI 1EGAA 4A3LI 2NVYI
chains in the Genus database with same CATH superfamily
2NVQI 1X3WA 5D1OA 2KI7B 1QM4A 2P3YA 5CZXA 5T67A 4B3SC 3S1MI 2ONFA 2F4OA 3PROC 3J80b 1VQO1 4DGLA 4I9GA 4MH4A 2QEX1 1Q7Y1 2Z51A 3A25A 2QKDA 3GTJI 1VQLZ 1O92A 1WH9A 2DYJA 3VMGA 3N54B 4NXMC 4JI1C 1O93A 4MTNA 4OX9C 3M4OI 4Y7NI 1LCIA 3CXCZ 1USPB 2OTLZ 3EEDA 3GTKI 3CCMZ 2M6NA 2OBVA 1R9TI 1VQKZ 2M5OA 3HOWI 5C44I 3UZ0A 3IEVA 4ZLPA 1VQ4Z 2CXCA 4AYBA 4A3II 4D4IA 2VF1A 1K9M1 3UX3A 1N36C 3T1YC 1PFTA 1Q861 3CCE1 3LNOA 2Q4ZA 4BY1I 1YJ91 1AMUA 3E7WA 1L2FA 3RV2A 4DV3C 2UUBC 1YJ7A 5IWAC 4E2YA 1TH5A 3S82A 5A19A 3NDJA 4X65C 3UEBA 3IF8A 1ML8A 1WW9A 2YX1A 1RY2A 5BSTA 2JNYA 3EQ6A 2E2II 3CW8X 4B3RC 1ZB8A 2RT9A 2QL8A 3CD61 3HOVI 1TWHI 1RO0A 2NAPA 4NBEA 1M1K1 4G1IA 4GS5A 2HHHC 2F4MA 1USPA 4A3FI 3CCU1 1XHJA 2RPRA 1YITZ 3G7SA 2BH1X 4KTTA 1ZB9A 3S15I 4OYCA 2RIQA 5LCIA 1M6XA 3LUSA 2E0GA 4AQYC 4MD7A 3A9UA 3I07A 3PESA 3J80f 2LIYA 5FLXb 2Y0SA 3G4SZ 1JJ2Z 2VPWA 3FCCA 4LFCC 3H0GI 1YI2Z 2DE6A 1UKKA 3GTOI 4DG9A 2VPYA 1P4EC 4PROC 1MDBA 5KYVA 2UU9C 5AE3A 2AYDA 2O53A 1VQ51 4JI7C 3QWUA 2LEXA 1KQSY 4R0MA 2QRCB 4RVOA 4NBAA 3S2DI 4MXUA 5IFIA 2JMOA 4RVGA 1I94C 2B63I 2JNVA 2Y4NA 2PROA 4DK1A 4BSZA 4D57A 1KD12 1WIIA 1VQL1 4K0BA 3H3VJ 1MXAA 1QYPA 3I56Z 2OTL1 3B7WA 4KTVA 4LF9C 3LNVA 2ASBA 4E32A 2JR6A 3S16I 4ISBA 1VQK1 5C3EI 2DE7A 1HH2P 4BCAA 4E2ZA 3G71Z 5BR8C 1HNXC 1NY8A 3KIFA 3CC4Z 1P7LA 4FTFA 1UWDA 1VQ41 3ETCA 4X64C 1I50I 1X0TA 1T5DX 2MCQA 3E7XA 4JM1A 3NH4A 4DCVA 4JI0C 2MMAB 5LMUC 1K83I 1PU1A 2UUCC 3I4MI 5BSMA 4Y52I 2YWBA 3VNSA 2DPLA 1SIWA 3J7A4 4NBCA 3CCSZ 5T8SA 1FDIA 1M902 4A93I 4DCSA 4PUIA 2F4VC 2JA6I 1V25A 1K8A1 1T5HX 4LFBC 1RO4A 5BSUA 3OTOC 3HOZI 1XNRC 1W2BZ 4X6AI 5AN9F 1QVGY 4BXXI 3CC2Z 4BY7I 4GXQA 4DR6C 4BC9A 2QR1B 3CJEA 3A9VA 1ZH1A 1Q822 2VUGA 1YIT1 4FUTA 2D7VA 3DLPX 4DV2C 2E8CA 5AE2A 2D1SA 3S2HI 1AA6A 2QA41 2ATWA 1KC82 3L95X 1VQNZ 4QTUA 4KHPC 2JIPA 3G4S1 3CC7Z 2OOXB 3KIHA 1GPMA 4B3TC 2EGTA 2PMZA 3CMA1 1O90A 1HNWC 1S72Z 4DV6C 3BG0B 4A3KI 1VQ91 1QVFZ 2XR1A 1YIJ1 4LF4C 2E5LC 1WCMI 2J6AA 2Y4OA 3LGXA 3CCRZ 4MONA 1VQ71 1FDOA 1N8R1 1SFOI 2WP0C 3JAMb 3OW2Y 3NYRA 1YJWZ 4GKJC 1KRLA 2PM9A 4DUZC 3A4IA 5KEIA 1VQPZ 2VZEA 4RV9A 4OXIA 1K732 2V8JA 3VNQA 3CPWZ 3PO2I 4X66C 3S1NI 2CU6A 2OZKA 3S17I 4RLFA 2E7ZA 3UOWA 4DG8A 2E8EA 1XNQC 1P9NA 4HGZA 1IB8A 1NJI2 5IP9I 3CQZI 3J81b 3RZOI 4RVFA 3U50C 2YU9I 4A3MI 5GTDA 4YY3C 4BBRI 4RM2A 2DE5A 1BA3A 4NXNC 5IT9b 4LFAC 1XRAA 3G711 3CC41 1RO2A 2JA7I 4A3BI 2ZZNA 4RLQA 3CCJZ 4NB9A 2JA8I 1Z01A 2GTHA 3CCV1 4JYAC 2CY1A 2W03A 4X62C 3GTGI 3GTPI 3F3FC 3IPLA 3GR0A 4DUYC 2BJOA 2LFUA 3TDHB 3H2TA 2D1TA 4GXRA 4A3JI 1MXCA 5DV9A 5AE1A 1XMQC 1Q7Y2 2M5HA 3CCLZ 3K6RA 3I55Z 1JOSA 1IBKC 1N33C 3AF6A 4R1LA 2PN2A 2NCLA 4LF5C 4JI3C 2V8KA 1IBMC 1TWGI 5FLMI 1MD9A 1YJNZ 1K0RA 4DQYB 5ADZA 3JAMf 3SO4A 3I4NI 4DV4C 3ETOA 2UXDC 2NVXI 1I3QI 3GR1A 4RM3A 3J80D 3AF5A 4U5YD 1HR0C 2QEXZ 1K9M2 3FKII 4YHHC 3AY0A 4DCTA 3MONA 4E2WA 3PO3I 4EWCA 3P5JB 1Q862 1LQLA 3PBKA 2YADA 3GTMI 2R93I 3CC71 2D28C 2K3RA 3G6EZ 3CXCY 3J81f 2DHMA 1VQMZ 1S721 4JI2C 2PK7A 2VPZA 3NDIA 1Q811 1QVFY 3JAMD 5IP7I 3CCM1 2OTJZ 2QRDB 5A2Qb 2G2KA 2HF1A 2IZ3A 4XX2A 1Y1WI 1M1K2 2GTIA 4FUQA 3CCR1 5K8FA 3A26A 1YJW1 1YJ9Z 2JIMA 1XS3A 2ZM6C 4LF6C 1VEHA 1MKYA 3IR7A 5FLXf 1PG4A 2Q51A 3VB9A 3J81D 4S1TA 5KYTA 4PUGA 5K85A 1NP6A 2KZ0A 2VQFC 5E7QA 3VMHA 4BBYA 2V7BA 3CCUZ 4JI4C 1X3ZA 3MZKB 4QTTA 2P20A 2P2MA 1RQFA 1QF8A 3BG1B 3MZLB 4TNUA 2OO4A 2QVXX 3I08A 3NI2A 1M6XC 4A3CI 3GPCA 4LF8C 3Q87A 3PO3S 2OOYB 2E2JI 2UXBC 4D4GA 5FLXD 2JIOA 2KPIA 1ULTA 1YUKA 2O4HA 4GKKC 4NDNA 3VMIA 2HJGA 4E2XA 1QWIA 1WJ2A 2P2JA 1YHQZ 4B3MC 1TWCI 4I9FA 3HOYI 5LMNC 3M3YI 3FCEA 1JJ2Y 3NYQA 2H85A 4RMNA 1RNIA 1IBLC 4NOZA 2WB1A 4NBGA 3TDEA 1FJGC 4PHTA 1YI21 2R6MA 4E33A 3CCL1 2D1RA 2W04A 3I551 5A2Qf 3R9WA 2D1QA 4DR5C 2IV2X 3HOUI 1TFIA 5C4XI 2QVZX 4RVHA 4WS9A 1P4EA 2K5RA 1KQSZ 3NPDA 1N2FA 4JV5C 5T64A 2R92I 4HPVA 3GKQA 1XMOC 3NH8A 2IZ4A 4R1MA 1O9TA 2P28A 3D9XA 5BUQA 4DV5C 1Y1VI 1TWFI 5JRHA 1FLOA 1N32C 2P2FA 2QW0X 1WF3A 4ODJA 2JIQA 3T4NB 4ZJZA 2MM9A 4JI6C 3F3PC 1Q16A 5A2QD 4L7IA 3HKZA 3G6E1 1FUGA 2VQEC 4L2ZA 2JMPA 2V8IA 2P2BA 2RHBA 1VQM1 1K8A2 3TE5B 3DHVA 3I561 2QVYX 1V60A 3FQMA 3GTQI 2OTJ1 2KZFA 3L8CA 3ESWA 3VNRA 1HNZC 1L1OC 1TWAI 3GTLI 2RBLA 3S1QI 2QLVB 3KXWA 1WCJA 4DR2C 1RLYA 4DR7C 1KD11 3LAXA 3RG2A 1XRBA 4RVNA 2M48A 3CCQZ 2NVTI 2ZAEB 4BBSI 2KDNA 5T6BA 1VQ6Z 1VQ8Z 3IMLA 5BURA 2AYAA 3CCS1 5LL6f 2JA5I 4DR1C 4NH1C 1N34C 4MRIA 3CMEZ 1W2BY 2WD9A 1QVGZ 1Z03A 2P02A 4BC7A 4D56A 1KKGA 3D2LA 4NBFA 2I3CA 3CC21 1Y1VS 1V26A 2E7GA 3IEUA 3TQIA 4RS4A 4RVDA 5D1PA 3D6WA 1XRCA 3R44A 4WV3A 4DCUA 4HGYA 2R7ZI 4PUHA 3NH5A 2JIRA 5C4JI 2V3VA 3TR3A 2QA4Z 5T8TA 1M901 3UX2A 1QXFA 4LF7C 1VQOZ 1VLAA 1N8R2 2OPLB 5BSVA 4NBHA 4PZPA 1YHQ1 4G36A 3DAYA 4DV7C 3CMAZ 4E31A 1VQN1 4DR4C 3S14I 3GKUA 2YCBA 1YUAA 4K0KC 1VQ9Z 2GU2A 2YWCA 3IX0A 4L4QA 1J5EC 2UUAC 4NB8A 1YIJZ 1Q821 4IR7A 2Y27A 1Z02A 4CL1A 1WZNA 4HH4A 2JS4A 4NBBA 1VQ7Z 3C5EA 2VPXA 3HOXI 5IT9f 3CQ2A 4A3GI 4TPSB 2QREB 3IFUA 3OW2Z 4MD8A 4JI8C 4LE5A 1KC81 4E30A 2WAQA 3CCEZ 5BSWA 3RZDI 2E2HI 2P2QA 5BSRA 1Y8CA 3TUFA 4MD9A 4DV1C 1VQP1 4EATA 1S7MA 3CPWY 3EERA 3CQ1A 3R9XA 2OPLA 1NUIA 4DR3C 3CQ3A 1PA4A 3CD6Z 1PG3A 1MXBA 2AKLA 4NFRA 4IZ6A 5IT9D 3O2EA 3GCFA 4A3DI 5D1OB 1RG9A 4DV0C 2HU9A 2VUMI 2VSQA 1JWHC 1K731 3CCVZ 3S1RI 4JI5C 2D27A 2ZZMA 2E8FA 3GTMS 3NFZA 2PT7G 5H9UA 3CCJ1 1NYEA 4NBDA 1DL6A 3FQQA 5BUSA 3CCQ1 5CM2M 3K7AI 1NJI1 2UXCC 2JUBA 3VTNA 3T1HC 1VQ61 1VQ81 4A3EI 5CZVA 1I6HI 1MDFA 1EGAA 3CME1 4A3LI 5A1IA 1VQ5Z 2V45A 3N2QA 4G37A 3CW9A 1Q812 2NVYI 2E9HA 5A1GA 1YJN1
chains in the Genus database with same CATH topology
2NVQI 1X3WA 5D1OA 2KI7B 1QM4A 2P3YA 5CZXA 5T67A 4B3SC 3S1MI 2ONFA 2F4OA 3PROC 3J80b 1VQO1 4DGLA 4I9GA 4MH4A 2QEX1 1Q7Y1 2QKDA 3GTJI 1VQLZ 1O92A 1WH9A 2DYJA 3VMGA 3N54B 4NXMC 4JI1C 1O93A 4MTNA 4OX9C 3M4OI 4Y7NI 1LCIA 3CXCZ 1USPB 2OTLZ 3EEDA 3GTKI 3CCMZ 2M6NA 2OBVA 1R9TI 1VQKZ 3HOWI 5C44I 3UZ0A 3IEVA 4ZLPA 1VQ4Z 2CXCA 4A3II 4AYBA 4D4IA 2VF1A 1K9M1 1N36C 3T1YC 1PFTA 1Q861 3CCE1 2Q4ZA 4BY1I 1YJ91 1AMUA 3E7WA 1L2FA 3RV2A 4DV3C 2UUBC 1YJ7A 5IWAC 4E2YA 3S82A 5A19A 3NDJA 4X65C 3IF8A 1ML8A 1WW9A 1RY2A 5BSTA 2JNYA 3EQ6A 2E2II 3CW8X 4B3RC 1ZB8A 2RT9A 2QL8A 3CD61 3HOVI 1TWHI 1RO0A 4NBEA 1M1K1 4G1IA 4GS5A 2HHHC 2F4MA 1USPA 4A3FI 3CCU1 2RPRA 1YITZ 3G7SA 2BH1X 4KTTA 1ZB9A 3S15I 4OYCA 2RIQA 3LUSA 2E0GA 4AQYC 4MD7A 3A9UA 3I07A 3PESA 2LIYA 3J80f 5FLXb 2Y0SA 3G4SZ 1JJ2Z 3FCCA 4LFCC 3H0GI 1YI2Z 2DE6A 1UKKA 3GTOI 4DG9A 4PROC 1MDBA 5KYVA 2UU9C 5AE3A 1VQ51 2O53A 4JI7C 3QWUA 1KQSY 4R0MA 2QRCB 4RVOA 4NBAA 3S2DI 4MXUA 5IFIA 2JMOA 4RVGA 1I94C 2B63I 2Y4NA 2PROA 4DK1A 4BSZA 4D57A 1KD12 1WIIA 1VQL1 4K0BA 3H3VJ 1MXAA 1QYPA 3I56Z 2OTL1 3B7WA 4KTVA 4LF9C 3LNVA 2ASBA 4E32A 2JR6A 3S16I 4ISBA 1VQK1 5C3EI 2DE7A 1HH2P 4BCAA 4E2ZA 3G71Z 5BR8C 1HNXC 3KIFA 3CC4Z 1P7LA 4FTFA 1VQ41 3ETCA 4X64C 1I50I 1X0TA 1T5DX 3E7XA 4JM1A 3NH4A 4DCVA 4JI0C 5LMUC 2UUCC 1K83I 3I4MI 5BSMA 4Y52I 2YWBA 3VNSA 2DPLA 3J7A4 4NBCA 3CCSZ 5T8SA 1M902 4A93I 4DCSA 2F4VC 2JA6I 1V25A 1K8A1 1T5HX 4LFBC 1RO4A 5BSUA 3OTOC 3HOZI 1XNRC 1W2BZ 4X6AI 5AN9F 1QVGY 4BXXI 3CC2Z 4BY7I 4GXQA 4DR6C 4BC9A 2QR1B 3CJEA 3A9VA 1ZH1A 1Q822 2VUGA 1YIT1 4FUTA 2D7VA 3DLPX 4DV2C 2E8CA 5AE2A 2D1SA 3S2HI 2ATWA 2QA41 1KC82 3L95X 1VQNZ 4QTUA 4KHPC 3G4S1 3CC7Z 2OOXB 3KIHA 1GPMA 4B3TC 2EGTA 2PMZA 3CMA1 1O90A 1HNWC 1S72Z 4DV6C 3BG0B 4A3KI 1VQ91 1QVFZ 2XR1A 1YIJ1 4LF4C 2E5LC 1WCMI 2J6AA 2Y4OA 3LGXA 3CCRZ 4MONA 1VQ71 1N8R1 1SFOI 2WP0C 3JAMb 3OW2Y 3NYRA 1YJWZ 4GKJC 1KRLA 2PM9A 4DUZC 3A4IA 5KEIA 1VQPZ 2VZEA 4RV9A 4OXIA 1K732 2V8JA 3VNQA 3CPWZ 3PO2I 4X66C 3S1NI 2OZKA 3S17I 4RLFA 3UOWA 4DG8A 2E8EA 1XNQC 1P9NA 4HGZA 1NJI2 5IP9I 3CQZI 3J81b 3RZOI 4RVFA 3U50C 2YU9I 4A3MI 5GTDA 4YY3C 4BBRI 4RM2A 2DE5A 1BA3A 4NXNC 5IT9b 4LFAC 1XRAA 3G711 3CC41 1RO2A 2JA7I 4A3BI 4RLQA 3CCJZ 4NB9A 2JA8I 1Z01A 2GTHA 3CCV1 4JYAC 2CY1A 2W03A 4X62C 3GTGI 3GTPI 3F3FC 3IPLA 3GR0A 4DUYC 2BJOA 2LFUA 3TDHB 3H2TA 2D1TA 4GXRA 4A3JI 1MXCA 5DV9A 5AE1A 1XMQC 1Q7Y2 3CCLZ 3I55Z 1JOSA 1IBKC 1N33C 3AF6A 4R1LA 2PN2A 4LF5C 4JI3C 2V8KA 1IBMC 1TWGI 5FLMI 1MD9A 1YJNZ 1K0RA 4DQYB 5ADZA 3JAMf 3SO4A 3I4NI 4DV4C 3ETOA 2UXDC 2NVXI 1I3QI 3GR1A 4RM3A 3J80D 3AF5A 4U5YD 1HR0C 2QEXZ 1K9M2 3FKII 4YHHC 4DCTA 3MONA 4E2WA 3PO3I 4EWCA 3P5JB 1Q862 1LQLA 3PBKA 2YADA 3GTMI 2R93I 3CC71 2D28C 2K3RA 3G6EZ 3CXCY 3J81f 1VQMZ 1S721 4JI2C 2PK7A 3NDIA 1Q811 1QVFY 3JAMD 5IP7I 3CCM1 2OTJZ 2QRDB 5A2Qb 2G2KA 2HF1A 2IZ3A 4XX2A 1Y1WI 1M1K2 2GTIA 4FUQA 3CCR1 5K8FA 1YJW1 1YJ9Z 2ZM6C 4LF6C 1MKYA 5FLXf 1PG4A 2Q51A 3VB9A 3J81D 4S1TA 5KYTA 5K85A 1NP6A 2VQFC 5E7QA 3VMHA 4BBYA 2V7BA 3CCUZ 4JI4C 1X3ZA 3MZKB 4QTTA 2P20A 2P2MA 1RQFA 1QF8A 3BG1B 3MZLB 4TNUA 2OO4A 2QVXX 3I08A 3NI2A 4A3CI 3GPCA 4LF8C 3Q87A 3PO3S 2OOYB 2E2JI 2UXBC 4D4GA 5FLXD 2KPIA 1ULTA 1YUKA 2O4HA 4GKKC 4NDNA 3VMIA 2HJGA 4E2XA 1QWIA 4B3MC 2P2JA 1YHQZ 1TWCI 4I9FA 3HOYI 5LMNC 3M3YI 3FCEA 1JJ2Y 3NYQA 2H85A 4RMNA 1RNIA 1IBLC 4NOZA 2WB1A 4NBGA 3TDEA 1FJGC 4PHTA 1YI21 2R6MA 4E33A 3CCL1 2D1RA 2W04A 3I551 5A2Qf 3R9WA 2D1QA 4DR5C 3HOUI 1TFIA 5C4XI 2QVZX 4RVHA 4WS9A 2K5RA 1KQSZ 3NPDA 1N2FA 4JV5C 5T64A 2R92I 4HPVA 3GKQA 1XMOC 3NH8A 2IZ4A 4R1MA 1O9TA 2P28A 3D9XA 5BUQA 4DV5C 1Y1VI 1TWFI 5JRHA 1N32C 2P2FA 2QW0X 1WF3A 4ODJA 3T4NB 4ZJZA 4JI6C 3F3PC 5A2QD 4L7IA 3HKZA 3G6E1 1FUGA 2VQEC 4L2ZA 2JMPA 2V8IA 2P2BA 2RHBA 1VQM1 1K8A2 3TE5B 3DHVA 3I561 2QVYX 3FQMA 3GTQI 2OTJ1 2KZFA 3L8CA 3ESWA 3VNRA 1HNZC 1L1OC 1TWAI 3GTLI 2RBLA 3S1QI 2QLVB 3KXWA 4DR2C 1RLYA 4DR7C 1KD11 3LAXA 3RG2A 1XRBA 4RVNA 2M48A 3CCQZ 2NVTI 2ZAEB 4BBSI 5T6BA 1VQ6Z 1VQ8Z 3IMLA 5BURA 2AYAA 3CCS1 5LL6f 2JA5I 4DR1C 4NH1C 1N34C 4MRIA 3CMEZ 1W2BY 2WD9A 1QVGZ 1Z03A 2P02A 4BC7A 4D56A 1KKGA 4NBFA 2I3CA 3CC21 1Y1VS 1V26A 2E7GA 3IEUA 3TQIA 4RS4A 4RVDA 5D1PA 3D6WA 1XRCA 3R44A 4WV3A 4DCUA 4HGYA 2R7ZI 3NH5A 5C4JI 2QA4Z 5T8TA 1M901 4LF7C 1VQOZ 1VLAA 1N8R2 2OPLB 5BSVA 4NBHA 4PZPA 1YHQ1 4G36A 3DAYA 4DV7C 3CMAZ 4E31A 1VQN1 4DR4C 3S14I 3GKUA 2YCBA 1YUAA 4K0KC 1VQ9Z 2GU2A 2YWCA 3IX0A 4L4QA 1J5EC 2UUAC 4NB8A 1YIJZ 1Q821 4IR7A 2Y27A 1Z02A 4CL1A 1VQ7Z 2JS4A 4HH4A 4NBBA 3C5EA 3HOXI 5IT9f 4A3GI 4TPSB 2QREB 3IFUA 3OW2Z 4MD8A 4JI8C 4LE5A 1KC81 4E30A 2WAQA 3CCEZ 5BSWA 3RZDI 2E2HI 2P2QA 5BSRA 3TUFA 4MD9A 4DV1C 1VQP1 4EATA 1S7MA 3CPWY 3EERA 3R9XA 2OPLA 1NUIA 4DR3C 1PA4A 3CD6Z 1PG3A 1MXBA 2AKLA 4NFRA 4IZ6A 5IT9D 3GCFA 4A3DI 5D1OB 1RG9A 4DV0C 2HU9A 2VUMI 2VSQA 1JWHC 1K731 3CCVZ 3S1RI 4JI5C 2D27A 2E8FA 3GTMS 3NFZA 2PT7G 5H9UA 3CCJ1 1NYEA 4NBDA 1DL6A 3FQQA 5BUSA 3CCQ1 5CM2M 3K7AI 1NJI1 2UXCC 2JUBA 3VTNA 3T1HC 1VQ61 1VQ81 4A3EI 5CZVA 1I6HI 1MDFA 1EGAA 3CME1 4A3LI 5A1IA 1VQ5Z 3N2QA 4G37A 3CW9A 1Q812 2NVYI 2E9HA 5A1GA 1YJN1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ I;  1X3W A;  2P3Y A;  4B3S C;  3S1M I;  2ONF A;  2F4O A;  4MH4 A;  1WH9 A;  3GTJ I;  4NXM C;  2DYJ A;  3VMG A;  4JI1 C;  4MTN A;  4OX9 C;  3M4O I;  4Y7N I;  1USP B;  3GTK I;  1R9T I;  3HOW I;  5C44 I;  3IEV A;  2CXC A;  4A3I I;  1N36 C;  3T1Y C;  1PFT A;  4BY1 I;  1L2F A;  4DV3 C;  2UUB C;  5IWA C;  4X65 C;  1ML8 A;  1WW9 A;  2JNY A;  2E2I I;  4B3R C;  1ZB8 A;  2QL8 A;  3HOV I;  1TWH I;  4NBE A;  2HHH C;  2F4M A;  1USP A;  4A3F I;  1ZB9 A;  3S15 I;  3LUS A;  4AQY C;  3I07 A;  4LFC C;  3H0G I;  2DE6 A;  1UKK A;  3GTO I;  2UU9 C;  4JI7 C;  4NBA A;  3S2D I;  1I94 C;  2B63 I;  4BSZ A;  3H3V J;  1QYP A;  4LF9 C;  2ASB A;  2JR6 A;  3S16 I;  5C3E I;  2DE7 A;  1HH2 P;  5BR8 C;  1HNX C;  4X64 C;  1I50 I;  4DCV A;  4JI0 C;  5LMU C;  2UUC C;  1K83 I;  3I4M I;  4Y52 I;  4NBC A;  4A93 I;  4DCS A;  2F4V C;  2JA6 I;  4LFB C;  1RO4 A;  3OTO C;  3HOZ I;  1XNR C;  4X6A I;  4BXX I;  4BY7 I;  4DR6 C;  3CJE A;  2D7V A;  4DV2 C;  2E8C A;  3S2H I;  2ATW A;  4QTU A;  4KHP C;  4B3T C;  2EGT A;  1HNW C;  4DV6 C;  4A3K I;  2XR1 A;  4LF4 C;  2E5L C;  1WCM I;  2J6A A;  1SFO I;  4GKJ C;  4DUZ C;  3PO2 I;  4X66 C;  3S1N I;  3S17 I;  2E8E A;  1XNQ C;  5IP9 I;  3CQZ I;  3RZO I;  4YY3 C;  3U50 C;  2YU9 I;  4A3M I;  4BBR I;  2DE5 A;  4NXN C;  4LFA C;  2JA7 I;  4A3B I;  4NB9 A;  2JA8 I;  4JYA C;  2CY1 A;  4X62 C;  3GTG I;  3GTP I;  4DUY C;  2BJO A;  4A3J I;  1XMQ C;  1JOS A;  1IBK C;  1N33 C;  3AF6 A;  2PN2 A;  4LF5 C;  4JI3 C;  1IBM C;  1TWG I;  5FLM I;  1K0R A;  3I4N I;  4DV4 C;  2UXD C;  2NVX I;  1I3Q I;  3J80 D;  3AF5 A;  1HR0 C;  3FKI I;  4YHH C;  4DCT A;  3PO3 I;  1LQL A;  3GTM I;  2R93 I;  4JI2 C;  2PK7 A;  3JAM D;  5IP7 I;  2HF1 A;  4XX2 A;  1Y1W I;  2ZM6 C;  4LF6 C;  1MKY A;  3VB9 A;  3J81 D;  2VQF C;  3VMH A;  4JI4 C;  1X3Z A;  4QTT A;  4A3C I;  4LF8 C;  3Q87 A;  3PO3 S;  2E2J I;  2UXB C;  5FLX D;  2KPI A;  4GKK C;  3VMI A;  2HJG A;  1QWI A;  4B3M C;  1TWC I;  3HOY I;  5LMN C;  3M3Y I;  1IBL C;  4NOZ A;  4NBG A;  1FJG C;  3R9W A;  4DR5 C;  3HOU I;  1TFI A;  5C4X I;  2K5R A;  1N2F A;  4JV5 C;  2R92 I;  3GKQ A;  1XMO C;  4DV5 C;  1Y1V I;  1TWF I;  1N32 C;  1WF3 A;  4JI6 C;  5A2Q D;  2VQE C;  2JMP A;  3GTQ I;  2KZF A;  3ESW A;  1HNZ C;  1L1O C;  1TWA I;  3GTL I;  2RBL A;  3S1Q I;  4DR2 C;  1RLY A;  4DR7 C;  2NVT I;  4BBS I;  2JA5 I;  4DR1 C;  1N34 C;  1KKG A;  4NBF A;  1Y1V S;  2E7G A;  3IEU A;  4DCU A;  3D6W A;  2R7Z I;  5C4J I;  4LF7 C;  2OPL B;  1VLA A;  4NBH A;  4DV7 C;  4DR4 C;  3S14 I;  3GKU A;  2YCB A;  1YUA A;  4K0K C;  1J5E C;  2UUA C;  4NB8 A;  2JS4 A;  4NBB A;  3HOX I;  4A3G I;  4JI8 C;  3RZD I;  2E2H I;  4DV1 C;  3EER A;  3R9X A;  2OPL A;  1NUI A;  4DR3 C;  1PA4 A;  2AKL A;  5IT9 D;  3GCF A;  4A3D I;  4DV0 C;  2VUM I;  3S1R I;  4JI5 C;  2E8F A;  3GTM S;  2PT7 G;  1NYE A;  4NBD A;  1DL6 A;  2UXC C;  5CM2 M;  3K7A I;  3T1H C;  4A3E I;  1I6H I;  1EGA A;  4A3L I;  2NVY I; 
#chains in the Genus database with same CATH topology
 2NVQ I;  1X3W A;  5D1O A;  2KI7 B;  1QM4 A;  2P3Y A;  5CZX A;  5T67 A;  4B3S C;  3S1M I;  2ONF A;  2F4O A;  3PRO C;  3J80 b;  1VQO 1;  4DGL A;  4I9G A;  4MH4 A;  2QEX 1;  1Q7Y 1;  2Z51 A;  3A25 A;  2QKD A;  3GTJ I;  1VQL Z;  1O92 A;  1WH9 A;  2DYJ A;  3VMG A;  3N54 B;  4NXM C;  4JI1 C;  1O93 A;  4MTN A;  4OX9 C;  3M4O I;  4Y7N I;  1LCI A;  3CXC Z;  1USP B;  2OTL Z;  3EED A;  3GTK I;  3CCM Z;  2M6N A;  2OBV A;  1R9T I;  1VQK Z;  2M5O A;  3HOW I;  5C44 I;  3UZ0 A;  3IEV A;  4ZLP A;  1VQ4 Z;  2CXC A;  4AYB A;  4A3I I;  4D4I A;  2VF1 A;  1K9M 1;  3UX3 A;  1N36 C;  3T1Y C;  1PFT A;  1Q86 1;  3CCE 1;  3LNO A;  2Q4Z A;  4BY1 I;  1YJ9 1;  1AMU A;  3E7W A;  1L2F A;  3RV2 A;  4DV3 C;  2UUB C;  1YJ7 A;  5IWA C;  4E2Y A;  1TH5 A;  3S82 A;  5A19 A;  3NDJ A;  4X65 C;  3UEB A;  3IF8 A;  1ML8 A;  1WW9 A;  2YX1 A;  1RY2 A;  5BST A;  2JNY A;  3EQ6 A;  2E2I I;  3CW8 X;  4B3R C;  1ZB8 A;  2RT9 A;  2QL8 A;  3CD6 1;  3HOV I;  1TWH I;  1RO0 A;  2NAP A;  4NBE A;  1M1K 1;  4G1I A;  4GS5 A;  2HHH C;  2F4M A;  1USP A;  4A3F I;  3CCU 1;  1XHJ A;  2RPR A;  1YIT Z;  3G7S A;  2BH1 X;  4KTT A;  1ZB9 A;  3S15 I;  4OYC A;  2RIQ A;  5LCI A;  1M6X A;  3LUS A;  2E0G A;  4AQY C;  4MD7 A;  3A9U A;  3I07 A;  3PES A;  3J80 f;  2LIY A;  5FLX b;  2Y0S A;  3G4S Z;  1JJ2 Z;  2VPW A;  3FCC A;  4LFC C;  3H0G I;  1YI2 Z;  2DE6 A;  1UKK A;  3GTO I;  4DG9 A;  2VPY A;  1P4E C;  4PRO C;  1MDB A;  5KYV A;  2UU9 C;  5AE3 A;  2AYD A;  2O53 A;  1VQ5 1;  4JI7 C;  3QWU A;  2LEX A;  1KQS Y;  4R0M A;  2QRC B;  4RVO A;  4NBA A;  3S2D I;  4MXU A;  5IFI A;  2JMO A;  4RVG A;  1I94 C;  2B63 I;  2JNV A;  2Y4N A;  2PRO A;  4DK1 A;  4BSZ A;  4D57 A;  1KD1 2;  1WII A;  1VQL 1;  4K0B A;  3H3V J;  1MXA A;  1QYP A;  3I56 Z;  2OTL 1;  3B7W A;  4KTV A;  4LF9 C;  3LNV A;  2ASB A;  4E32 A;  2JR6 A;  3S16 I;  4ISB A;  1VQK 1;  5C3E I;  2DE7 A;  1HH2 P;  4BCA A;  4E2Z A;  3G71 Z;  5BR8 C;  1HNX C;  1NY8 A;  3KIF A;  3CC4 Z;  1P7L A;  4FTF A;  1UWD A;  1VQ4 1;  3ETC A;  4X64 C;  1I50 I;  1X0T A;  1T5D X;  2MCQ A;  3E7X A;  4JM1 A;  3NH4 A;  4DCV A;  4JI0 C;  2MMA B;  5LMU C;  1K83 I;  1PU1 A;  2UUC C;  3I4M I;  5BSM A;  4Y52 I;  2YWB A;  3VNS A;  2DPL A;  1SIW A;  3J7A 4;  4NBC A;  3CCS Z;  5T8S A;  1FDI A;  1M90 2;  4A93 I;  4DCS A;  4PUI A;  2F4V C;  2JA6 I;  1V25 A;  1K8A 1;  1T5H X;  4LFB C;  1RO4 A;  5BSU A;  3OTO C;  3HOZ I;  1XNR C;  1W2B Z;  4X6A I;  5AN9 F;  1QVG Y;  4BXX I;  3CC2 Z;  4BY7 I;  4GXQ A;  4DR6 C;  4BC9 A;  2QR1 B;  3CJE A;  3A9V A;  1ZH1 A;  1Q82 2;  2VUG A;  1YIT 1;  4FUT A;  2D7V A;  3DLP X;  4DV2 C;  2E8C A;  5AE2 A;  2D1S A;  3S2H I;  1AA6 A;  2QA4 1;  2ATW A;  1KC8 2;  3L95 X;  1VQN Z;  4QTU A;  4KHP C;  2JIP A;  3G4S 1;  3CC7 Z;  2OOX B;  3KIH A;  1GPM A;  4B3T C;  2EGT A;  2PMZ A;  3CMA 1;  1O90 A;  1HNW C;  1S72 Z;  4DV6 C;  3BG0 B;  4A3K I;  1VQ9 1;  1QVF Z;  2XR1 A;  1YIJ 1;  4LF4 C;  2E5L C;  1WCM I;  2J6A A;  2Y4O A;  3LGX A;  3CCR Z;  4MON A;  1VQ7 1;  1FDO A;  1N8R 1;  1SFO I;  2WP0 C;  3JAM b;  3OW2 Y;  3NYR A;  1YJW Z;  4GKJ C;  1KRL A;  2PM9 A;  4DUZ C;  3A4I A;  5KEI A;  1VQP Z;  2VZE A;  4RV9 A;  4OXI A;  1K73 2;  2V8J A;  3VNQ A;  3CPW Z;  3PO2 I;  4X66 C;  3S1N I;  2CU6 A;  2OZK A;  3S17 I;  4RLF A;  2E7Z A;  3UOW A;  4DG8 A;  2E8E A;  1XNQ C;  1P9N A;  4HGZ A;  1IB8 A;  1NJI 2;  5IP9 I;  3CQZ I;  3J81 b;  3RZO I;  4RVF A;  3U50 C;  2YU9 I;  4A3M I;  5GTD A;  4YY3 C;  4BBR I;  4RM2 A;  2DE5 A;  1BA3 A;  4NXN C;  5IT9 b;  4LFA C;  1XRA A;  3G71 1;  3CC4 1;  1RO2 A;  2JA7 I;  4A3B I;  2ZZN A;  4RLQ A;  3CCJ Z;  4NB9 A;  2JA8 I;  1Z01 A;  2GTH A;  3CCV 1;  4JYA C;  2CY1 A;  2W03 A;  4X62 C;  3GTG I;  3GTP I;  3F3F C;  3IPL A;  3GR0 A;  4DUY C;  2BJO A;  2LFU A;  3TDH B;  3H2T A;  2D1T A;  4GXR A;  4A3J I;  1MXC A;  5DV9 A;  5AE1 A;  1XMQ C;  1Q7Y 2;  2M5H A;  3CCL Z;  3K6R A;  3I55 Z;  1JOS A;  1IBK C;  1N33 C;  3AF6 A;  4R1L A;  2PN2 A;  2NCL A;  4LF5 C;  4JI3 C;  2V8K A;  1IBM C;  1TWG I;  5FLM I;  1MD9 A;  1YJN Z;  1K0R A;  4DQY B;  5ADZ A;  3JAM f;  3SO4 A;  3I4N I;  4DV4 C;  3ETO A;  2UXD C;  2NVX I;  1I3Q I;  3GR1 A;  4RM3 A;  3J80 D;  3AF5 A;  4U5Y D;  1HR0 C;  2QEX Z;  1K9M 2;  3FKI I;  4YHH C;  3AY0 A;  4DCT A;  3MON A;  4E2W A;  3PO3 I;  4EWC A;  3P5J B;  1Q86 2;  1LQL A;  3PBK A;  2YAD A;  3GTM I;  2R93 I;  3CC7 1;  2D28 C;  2K3R A;  3G6E Z;  3CXC Y;  3J81 f;  2DHM A;  1VQM Z;  1S72 1;  4JI2 C;  2PK7 A;  2VPZ A;  3NDI A;  1Q81 1;  1QVF Y;  3JAM D;  5IP7 I;  3CCM 1;  2OTJ Z;  2QRD B;  5A2Q b;  2G2K A;  2HF1 A;  2IZ3 A;  4XX2 A;  1Y1W I;  1M1K 2;  2GTI A;  4FUQ A;  3CCR 1;  5K8F A;  3A26 A;  1YJW 1;  1YJ9 Z;  2JIM A;  1XS3 A;  2ZM6 C;  4LF6 C;  1VEH A;  1MKY A;  3IR7 A;  5FLX f;  1PG4 A;  2Q51 A;  3VB9 A;  3J81 D;  4S1T A;  5KYT A;  4PUG A;  5K85 A;  1NP6 A;  2KZ0 A;  2VQF C;  5E7Q A;  3VMH A;  4BBY A;  2V7B A;  3CCU Z;  4JI4 C;  1X3Z A;  3MZK B;  4QTT A;  2P20 A;  2P2M A;  1RQF A;  1QF8 A;  3BG1 B;  3MZL B;  4TNU A;  2OO4 A;  2QVX X;  3I08 A;  3NI2 A;  1M6X C;  4A3C I;  3GPC A;  4LF8 C;  3Q87 A;  3PO3 S;  2OOY B;  2E2J I;  2UXB C;  4D4G A;  5FLX D;  2JIO A;  2KPI A;  1ULT A;  1YUK A;  2O4H A;  4GKK C;  4NDN A;  3VMI A;  2HJG A;  4E2X A;  1QWI A;  1WJ2 A;  2P2J A;  1YHQ Z;  4B3M C;  1TWC I;  4I9F A;  3HOY I;  5LMN C;  3M3Y I;  3FCE A;  1JJ2 Y;  3NYQ A;  2H85 A;  4RMN A;  1RNI A;  1IBL C;  4NOZ A;  2WB1 A;  4NBG A;  3TDE A;  1FJG C;  4PHT A;  1YI2 1;  2R6M A;  4E33 A;  3CCL 1;  2D1R A;  2W04 A;  3I55 1;  5A2Q f;  3R9W A;  2D1Q A;  4DR5 C;  2IV2 X;  3HOU I;  1TFI A;  5C4X I;  2QVZ X;  4RVH A;  4WS9 A;  1P4E A;  2K5R A;  1KQS Z;  3NPD A;  1N2F A;  4JV5 C;  5T64 A;  2R92 I;  4HPV A;  3GKQ A;  1XMO C;  3NH8 A;  2IZ4 A;  4R1M A;  1O9T A;  2P28 A;  3D9X A;  5BUQ A;  4DV5 C;  1Y1V I;  1TWF I;  5JRH A;  1FLO A;  1N32 C;  2P2F A;  2QW0 X;  1WF3 A;  4ODJ A;  2JIQ A;  3T4N B;  4ZJZ A;  2MM9 A;  4JI6 C;  3F3P C;  1Q16 A;  5A2Q D;  4L7I A;  3HKZ A;  3G6E 1;  1FUG A;  2VQE C;  4L2Z A;  2JMP A;  2V8I A;  2P2B A;  2RHB A;  1VQM 1;  1K8A 2;  3TE5 B;  3DHV A;  3I56 1;  2QVY X;  1V60 A;  3FQM A;  3GTQ I;  2OTJ 1;  2KZF A;  3L8C A;  3ESW A;  3VNR A;  1HNZ C;  1L1O C;  1TWA I;  3GTL I;  2RBL A;  3S1Q I;  2QLV B;  3KXW A;  1WCJ A;  4DR2 C;  1RLY A;  4DR7 C;  1KD1 1;  3LAX A;  3RG2 A;  1XRB A;  4RVN A;  2M48 A;  3CCQ Z;  2NVT I;  2ZAE B;  4BBS I;  2KDN A;  5T6B A;  1VQ6 Z;  1VQ8 Z;  3IML A;  5BUR A;  2AYA A;  3CCS 1;  5LL6 f;  2JA5 I;  4DR1 C;  4NH1 C;  1N34 C;  4MRI A;  3CME Z;  1W2B Y;  2WD9 A;  1QVG Z;  1Z03 A;  2P02 A;  4BC7 A;  4D56 A;  1KKG A;  3D2L A;  4NBF A;  2I3C A;  3CC2 1;  1Y1V S;  1V26 A;  2E7G A;  3IEU A;  3TQI A;  4RS4 A;  4RVD A;  5D1P A;  3D6W A;  1XRC A;  3R44 A;  4WV3 A;  4DCU A;  4HGY A;  2R7Z I;  4PUH A;  3NH5 A;  2JIR A;  5C4J I;  2V3V A;  3TR3 A;  2QA4 Z;  5T8T A;  1M90 1;  3UX2 A;  1QXF A;  4LF7 C;  1VQO Z;  1VLA A;  1N8R 2;  2OPL B;  5BSV A;  4NBH A;  4PZP A;  1YHQ 1;  4G36 A;  3DAY A;  4DV7 C;  3CMA Z;  4E31 A;  1VQN 1;  4DR4 C;  3S14 I;  3GKU A;  2YCB A;  1YUA A;  4K0K C;  1VQ9 Z;  2GU2 A;  2YWC A;  3IX0 A;  4L4Q A;  1J5E C;  2UUA C;  4NB8 A;  1YIJ Z;  1Q82 1;  4IR7 A;  2Y27 A;  1Z02 A;  4CL1 A;  1WZN A;  4HH4 A;  2JS4 A;  4NBB A;  1VQ7 Z;  3C5E A;  2VPX A;  3HOX I;  5IT9 f;  3CQ2 A;  4A3G I;  4TPS B;  2QRE B;  3IFU A;  3OW2 Z;  4MD8 A;  4JI8 C;  4LE5 A;  1KC8 1;  4E30 A;  2WAQ A;  3CCE Z;  5BSW A;  3RZD I;  2E2H I;  2P2Q A;  5BSR A;  1Y8C A;  3TUF A;  4MD9 A;  4DV1 C;  1VQP 1;  4EAT A;  1S7M A;  3CPW Y;  3EER A;  3CQ1 A;  3R9X A;  2OPL A;  1NUI A;  4DR3 C;  3CQ3 A;  1PA4 A;  3CD6 Z;  1PG3 A;  1MXB A;  2AKL A;  4NFR A;  4IZ6 A;  5IT9 D;  3O2E A;  3GCF A;  4A3D I;  5D1O B;  1RG9 A;  4DV0 C;  2HU9 A;  2VUM I;  2VSQ A;  1JWH C;  1K73 1;  3CCV Z;  3S1R I;  4JI5 C;  2D27 A;  2ZZM A;  2E8F A;  3GTM S;  3NFZ A;  2PT7 G;  5H9U A;  3CCJ 1;  1NYE A;  4NBD A;  1DL6 A;  3FQQ A;  5BUS A;  3CCQ 1;  5CM2 M;  3K7A I;  1NJI 1;  2UXC C;  2JUB A;  3VTN A;  3T1H C;  1VQ6 1;  1VQ8 1;  4A3E I;  5CZV A;  1I6H I;  1MDF A;  1EGA A;  3CME 1;  4A3L I;  5A1I A;  1VQ5 Z;  2V45 A;  3N2Q A;  4G37 A;  3CW9 A;  1Q81 2;  2NVY I;  2E9H A;  5A1G A;  1YJN 1; 
#chains in the Genus database with same CATH homology
 2NVQ I;  1X3W A;  5D1O A;  2KI7 B;  1QM4 A;  2P3Y A;  5CZX A;  5T67 A;  4B3S C;  3S1M I;  2ONF A;  2F4O A;  3PRO C;  3J80 b;  1VQO 1;  4DGL A;  4I9G A;  4MH4 A;  2QEX 1;  1Q7Y 1;  2QKD A;  3GTJ I;  1VQL Z;  1O92 A;  1WH9 A;  2DYJ A;  3VMG A;  3N54 B;  4NXM C;  4JI1 C;  1O93 A;  4MTN A;  4OX9 C;  3M4O I;  4Y7N I;  1LCI A;  3CXC Z;  1USP B;  2OTL Z;  3EED A;  3GTK I;  3CCM Z;  2M6N A;  2OBV A;  1R9T I;  1VQK Z;  3HOW I;  5C44 I;  3UZ0 A;  3IEV A;  4ZLP A;  1VQ4 Z;  2CXC A;  4A3I I;  4AYB A;  4D4I A;  2VF1 A;  1K9M 1;  1N36 C;  3T1Y C;  1PFT A;  1Q86 1;  3CCE 1;  2Q4Z A;  4BY1 I;  1YJ9 1;  1AMU A;  3E7W A;  1L2F A;  3RV2 A;  4DV3 C;  2UUB C;  1YJ7 A;  5IWA C;  4E2Y A;  3S82 A;  5A19 A;  3NDJ A;  4X65 C;  3IF8 A;  1ML8 A;  1WW9 A;  1RY2 A;  5BST A;  2JNY A;  3EQ6 A;  2E2I I;  3CW8 X;  4B3R C;  1ZB8 A;  2RT9 A;  2QL8 A;  3CD6 1;  3HOV I;  1TWH I;  1RO0 A;  4NBE A;  1M1K 1;  4G1I A;  4GS5 A;  2HHH C;  2F4M A;  1USP A;  4A3F I;  3CCU 1;  2RPR A;  1YIT Z;  3G7S A;  2BH1 X;  4KTT A;  1ZB9 A;  3S15 I;  4OYC A;  2RIQ A;  3LUS A;  2E0G A;  4AQY C;  4MD7 A;  3A9U A;  3I07 A;  3PES A;  2LIY A;  3J80 f;  5FLX b;  2Y0S A;  3G4S Z;  1JJ2 Z;  3FCC A;  4LFC C;  3H0G I;  1YI2 Z;  2DE6 A;  1UKK A;  3GTO I;  4DG9 A;  4PRO C;  1MDB A;  5KYV A;  2UU9 C;  5AE3 A;  1VQ5 1;  2O53 A;  4JI7 C;  3QWU A;  1KQS Y;  4R0M A;  2QRC B;  4RVO A;  4NBA A;  3S2D I;  4MXU A;  5IFI A;  2JMO A;  4RVG A;  1I94 C;  2B63 I;  2Y4N A;  2PRO A;  4DK1 A;  4BSZ A;  4D57 A;  1KD1 2;  1WII A;  1VQL 1;  4K0B A;  3H3V J;  1MXA A;  1QYP A;  3I56 Z;  2OTL 1;  3B7W A;  4KTV A;  4LF9 C;  3LNV A;  2ASB A;  4E32 A;  2JR6 A;  3S16 I;  4ISB A;  1VQK 1;  5C3E I;  2DE7 A;  1HH2 P;  4BCA A;  4E2Z A;  3G71 Z;  5BR8 C;  1HNX C;  3KIF A;  3CC4 Z;  1P7L A;  4FTF A;  1VQ4 1;  3ETC A;  4X64 C;  1I50 I;  1X0T A;  1T5D X;  3E7X A;  4JM1 A;  3NH4 A;  4DCV A;  4JI0 C;  5LMU C;  2UUC C;  1K83 I;  3I4M I;  5BSM A;  4Y52 I;  2YWB A;  3VNS A;  2DPL A;  3J7A 4;  4NBC A;  3CCS Z;  5T8S A;  1M90 2;  4A93 I;  4DCS A;  2F4V C;  2JA6 I;  1V25 A;  1K8A 1;  1T5H X;  4LFB C;  1RO4 A;  5BSU A;  3OTO C;  3HOZ I;  1XNR C;  1W2B Z;  4X6A I;  5AN9 F;  1QVG Y;  4BXX I;  3CC2 Z;  4BY7 I;  4GXQ A;  4DR6 C;  4BC9 A;  2QR1 B;  3CJE A;  3A9V A;  1ZH1 A;  1Q82 2;  2VUG A;  1YIT 1;  4FUT A;  2D7V A;  3DLP X;  4DV2 C;  2E8C A;  5AE2 A;  2D1S A;  3S2H I;  2ATW A;  2QA4 1;  1KC8 2;  3L95 X;  1VQN Z;  4QTU A;  4KHP C;  3G4S 1;  3CC7 Z;  2OOX B;  3KIH A;  1GPM A;  4B3T C;  2EGT A;  2PMZ A;  3CMA 1;  1O90 A;  1HNW C;  1S72 Z;  4DV6 C;  3BG0 B;  4A3K I;  1VQ9 1;  1QVF Z;  2XR1 A;  1YIJ 1;  4LF4 C;  2E5L C;  1WCM I;  2J6A A;  2Y4O A;  3LGX A;  3CCR Z;  4MON A;  1VQ7 1;  1N8R 1;  1SFO I;  2WP0 C;  3JAM b;  3OW2 Y;  3NYR A;  1YJW Z;  4GKJ C;  1KRL A;  2PM9 A;  4DUZ C;  3A4I A;  5KEI A;  1VQP Z;  2VZE A;  4RV9 A;  4OXI A;  1K73 2;  2V8J A;  3VNQ A;  3CPW Z;  3PO2 I;  4X66 C;  3S1N I;  2OZK A;  3S17 I;  4RLF A;  3UOW A;  4DG8 A;  2E8E A;  1XNQ C;  1P9N A;  4HGZ A;  1NJI 2;  5IP9 I;  3CQZ I;  3J81 b;  3RZO I;  4RVF A;  3U50 C;  2YU9 I;  4A3M I;  5GTD A;  4YY3 C;  4BBR I;  4RM2 A;  2DE5 A;  1BA3 A;  4NXN C;  5IT9 b;  4LFA C;  1XRA A;  3G71 1;  3CC4 1;  1RO2 A;  2JA7 I;  4A3B I;  4RLQ A;  3CCJ Z;  4NB9 A;  2JA8 I;  1Z01 A;  2GTH A;  3CCV 1;  4JYA C;  2CY1 A;  2W03 A;  4X62 C;  3GTG I;  3GTP I;  3F3F C;  3IPL A;  3GR0 A;  4DUY C;  2BJO A;  2LFU A;  3TDH B;  3H2T A;  2D1T A;  4GXR A;  4A3J I;  1MXC A;  5DV9 A;  5AE1 A;  1XMQ C;  1Q7Y 2;  3CCL Z;  3I55 Z;  1JOS A;  1IBK C;  1N33 C;  3AF6 A;  4R1L A;  2PN2 A;  4LF5 C;  4JI3 C;  2V8K A;  1IBM C;  1TWG I;  5FLM I;  1MD9 A;  1YJN Z;  1K0R A;  4DQY B;  5ADZ A;  3JAM f;  3SO4 A;  3I4N I;  4DV4 C;  3ETO A;  2UXD C;  2NVX I;  1I3Q I;  3GR1 A;  4RM3 A;  3J80 D;  3AF5 A;  4U5Y D;  1HR0 C;  2QEX Z;  1K9M 2;  3FKI I;  4YHH C;  4DCT A;  3MON A;  4E2W A;  3PO3 I;  4EWC A;  3P5J B;  1Q86 2;  1LQL A;  3PBK A;  2YAD A;  3GTM I;  2R93 I;  3CC7 1;  2D28 C;  2K3R A;  3G6E Z;  3CXC Y;  3J81 f;  1VQM Z;  1S72 1;  4JI2 C;  2PK7 A;  3NDI A;  1Q81 1;  1QVF Y;  3JAM D;  5IP7 I;  3CCM 1;  2OTJ Z;  2QRD B;  5A2Q b;  2G2K A;  2HF1 A;  2IZ3 A;  4XX2 A;  1Y1W I;  1M1K 2;  2GTI A;  4FUQ A;  3CCR 1;  5K8F A;  1YJW 1;  1YJ9 Z;  2ZM6 C;  4LF6 C;  1MKY A;  5FLX f;  1PG4 A;  2Q51 A;  3VB9 A;  3J81 D;  4S1T A;  5KYT A;  5K85 A;  1NP6 A;  2VQF C;  5E7Q A;  3VMH A;  4BBY A;  2V7B A;  3CCU Z;  4JI4 C;  1X3Z A;  3MZK B;  4QTT A;  2P20 A;  2P2M A;  1RQF A;  1QF8 A;  3BG1 B;  3MZL B;  4TNU A;  2OO4 A;  2QVX X;  3I08 A;  3NI2 A;  4A3C I;  3GPC A;  4LF8 C;  3Q87 A;  3PO3 S;  2OOY B;  2E2J I;  2UXB C;  4D4G A;  5FLX D;  2KPI A;  1ULT A;  1YUK A;  2O4H A;  4GKK C;  4NDN A;  3VMI A;  2HJG A;  4E2X A;  1QWI A;  4B3M C;  2P2J A;  1YHQ Z;  1TWC I;  4I9F A;  3HOY I;  5LMN C;  3M3Y I;  3FCE A;  1JJ2 Y;  3NYQ A;  2H85 A;  4RMN A;  1RNI A;  1IBL C;  4NOZ A;  2WB1 A;  4NBG A;  3TDE A;  1FJG C;  4PHT A;  1YI2 1;  2R6M A;  4E33 A;  3CCL 1;  2D1R A;  2W04 A;  3I55 1;  5A2Q f;  3R9W A;  2D1Q A;  4DR5 C;  3HOU I;  1TFI A;  5C4X I;  2QVZ X;  4RVH A;  4WS9 A;  2K5R A;  1KQS Z;  3NPD A;  1N2F A;  4JV5 C;  5T64 A;  2R92 I;  4HPV A;  3GKQ A;  1XMO C;  3NH8 A;  2IZ4 A;  4R1M A;  1O9T A;  2P28 A;  3D9X A;  5BUQ A;  4DV5 C;  1Y1V I;  1TWF I;  5JRH A;  1N32 C;  2P2F A;  2QW0 X;  1WF3 A;  4ODJ A;  3T4N B;  4ZJZ A;  4JI6 C;  3F3P C;  5A2Q D;  4L7I A;  3HKZ A;  3G6E 1;  1FUG A;  2VQE C;  4L2Z A;  2JMP A;  2V8I A;  2P2B A;  2RHB A;  1VQM 1;  1K8A 2;  3TE5 B;  3DHV A;  3I56 1;  2QVY X;  3FQM A;  3GTQ I;  2OTJ 1;  2KZF A;  3L8C A;  3ESW A;  3VNR A;  1HNZ C;  1L1O C;  1TWA I;  3GTL I;  2RBL A;  3S1Q I;  2QLV B;  3KXW A;  4DR2 C;  1RLY A;  4DR7 C;  1KD1 1;  3LAX A;  3RG2 A;  1XRB A;  4RVN A;  2M48 A;  3CCQ Z;  2NVT I;  2ZAE B;  4BBS I;  5T6B A;  1VQ6 Z;  1VQ8 Z;  3IML A;  5BUR A;  2AYA A;  3CCS 1;  5LL6 f;  2JA5 I;  4DR1 C;  4NH1 C;  1N34 C;  4MRI A;  3CME Z;  1W2B Y;  2WD9 A;  1QVG Z;  1Z03 A;  2P02 A;  4BC7 A;  4D56 A;  1KKG A;  4NBF A;  2I3C A;  3CC2 1;  1Y1V S;  1V26 A;  2E7G A;  3IEU A;  3TQI A;  4RS4 A;  4RVD A;  5D1P A;  3D6W A;  1XRC A;  3R44 A;  4WV3 A;  4DCU A;  4HGY A;  2R7Z I;  3NH5 A;  5C4J I;  2QA4 Z;  5T8T A;  1M90 1;  4LF7 C;  1VQO Z;  1VLA A;  1N8R 2;  2OPL B;  5BSV A;  4NBH A;  4PZP A;  1YHQ 1;  4G36 A;  3DAY A;  4DV7 C;  3CMA Z;  4E31 A;  1VQN 1;  4DR4 C;  3S14 I;  3GKU A;  2YCB A;  1YUA A;  4K0K C;  1VQ9 Z;  2GU2 A;  2YWC A;  3IX0 A;  4L4Q A;  1J5E C;  2UUA C;  4NB8 A;  1YIJ Z;  1Q82 1;  4IR7 A;  2Y27 A;  1Z02 A;  4CL1 A;  1VQ7 Z;  2JS4 A;  4HH4 A;  4NBB A;  3C5E A;  3HOX I;  5IT9 f;  4A3G I;  4TPS B;  2QRE B;  3IFU A;  3OW2 Z;  4MD8 A;  4JI8 C;  4LE5 A;  1KC8 1;  4E30 A;  2WAQ A;  3CCE Z;  5BSW A;  3RZD I;  2E2H I;  2P2Q A;  5BSR A;  3TUF A;  4MD9 A;  4DV1 C;  1VQP 1;  4EAT A;  1S7M A;  3CPW Y;  3EER A;  3R9X A;  2OPL A;  1NUI A;  4DR3 C;  1PA4 A;  3CD6 Z;  1PG3 A;  1MXB A;  2AKL A;  4NFR A;  4IZ6 A;  5IT9 D;  3GCF A;  4A3D I;  5D1O B;  1RG9 A;  4DV0 C;  2HU9 A;  2VUM I;  2VSQ A;  1JWH C;  1K73 1;  3CCV Z;  3S1R I;  4JI5 C;  2D27 A;  2E8F A;  3GTM S;  3NFZ A;  2PT7 G;  5H9U A;  3CCJ 1;  1NYE A;  4NBD A;  1DL6 A;  3FQQ A;  5BUS A;  3CCQ 1;  5CM2 M;  3K7A I;  1NJI 1;  2UXC C;  2JUB A;  3VTN A;  3T1H C;  1VQ6 1;  1VQ8 1;  4A3E I;  5CZV A;  1I6H I;  1MDF A;  1EGA A;  3CME 1;  4A3L I;  5A1I A;  1VQ5 Z;  3N2Q A;  4G37 A;  3CW9 A;  1Q81 2;  2NVY I;  2E9H A;  5A1G A;  1YJN 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...