4XX2A

Ohr from xylella fastidiosa in oxidized state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
141
Chain Sequence
MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ohr from Xylella fastidiosa in oxidized state
rcsb
source organism Xylella fastidiosa (strain 9a5c)
molecule tags Oxidoreductase
molecule keywords Organic hydroperoxide resistance protein
total genus 32
structure length 141
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4xx2A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4xx2A02
1USPA 4JI7C 2R92I 2B63I 1FJGC 1TWHI 3HOUI 1ZB8A 2BJOA 3CQZI 2VQEC 3GTQI 1XMOC 3FKII 2E2II 2UUAC 4GKKC 4B3RC 1HNZC 4DV1C 2D7VA 4LF7C 3T1HC 4BBRI 4DV0C 2HF1A 2R93I 3K7AI 4BY1I 4BSZA 4A3FI 4A93I 4NBCA 1Y1VI 3PO3S 2NVXI 4YY3C 3HOWI 4A3II 1WH9A 4X66C 4JV5C 1NUIA 3D6WA 4DR1C 4LF9C 1I50I 3LUSA 2E7GA 1N34C 3VMIA 3CJEA 5LMUC 1N36C 1WCMI 5LMNC 1TWGI 1JOSA 1SFOI 3Q87A 3GKQA 4JI6C 3GTPI 4KHPC 1I6HI 1WW9A 4DCSA 2NVTI 4X64C 3GTJI 4DCTA 4K0KC 1TFIA 3I07A 2UU9C 4NOZA 3M4OI 4DR2C 2ASBA 2UXDC 2XR1A 1ML8A 1X3WA 5C3EI 4JI0C 3VMGA 3I4MI 2ZM6C 4JI1C 2UXCC 1J5EC 1R9TI 4A3KI 5BR8C 1N33C 3IEUA 4DCUA 1Y1WI 1I3QI 3EERA 3U50C 4A3EI 1UKKA 5C44I 1TWFI 2HJGA 4YHHC 4XX2A 4NXNC 4OX9C 2ATWA 4JYAC 1HNWC 4Y52I 4DV2C 1XNRC 5IP7I 1ZB9A 1HNXC 1HH2P 3HOVI 3GTKI 4A3GI 2KZFA 4JI4C 4DUZC 2DE6A 2JA5I 4B3TC 4LFAC 4LFCC 1QYPA 1L2FA 4DR5C 1XMQC 1HR0C 4DV6C 2E8EA 2YCBA 2E5LC 4MTNA 4MH4A 2JR6A 2UUBC 4BY7I 3OTOC 5FLMI 4B3SC 2JNYA 2EGTA 2E2HI 2KPIA 4NBFA 4NBHA 2JA8I 3HOZI 3S1QI 4JI8C 2PK7A 5IP9I 3GTOI 5CM2M 1MKYA 1PA4A 3S15I 2VUMI 3S1MI 4LF8C 4JI5C 1K83I 4Y7NI 1X3ZA 1N32C 3VB9A 2OPLB 2DYJA 2NVQI 1KKGA 4JI3C 2UXBC 4DCVA 4NBEA 1USPB 4A3JI 2R7ZI 4A3LI 1DL6A 5C4JI 2HHHC 2AKLA 3GTMS 4DV5C 4JI2C 3GTGI 2P3YA 3RZDI 4DV7C 2E2JI 1IBKC 4DR4C 1EGAA 2YU9I 3PO3I 1QWIA 1IBLC 1YUAA 4LF5C 1L1OC 3T1YC 4DR7C 3S14I 1I94C 3S2HI 4X6AI 4A3DI 1K0RA 2JMPA 1TWAI 3HOXI 1PFTA 2ONFA 1VLAA 2JA6I 1Y1VS 4A3BI 4QTUA 4X65C 4DUYC 4DV4C 5FLXD 2K5RA 3S1NI 1LQLA 2VQFC 2JS4A 3GTMI 5A2QD 4BXXI 1IBMC 3M3YI 3H0GI 2J6AA 3J81D 4AQYC 2CY1A 2JA7I 3AF5A 4BBSI 4NB9A 4LFBC 3IEVA 5IWAC 2CXCA 4X62C 1N2FA 1RLYA 1RO4A 1TWCI 3GTLI 1NYEA 3H3VJ 2PT7G 4NXMC 2F4OA 3J80D 5C4XI 3PO2I 2DE5A 3AF6A 4NBAA 4LF6C 4GKJC 4B3MC 5IT9D 2PN2A 2RBLA 3R9WA 3I4NI 4A3MI 4LF4C 1WF3A 2UUCC 1XNQC 4DR6C 3R9XA 2DE7A 3ESWA 4NB8A 2E8CA 2QL8A 4DR3C 2F4VC 4NBGA 4A3CI 3RZOI 4NBBA 3S16I 3S2DI 2F4MA 4NBDA 3GCFA 3S1RI 3JAMD 2OPLA 3HOYI 2NVYI 4QTTA 3VMHA 3GKUA 4DV3C 2E8FA 3S17I
chains in the Genus database with same CATH superfamily
4JI7C 2R92I 1XRAA 3NFZA 1ZB8A 3NDIA 3GTQI 3LNVA 4B3RC 4U5YD 4DV1C 1MD9A 3CCLZ 3CCM1 4A3FI 5ADZA 4A93I 1S7MA 2NVXI 3PO3S 1YJW1 3CCJ1 4K0BA 2O53A 2E0GA 5E7QA 1MDBA 3C5EA 4AYBA 3E7XA 2E7GA 3N54B 3VMIA 2QRCB 5A1GA 1QXFA 2PROA 4KHPC 4RV9A 3CCMZ 5CZXA 4D56A 2NVTI 5AE3A 2E9HA 4E2WA 3M4OI 4DR2C 4FTFA 3MZLB 3CMA1 5T6BA 5BSMA 2ZM6C 4JI1C 5T67A 3CC21 4DK1A 4A3KI 4GKKC 1Y1WI 1I3QI 3EERA 2OTJZ 1MDFA 4OYCA 2P28A 1VQ61 1XNRC 5IP7I 2VSQA 1HNXC 2JIRA 4LE5A 1GPMA 4IR7A 3GR1A 2Q4ZA 3L95X 4TPSB 4IZ6A 1ZH1A 2YCBA 5FLMI 2JNYA 5AN9F 3IR7A 1VQO1 3G71Z 1VQ81 3NDJA 2KPIA 2QA4Z 4NBFA 1K9M2 2JA8I 4PZPA 1W2BZ 3T4NB 3NH4A 1O9TA 2Y0SA 2VUGA 3RV2A 3D9XA 1VQ91 3CCQZ 3I56Z 3F3PC 3CCQ1 1X3ZA 2P2BA 2JIOA 3HKZA 1WJ2A 3LAXA 4R1MA 1YJ7A 1K732 3CC71 3G711 3NH8A 3RZDI 1T5HX 2KZ0A 2G2KA 3PO3I 1QM4A 2QKDA 1KC81 4DR7C 3MONA 3NI2A 2GTHA 4X6AI 4NDNA 5K8FA 2JMPA 3SO4A 3TQIA 1XRBA 3A26A 2JMOA 2QR1B 4X65C 4DUYC 2OTJ1 1QVGZ 3S1NI 5A2QD 1IBMC 3CC2Z 1M6XA 3CMAZ 2J6AA 1K9M1 3RG2A 3AF5A 2IZ4A 5IFIA 3TUFA 3NPDA 2OBVA 3L8CA 3OW2Z 3J80D 3AF6A 4MONA 5IT9D 2OZKA 4ZJZA 5JRHA 3BG1B 3I4NI 4A3MI 1QF8A 1YJNZ 1WF3A 4MD9A 2LFUA 4NH1C 5T8TA 3R9XA 3CCJZ 4OXIA 1YJWZ 3ESWA 2E8CA 2QL8A 3KIFA 2QVXX 1N8R2 3S2DI 4NBDA 3CCL1 2Y4OA 1X0TA 3F3FC 3CW8X 1SIWA 4QTTA 2P2FA 2MCQA 3VTNA 2WB1A 1YI21 5A2Qb 2UUAC 3CQ1A 1NP6A 1M1K2 4RLFA 1YIT1 4RS4A 3T1HC 2HF1A 3K7AI 4BY1I 1FUGA 3VNQA 4PUIA 4NBCA 1QVFY 4RVFA 3CCR1 3OW2Y 4X66C 2E7ZA 4JV5C 2YWBA 4DQYB 1I50I 3LUSA 3G6EZ 3CJEA 5LMUC 1N36C 1TWGI 1JOSA 4RLQA 5A2Qf 2QREB 1FDOA 4JI6C 4D4IA 1Z02A 1I6HI 1WW9A 4X64C 1V25A 4DCTA 5BSRA 1FDIA 2XR1A 2UXCC 3I4MI 2OTLZ 1RG9A 1J5EC 1N33C 3MZKB 3IEUA 5IWAC 4E2YA 5C44I 1TWFI 1UKKA 3H2TA 4XX2A 2JNVA 1HNWC 1TH5A 3I55Z 3GR0A 3GTKI 1MXCA 1VQP1 1NJI1 4GXQA 2DE6A 1RO0A 2D28C 4BCAA 4LFCC 1L2FA 5BSVA 2E8EA 3CMEZ 3IMLA 2NAPA 1P4EC 4BY7I 5GTDA 2UUBC 2EGTA 2JIPA 3CC4Z 3ETCA 1UWDA 3IFUA 4NBHA 2O4HA 1VQN1 2PK7A 1AA6A 4MD8A 1VQK1 3UEBA 2V8KA 4JI5C 2QLVB 3CQ2A 5T64A 3J80b 1P7LA 1N8R1 1N32C 3IF8A 3VB9A 1VQ41 4HGYA 2DYJA 1IB8A 2UXBC 3CCEZ 1S72Z 2ZAEB 4BC7A 2R7ZI 5C4JI 2HHHC 4R0MA 3GTMS 2AYDA 1VQ71 4JI2C 3B7WA 3CXCY 1KRLA 2E2JI 4DR4C 2V3VA 4FUQA 2P2MA 1QWIA 1YUAA 4LF5C 1YJ91 1VQ5Z 1L1OC 1Q862 5AE1A 4HH4A 4A3DI 3N2QA 4I9GA 4A3BI 3CCUZ 5LL6f 2K5RA 1NJI2 3A9UA 2VQFC 4MXUA 3M3YI 4KTVA 3J81D 1Z01A 2D1RA 3UX2A 2YADA 3IEVA 2QEXZ 1KC82 3VNRA 3H3VJ 5BSTA 2QVZX 4G1IA 5C4XI 3EQ6A 4B3MC 3I08A 1Y8CA 3D2LA 3R9WA 3CCS1 1XNQC 4DR6C 1W2BY 2VZEA 1YIJ1 4PHTA 3FQQA 4E2XA 4JM1A 1MXAA 2V8JA 2F4VC 1Q822 3TR3A 3UOWA 4NBBA 3S16I 4R1LA 5KEIA 2D1QA 4PUGA 1FLOA 3CQ3A 2K3RA 3S17I 2YX1A 1FJGC 4RVHA 1TWHI 3HOUI 2BJOA 2JIMA 4GS5A 1YHQZ 1XMOC 3FKII 5KYTA 1VQMZ 3AY0A 1HNZC 2D7VA 4LF7C 3DHVA 5T8SA 1Q16A 2R93I 2LEXA 1XRCA 4BSZA 4NFRA 1Y1VI 3CCVZ 1PU1A 1RO2A 4YY3C 3HOWI 1WH9A 2HU9A 4L7IA 3D6WA 1QVFZ 1XHJA 3FCCA 1JWHC 1WCMI 5LMNC 3CCV1 1SFOI 2WP0C 3GKQA 2OO4A 5BUQA 3GTPI 4DCSA 4K0KC 2DHMA 2GU2A 3GTJI 2UU9C 2ASBA 2RHBA 1JJ2Y 1VQL1 1YHQ1 3DLPX 1ML8A 1X3WA 5C3EI 3KXWA 4JI0C 2MMAB 1O93A 3PESA 4WS9A 1Q7Y1 3PBKA 4NXNC 4OX9C 5LCIA 1Q811 1M901 2Y4NA 3CPWY 5CZVA 4YHHC 1ZB9A 1HH2P 3KIHA 2KI7B 4A3GI 2KZFA 4DUZC 2JA5I 4LFAC 4HGZA 4RM3A 1LCIA 1QYPA 2P02A 1XMQC 1HR0C 3G4SZ 4MTNA 4MH4A 5FLXb 1P9NA 3OTOC 2P2JA 2WAQA 2E2HI 3HOZI 2NCLA 1K8A2 3S1QI 3A4IA 1WIIA 5IP9I 5BSUA 1PA4A 3FQMA 2Q51A 3CD61 1RY2A 4JI8C 2VUMI 4RM2A 4PUHA 3S1MI 1K731 1QVGY 2P20A 2OPLB 2NVQI 1KKGA 2QW0X 3CD6Z 3CXCZ 1USPB 4A3JI 5DV9A 1DL6A 2R6MA 2AKLA 4E30A 1KD11 1RNIA 2P3YA 2Z51A 4DV7C 4ISBA 2KDNA 3NYRA 3J81f 1IBLC 1KD12 2RIQA 1T5DX 3G4S1 4G37A 3T1YC 2M5HA 3A25A 4L4QA 1I94C 3S2HI 2JUBA 1K0RA 3R44A 3TDEA 1VQ7Z 3HOXI 2ONFA 4KTTA 4QTUA 5FLXD 2RPRA 3CCE1 2JS4A 1S721 1PG4A 1VQ4Z 1O90A 3NH5A 3DAYA 2D1SA 1VQLZ 1VQKZ 4EATA 4BBYA 4LFBC 3EEDA 1VQNZ 1RLYA 1RO4A 1TWCI 1Q861 3GTLI 3UX3A 2RT9A 2W03A 2DE5A 3PO2I 4NBAA 3PROC 4LF6C 2V8IA 1RQFA 3CC41 2I3CA 1VEHA 2PN2A 3CW9A 3NYQA 4RMNA 3IX0A 3CME1 4LF4C 1V26A 1Q821 1Q812 5FLXf 1M902 4D4GA 2DE7A 1VQPZ 4NB8A 4DR3C 4DGLA 2M6NA 4NBGA 4A3CI 1XS3A 4BC9A 2F4MA 3S1RI 2GTIA 3JAMD 3JAMf 2DPLA 2LIYA 2OPLA 3HOYI 2NVYI 2IV2X 3VMHA 3GKUA 4WV3A 2E8FA 4EWCA 2QRDB 2VPWA 1USPA 1NY8A 3LGXA 1VQM1 2ZZNA 2OTL1 2B63I 3ETOA 4DG9A 2VQEC 3CQZI 5AE2A 2ZZMA 1WZNA 4I9FA 2E2II 1PG3A 3QWUA 3FCEA 4DG8A 4BBRI 4DV0C 2QVYX 1ULTA 1YUKA 2WD9A 2MM9A 4G36A 4RVDA 4A3II 1AMUA 1NUIA 3G6E1 1YIJZ 4DR1C 4LF9C 2OOYB 1O92A 1N34C 3CCSZ 4ZLPA 4RVOA 1WCJA 3G7SA 3Q87A 2IZ3A 2H85A 2VF1A 2QEX1 1JJ2Z 1TFIA 5BURA 3I07A 4NOZA 2W04A 1YITZ 2UXDC 2M5OA 2D1TA 2YWCA 5D1OA 3VMGA 1YI2Z 1R9TI 5BR8C 4DCUA 2HJGA 3U50C 4A3EI 4JYAC 1P4EA 3E7WA 3CCU1 2OOXB 2V45A 1KQSY 4Y52I 4DV2C 3HOVI 4JI4C 4S1TA 4L2ZA 4B3TC 1K8A1 1MXBA 5BUSA 4DR5C 4DV6C 1VQ51 1YJ9Z 2E5LC 2V7BA 2P2QA 4CL1A 2JR6A 1YJN1 4GXRA 4B3SC 3TE5B 3UZ0A 4MRIA 3P5JB 4RVNA 3GTOI 1MKYA 5CM2M 3LNOA 3S15I 4E32A 4LF8C 2VPXA 1K83I 4E31A 4Y7NI 1Q7Y2 5H9UA 3K6RA 4E33A 5IT9f 3J7A4 3JAMb 4JI3C 1Z03A 4DCVA 4NBEA 2VPZA 4A3LI 5D1OB 4DV5C 2PMZA 3GTGI 1IBKC 1EGAA 4D57A 2YU9I 4HPVA 2M48A 4TNUA 3S14I 1TWAI 3I551 1PFTA 5K85A 5D1PA 1VLAA 3CC7Z 2JA6I 1Y1VS 3VNSA 4DV4C 3S82A 2JIQA 1LQLA 3GTMI 4BXXI 3H0GI 3A9VA 3CPWZ 3GPCA 3I561 4AQYC 1VQ9Z 2CY1A 2VPYA 3J80f 2JA7I 2D27A 4BBSI 5A1IA 3J81b 4NB9A 1M1K1 1V60A 4E2ZA 3O2EA 4ODJA 2CXCA 4X62C 1N2FA 2BH1X 4NXMC 1NYEA 2QA41 2PT7G 2ATWA 4GKJC 2F4OA 1VQ8Z 1VQOZ 4PROC 4MD7A 2RBLA 3TDHB 1BA3A 5BSWA 2Y27A 5KYVA 3BG0B 2UUCC 4RVGA 1KQSZ 5A19A 4FUTA 3IPLA 3CCRZ 2CU6A 2AYAA 3RZOI 1VQ6Z 5IT9b 3GCFA 1M6XC 2PM9A 4DV3C
chains in the Genus database with same CATH topology
4JI7C 2R92I 1XRAA 3NFZA 1ZB8A 3NDIA 3GTQI 3LNVA 4B3RC 4U5YD 4DV1C 1MD9A 3CCLZ 3CCM1 4A3FI 5ADZA 4A93I 1S7MA 2NVXI 3PO3S 1YJW1 3CCJ1 4K0BA 2O53A 2E0GA 5E7QA 1MDBA 3C5EA 4AYBA 3E7XA 2E7GA 3N54B 3VMIA 2QRCB 5A1GA 2PROA 4KHPC 4RV9A 3CCMZ 5CZXA 4D56A 2NVTI 5AE3A 2E9HA 4E2WA 3M4OI 4DR2C 4FTFA 3MZLB 3CMA1 5T6BA 5BSMA 2ZM6C 4JI1C 5T67A 3CC21 4DK1A 4A3KI 4GKKC 1Y1WI 1I3QI 3EERA 2OTJZ 1MDFA 4OYCA 2P28A 1VQ61 1XNRC 5IP7I 2VSQA 1HNXC 4LE5A 1GPMA 4IR7A 3GR1A 2Q4ZA 3L95X 4TPSB 4IZ6A 1ZH1A 2YCBA 5FLMI 2JNYA 5AN9F 1VQO1 3G71Z 1VQ81 3NDJA 2KPIA 2QA4Z 4NBFA 1K9M2 2JA8I 4PZPA 1W2BZ 3T4NB 3NH4A 1O9TA 2Y0SA 2VUGA 3RV2A 3D9XA 1VQ91 3CCQZ 3I56Z 3F3PC 3CCQ1 1X3ZA 2P2BA 3HKZA 3LAXA 4R1MA 1YJ7A 1K732 3CC71 3G711 3NH8A 3RZDI 1T5HX 2G2KA 3PO3I 1QM4A 2QKDA 1KC81 4DR7C 3MONA 3NI2A 2GTHA 4X6AI 4NDNA 5K8FA 2JMPA 3SO4A 3TQIA 1XRBA 2JMOA 2QR1B 4X65C 4DUYC 2OTJ1 1QVGZ 3S1NI 5A2QD 1IBMC 3CC2Z 3CMAZ 2J6AA 1K9M1 3RG2A 3AF5A 2IZ4A 5IFIA 3TUFA 3NPDA 2OBVA 3L8CA 3OW2Z 3J80D 3AF6A 4MONA 5IT9D 2OZKA 4ZJZA 5JRHA 3BG1B 3I4NI 4A3MI 1QF8A 1YJNZ 1WF3A 4MD9A 2LFUA 4NH1C 5T8TA 3R9XA 3CCJZ 4OXIA 1YJWZ 3ESWA 2E8CA 2QL8A 3KIFA 2QVXX 1N8R2 3S2DI 4NBDA 3CCL1 2Y4OA 1X0TA 3F3FC 3CW8X 4QTTA 2P2FA 3VTNA 2WB1A 1YI21 5A2Qb 2UUAC 1NP6A 1M1K2 4RLFA 1YIT1 4RS4A 3T1HC 2HF1A 3K7AI 4BY1I 1FUGA 3VNQA 4NBCA 1QVFY 4RVFA 3CCR1 3OW2Y 4X66C 4JV5C 2YWBA 4DQYB 1I50I 3LUSA 3G6EZ 3CJEA 5LMUC 1N36C 1TWGI 1JOSA 4RLQA 5A2Qf 2QREB 4JI6C 4D4IA 1Z02A 1I6HI 1WW9A 4X64C 1V25A 4DCTA 5BSRA 2XR1A 2UXCC 3I4MI 2OTLZ 1RG9A 1J5EC 1N33C 3MZKB 3IEUA 5IWAC 4E2YA 5C44I 1TWFI 1UKKA 3H2TA 4XX2A 1HNWC 3I55Z 3GR0A 3GTKI 1MXCA 1VQP1 1NJI1 4GXQA 2DE6A 1RO0A 2D28C 4BCAA 4LFCC 1L2FA 5BSVA 2E8EA 3CMEZ 3IMLA 2UUBC 4BY7I 5GTDA 2EGTA 3CC4Z 3ETCA 3IFUA 4NBHA 2O4HA 1VQN1 2PK7A 4MD8A 1VQK1 2V8KA 4JI5C 2QLVB 5T64A 3J80b 1P7LA 1N8R1 1N32C 3IF8A 3VB9A 1VQ41 4HGYA 2DYJA 2UXBC 3CCEZ 1S72Z 2ZAEB 4BC7A 2R7ZI 5C4JI 2HHHC 4R0MA 3GTMS 4JI2C 1VQ71 3B7WA 3CXCY 1KRLA 2E2JI 4DR4C 4FUQA 2P2MA 1QWIA 1YUAA 4LF5C 1YJ91 1VQ5Z 1L1OC 1Q862 5AE1A 4HH4A 4A3DI 3N2QA 4I9GA 4A3BI 3CCUZ 5LL6f 2K5RA 1NJI2 3A9UA 2VQFC 4MXUA 3M3YI 4KTVA 3J81D 1Z01A 2D1RA 2YADA 3IEVA 2QEXZ 1KC82 3VNRA 3H3VJ 5BSTA 2QVZX 4G1IA 5C4XI 3EQ6A 4B3MC 3I08A 3R9WA 3CCS1 1XNQC 4DR6C 1W2BY 2VZEA 1YIJ1 4PHTA 3FQQA 4E2XA 4JM1A 1MXAA 2V8JA 2F4VC 1Q822 3UOWA 4NBBA 3S16I 4R1LA 5KEIA 2D1QA 2K3RA 3S17I 1FJGC 4RVHA 1TWHI 3HOUI 2BJOA 4GS5A 1YHQZ 1XMOC 3FKII 5KYTA 1VQMZ 1HNZC 2D7VA 4LF7C 3DHVA 5T8SA 2R93I 1XRCA 4BSZA 4NFRA 1Y1VI 3CCVZ 1RO2A 4YY3C 3HOWI 1WH9A 2HU9A 4L7IA 3D6WA 1QVFZ 3FCCA 1JWHC 1WCMI 5LMNC 3CCV1 1SFOI 2WP0C 3GKQA 2OO4A 5BUQA 3GTPI 4DCSA 4K0KC 2GU2A 3GTJI 2UU9C 2ASBA 2RHBA 1JJ2Y 1VQL1 1YHQ1 3DLPX 1ML8A 1X3WA 5C3EI 3KXWA 4JI0C 1O93A 3PESA 4WS9A 1Q7Y1 3PBKA 4NXNC 4OX9C 1Q811 1M901 2Y4NA 3CPWY 5CZVA 4YHHC 1ZB9A 1HH2P 3KIHA 2KI7B 4A3GI 2KZFA 4DUZC 2JA5I 4LFAC 4HGZA 4RM3A 1LCIA 1QYPA 2P02A 1XMQC 1HR0C 3G4SZ 4MTNA 4MH4A 5FLXb 1P9NA 3OTOC 2P2JA 2WAQA 2E2HI 3HOZI 3A4IA 1K8A2 3S1QI 5BSUA 1WIIA 5IP9I 4JI8C 1PA4A 3FQMA 2Q51A 3CD61 1RY2A 2VUMI 4RM2A 3S1MI 1K731 1QVGY 2P20A 2OPLB 2NVQI 1KKGA 2QW0X 3CD6Z 3CXCZ 1USPB 4A3JI 5DV9A 1DL6A 2R6MA 2AKLA 4E30A 1KD11 1RNIA 2P3YA 4DV7C 4ISBA 3NYRA 3J81f 1IBLC 1KD12 2RIQA 1T5DX 3G4S1 4G37A 3T1YC 4L4QA 1I94C 3S2HI 2JUBA 1K0RA 3R44A 3TDEA 1VQ7Z 3HOXI 2ONFA 4KTTA 4QTUA 5FLXD 2RPRA 3CCE1 2JS4A 1S721 1PG4A 1VQ4Z 1O90A 3NH5A 3DAYA 2D1SA 1VQLZ 1VQKZ 4EATA 4BBYA 4LFBC 3EEDA 1VQNZ 1RLYA 1RO4A 1TWCI 1Q861 3GTLI 2RT9A 2W03A 2DE5A 3PO2I 4NBAA 3PROC 4LF6C 2V8IA 1RQFA 3CC41 2I3CA 2PN2A 3CW9A 3NYQA 4RMNA 3IX0A 3CME1 4LF4C 1V26A 1Q821 1Q812 5FLXf 1M902 4D4GA 2DE7A 1VQPZ 4NB8A 4DR3C 4DGLA 2M6NA 4NBGA 4A3CI 4BC9A 2F4MA 3S1RI 2GTIA 3JAMD 3JAMf 2DPLA 2LIYA 2OPLA 3HOYI 2NVYI 3GKUA 3VMHA 4WV3A 2E8FA 4EWCA 2QRDB 3LGXA 1USPA 1VQM1 2OTL1 2B63I 3ETOA 4DG9A 2VQEC 3CQZI 5AE2A 4I9FA 2E2II 1PG3A 3QWUA 3FCEA 4DG8A 4BBRI 4DV0C 2QVYX 1ULTA 1YUKA 2WD9A 4G36A 4RVDA 4A3II 1AMUA 1NUIA 3G6E1 1YIJZ 4DR1C 4LF9C 2OOYB 1O92A 1N34C 3CCSZ 4ZLPA 4RVOA 3G7SA 3Q87A 2IZ3A 2H85A 2VF1A 2QEX1 1JJ2Z 1TFIA 5BURA 3I07A 4NOZA 2W04A 1YITZ 2UXDC 2D1TA 2YWCA 5D1OA 3VMGA 1YI2Z 1R9TI 5BR8C 4DCUA 2HJGA 3U50C 4A3EI 4JYAC 3E7WA 3CCU1 2OOXB 1KQSY 4Y52I 4DV2C 3HOVI 4JI4C 4S1TA 4L2ZA 4B3TC 1K8A1 1MXBA 5BUSA 4DR5C 4DV6C 1VQ51 1YJ9Z 2E5LC 2V7BA 2P2QA 4CL1A 2JR6A 1YJN1 4GXRA 4B3SC 3TE5B 3UZ0A 4MRIA 3P5JB 4RVNA 3GTOI 1MKYA 5CM2M 3S15I 4E32A 4LF8C 1K83I 4E31A 4Y7NI 1Q7Y2 5H9UA 4E33A 5IT9f 3J7A4 3JAMb 4JI3C 1Z03A 4DCVA 4NBEA 4A3LI 5D1OB 4DV5C 2PMZA 3GTGI 1IBKC 1EGAA 4D57A 2YU9I 4HPVA 2M48A 4TNUA 3S14I 1TWAI 3I551 1PFTA 5K85A 5D1PA 1VLAA 3CC7Z 2JA6I 1Y1VS 3VNSA 4DV4C 3S82A 1LQLA 3GTMI 4BXXI 3H0GI 3A9VA 3CPWZ 3GPCA 3I561 4AQYC 1VQ9Z 2CY1A 3J80f 2JA7I 2D27A 4BBSI 5A1IA 3J81b 4NB9A 1M1K1 4ODJA 4E2ZA 2CXCA 4X62C 1N2FA 2BH1X 4NXMC 1NYEA 2QA41 2PT7G 2ATWA 4GKJC 2F4OA 1VQ8Z 1VQOZ 4PROC 4MD7A 2RBLA 3TDHB 1BA3A 5BSWA 2Y27A 5KYVA 3BG0B 2UUCC 4RVGA 1KQSZ 5A19A 4FUTA 3IPLA 3CCRZ 2AYAA 3RZOI 1VQ6Z 5IT9b 3GCFA 2PM9A 4DV3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  4JI7 C;  2R92 I;  2B63 I;  1FJG C;  1TWH I;  3HOU I;  1ZB8 A;  2BJO A;  3CQZ I;  2VQE C;  3GTQ I;  1XMO C;  3FKI I;  2E2I I;  2UUA C;  4GKK C;  4B3R C;  1HNZ C;  4DV1 C;  2D7V A;  4LF7 C;  3T1H C;  4BBR I;  4DV0 C;  2HF1 A;  2R93 I;  3K7A I;  4BY1 I;  4BSZ A;  4A3F I;  4A93 I;  4NBC A;  1Y1V I;  3PO3 S;  2NVX I;  4YY3 C;  3HOW I;  4A3I I;  1WH9 A;  4X66 C;  4JV5 C;  1NUI A;  3D6W A;  4DR1 C;  4LF9 C;  1I50 I;  3LUS A;  2E7G A;  1N34 C;  3VMI A;  3CJE A;  5LMU C;  1N36 C;  1WCM I;  5LMN C;  1TWG I;  1JOS A;  1SFO I;  3Q87 A;  3GKQ A;  4JI6 C;  3GTP I;  4KHP C;  1I6H I;  1WW9 A;  4DCS A;  2NVT I;  4X64 C;  3GTJ I;  4DCT A;  4K0K C;  1TFI A;  3I07 A;  2UU9 C;  4NOZ A;  3M4O I;  4DR2 C;  2ASB A;  2UXD C;  2XR1 A;  1ML8 A;  1X3W A;  5C3E I;  4JI0 C;  3VMG A;  3I4M I;  2ZM6 C;  4JI1 C;  2UXC C;  1J5E C;  1R9T I;  4A3K I;  5BR8 C;  1N33 C;  3IEU A;  4DCU A;  1Y1W I;  1I3Q I;  3EER A;  3U50 C;  4A3E I;  1UKK A;  5C44 I;  1TWF I;  2HJG A;  4YHH C;  4XX2 A;  4NXN C;  4OX9 C;  2ATW A;  4JYA C;  1HNW C;  4Y52 I;  4DV2 C;  1XNR C;  5IP7 I;  1ZB9 A;  1HNX C;  1HH2 P;  3HOV I;  3GTK I;  4A3G I;  2KZF A;  4JI4 C;  4DUZ C;  2DE6 A;  2JA5 I;  4B3T C;  4LFA C;  4LFC C;  1QYP A;  1L2F A;  4DR5 C;  1XMQ C;  1HR0 C;  4DV6 C;  2E8E A;  2YCB A;  2E5L C;  4MTN A;  4MH4 A;  2JR6 A;  2UUB C;  4BY7 I;  3OTO C;  5FLM I;  4B3S C;  2JNY A;  2EGT A;  2E2H I;  2KPI A;  4NBF A;  4NBH A;  2JA8 I;  3HOZ I;  3S1Q I;  4JI8 C;  2PK7 A;  5IP9 I;  3GTO I;  5CM2 M;  1MKY A;  1PA4 A;  3S15 I;  2VUM I;  3S1M I;  4LF8 C;  4JI5 C;  1K83 I;  4Y7N I;  1X3Z A;  1N32 C;  3VB9 A;  2OPL B;  2DYJ A;  2NVQ I;  1KKG A;  4JI3 C;  2UXB C;  4DCV A;  4NBE A;  1USP B;  4A3J I;  2R7Z I;  4A3L I;  1DL6 A;  5C4J I;  2HHH C;  2AKL A;  3GTM S;  4DV5 C;  4JI2 C;  3GTG I;  2P3Y A;  3RZD I;  4DV7 C;  2E2J I;  1IBK C;  4DR4 C;  1EGA A;  2YU9 I;  3PO3 I;  1QWI A;  1IBL C;  1YUA A;  4LF5 C;  1L1O C;  3T1Y C;  4DR7 C;  3S14 I;  1I94 C;  3S2H I;  4X6A I;  4A3D I;  1K0R A;  2JMP A;  1TWA I;  3HOX I;  1PFT A;  2ONF A;  1VLA A;  2JA6 I;  1Y1V S;  4A3B I;  4QTU A;  4X65 C;  4DUY C;  4DV4 C;  5FLX D;  2K5R A;  3S1N I;  1LQL A;  2VQF C;  2JS4 A;  3GTM I;  5A2Q D;  4BXX I;  1IBM C;  3M3Y I;  3H0G I;  2J6A A;  3J81 D;  4AQY C;  2CY1 A;  2JA7 I;  3AF5 A;  4BBS I;  4NB9 A;  4LFB C;  3IEV A;  5IWA C;  2CXC A;  4X62 C;  1N2F A;  1RLY A;  1RO4 A;  1TWC I;  3GTL I;  1NYE A;  3H3V J;  2PT7 G;  4NXM C;  2F4O A;  3J80 D;  5C4X I;  3PO2 I;  2DE5 A;  3AF6 A;  4NBA A;  4LF6 C;  4GKJ C;  4B3M C;  5IT9 D;  2PN2 A;  2RBL A;  3R9W A;  3I4N I;  4A3M I;  4LF4 C;  1WF3 A;  2UUC C;  1XNQ C;  4DR6 C;  3R9X A;  2DE7 A;  3ESW A;  4NB8 A;  2E8C A;  2QL8 A;  4DR3 C;  2F4V C;  4NBG A;  4A3C I;  3RZO I;  4NBB A;  3S16 I;  3S2D I;  2F4M A;  4NBD A;  3GCF A;  3S1R I;  3JAM D;  2OPL A;  3HOY I;  2NVY I;  4QTT A;  3VMH A;  3GKU A;  4DV3 C;  2E8F A;  3S17 I; 
#chains in the Genus database with same CATH topology
 4JI7 C;  2R92 I;  1XRA A;  3NFZ A;  1ZB8 A;  3NDI A;  3GTQ I;  3LNV A;  4B3R C;  4U5Y D;  4DV1 C;  1MD9 A;  3CCL Z;  3CCM 1;  4A3F I;  5ADZ A;  4A93 I;  1S7M A;  2NVX I;  3PO3 S;  1YJW 1;  3CCJ 1;  4K0B A;  2O53 A;  2E0G A;  5E7Q A;  1MDB A;  3C5E A;  4AYB A;  3E7X A;  2E7G A;  3N54 B;  3VMI A;  2QRC B;  5A1G A;  1QXF A;  2PRO A;  4KHP C;  4RV9 A;  3CCM Z;  5CZX A;  4D56 A;  2NVT I;  5AE3 A;  2E9H A;  4E2W A;  3M4O I;  4DR2 C;  4FTF A;  3MZL B;  3CMA 1;  5T6B A;  5BSM A;  2ZM6 C;  4JI1 C;  5T67 A;  3CC2 1;  4DK1 A;  4A3K I;  4GKK C;  1Y1W I;  1I3Q I;  3EER A;  2OTJ Z;  1MDF A;  4OYC A;  2P28 A;  1VQ6 1;  1XNR C;  5IP7 I;  2VSQ A;  1HNX C;  2JIR A;  4LE5 A;  1GPM A;  4IR7 A;  3GR1 A;  2Q4Z A;  3L95 X;  4TPS B;  4IZ6 A;  1ZH1 A;  2YCB A;  5FLM I;  2JNY A;  5AN9 F;  3IR7 A;  1VQO 1;  3G71 Z;  1VQ8 1;  3NDJ A;  2KPI A;  2QA4 Z;  4NBF A;  1K9M 2;  2JA8 I;  4PZP A;  1W2B Z;  3T4N B;  3NH4 A;  1O9T A;  2Y0S A;  2VUG A;  3RV2 A;  3D9X A;  1VQ9 1;  3CCQ Z;  3I56 Z;  3F3P C;  3CCQ 1;  1X3Z A;  2P2B A;  2JIO A;  3HKZ A;  1WJ2 A;  3LAX A;  4R1M A;  1YJ7 A;  1K73 2;  3CC7 1;  3G71 1;  3NH8 A;  3RZD I;  1T5H X;  2KZ0 A;  2G2K A;  3PO3 I;  1QM4 A;  2QKD A;  1KC8 1;  4DR7 C;  3MON A;  3NI2 A;  2GTH A;  4X6A I;  4NDN A;  5K8F A;  2JMP A;  3SO4 A;  3TQI A;  1XRB A;  3A26 A;  2JMO A;  2QR1 B;  4X65 C;  4DUY C;  2OTJ 1;  1QVG Z;  3S1N I;  5A2Q D;  1IBM C;  3CC2 Z;  1M6X A;  3CMA Z;  2J6A A;  1K9M 1;  3RG2 A;  3AF5 A;  2IZ4 A;  5IFI A;  3TUF A;  3NPD A;  2OBV A;  3L8C A;  3OW2 Z;  3J80 D;  3AF6 A;  4MON A;  5IT9 D;  2OZK A;  4ZJZ A;  5JRH A;  3BG1 B;  3I4N I;  4A3M I;  1QF8 A;  1YJN Z;  1WF3 A;  4MD9 A;  2LFU A;  4NH1 C;  5T8T A;  3R9X A;  3CCJ Z;  4OXI A;  1YJW Z;  3ESW A;  2E8C A;  2QL8 A;  3KIF A;  2QVX X;  1N8R 2;  3S2D I;  4NBD A;  3CCL 1;  2Y4O A;  1X0T A;  3F3F C;  3CW8 X;  1SIW A;  4QTT A;  2P2F A;  2MCQ A;  3VTN A;  2WB1 A;  1YI2 1;  5A2Q b;  2UUA C;  3CQ1 A;  1NP6 A;  1M1K 2;  4RLF A;  1YIT 1;  4RS4 A;  3T1H C;  2HF1 A;  3K7A I;  4BY1 I;  1FUG A;  3VNQ A;  4PUI A;  4NBC A;  1QVF Y;  4RVF A;  3CCR 1;  3OW2 Y;  4X66 C;  2E7Z A;  4JV5 C;  2YWB A;  4DQY B;  1I50 I;  3LUS A;  3G6E Z;  3CJE A;  5LMU C;  1N36 C;  1TWG I;  1JOS A;  4RLQ A;  5A2Q f;  2QRE B;  1FDO A;  4JI6 C;  4D4I A;  1Z02 A;  1I6H I;  1WW9 A;  4X64 C;  1V25 A;  4DCT A;  5BSR A;  1FDI A;  2XR1 A;  2UXC C;  3I4M I;  2OTL Z;  1RG9 A;  1J5E C;  1N33 C;  3MZK B;  3IEU A;  5IWA C;  4E2Y A;  5C44 I;  1TWF I;  1UKK A;  3H2T A;  4XX2 A;  2JNV A;  1HNW C;  1TH5 A;  3I55 Z;  3GR0 A;  3GTK I;  1MXC A;  1VQP 1;  1NJI 1;  4GXQ A;  2DE6 A;  1RO0 A;  2D28 C;  4BCA A;  4LFC C;  1L2F A;  5BSV A;  2E8E A;  3CME Z;  3IML A;  2NAP A;  1P4E C;  4BY7 I;  5GTD A;  2UUB C;  2EGT A;  2JIP A;  3CC4 Z;  3ETC A;  1UWD A;  3IFU A;  4NBH A;  2O4H A;  1VQN 1;  2PK7 A;  1AA6 A;  4MD8 A;  1VQK 1;  3UEB A;  2V8K A;  4JI5 C;  2QLV B;  3CQ2 A;  5T64 A;  3J80 b;  1P7L A;  1N8R 1;  1N32 C;  3IF8 A;  3VB9 A;  1VQ4 1;  4HGY A;  2DYJ A;  1IB8 A;  2UXB C;  3CCE Z;  1S72 Z;  2ZAE B;  4BC7 A;  2R7Z I;  5C4J I;  2HHH C;  4R0M A;  3GTM S;  2AYD A;  1VQ7 1;  4JI2 C;  3B7W A;  3CXC Y;  1KRL A;  2E2J I;  4DR4 C;  2V3V A;  4FUQ A;  2P2M A;  1QWI A;  1YUA A;  4LF5 C;  1YJ9 1;  1VQ5 Z;  1L1O C;  1Q86 2;  5AE1 A;  4HH4 A;  4A3D I;  3N2Q A;  4I9G A;  4A3B I;  3CCU Z;  5LL6 f;  2K5R A;  1NJI 2;  3A9U A;  2VQF C;  4MXU A;  3M3Y I;  4KTV A;  3J81 D;  1Z01 A;  2D1R A;  3UX2 A;  2YAD A;  3IEV A;  2QEX Z;  1KC8 2;  3VNR A;  3H3V J;  5BST A;  2QVZ X;  4G1I A;  5C4X I;  3EQ6 A;  4B3M C;  3I08 A;  1Y8C A;  3D2L A;  3R9W A;  3CCS 1;  1XNQ C;  4DR6 C;  1W2B Y;  2VZE A;  1YIJ 1;  4PHT A;  3FQQ A;  4E2X A;  4JM1 A;  1MXA A;  2V8J A;  2F4V C;  1Q82 2;  3TR3 A;  3UOW A;  4NBB A;  3S16 I;  4R1L A;  5KEI A;  2D1Q A;  4PUG A;  1FLO A;  3CQ3 A;  2K3R A;  3S17 I;  2YX1 A;  1FJG C;  4RVH A;  1TWH I;  3HOU I;  2BJO A;  2JIM A;  4GS5 A;  1YHQ Z;  1XMO C;  3FKI I;  5KYT A;  1VQM Z;  3AY0 A;  1HNZ C;  2D7V A;  4LF7 C;  3DHV A;  5T8S A;  1Q16 A;  2R93 I;  2LEX A;  1XRC A;  4BSZ A;  4NFR A;  1Y1V I;  3CCV Z;  1PU1 A;  1RO2 A;  4YY3 C;  3HOW I;  1WH9 A;  2HU9 A;  4L7I A;  3D6W A;  1QVF Z;  1XHJ A;  3FCC A;  1JWH C;  1WCM I;  5LMN C;  3CCV 1;  1SFO I;  2WP0 C;  3GKQ A;  2OO4 A;  5BUQ A;  3GTP I;  4DCS A;  4K0K C;  2DHM A;  2GU2 A;  3GTJ I;  2UU9 C;  2ASB A;  2RHB A;  1JJ2 Y;  1VQL 1;  1YHQ 1;  3DLP X;  1ML8 A;  1X3W A;  5C3E I;  3KXW A;  4JI0 C;  2MMA B;  1O93 A;  3PES A;  4WS9 A;  1Q7Y 1;  3PBK A;  4NXN C;  4OX9 C;  5LCI A;  1Q81 1;  1M90 1;  2Y4N A;  3CPW Y;  5CZV A;  4YHH C;  1ZB9 A;  1HH2 P;  3KIH A;  2KI7 B;  4A3G I;  2KZF A;  4DUZ C;  2JA5 I;  4LFA C;  4HGZ A;  4RM3 A;  1LCI A;  1QYP A;  2P02 A;  1XMQ C;  1HR0 C;  3G4S Z;  4MTN A;  4MH4 A;  5FLX b;  1P9N A;  3OTO C;  2P2J A;  2WAQ A;  2E2H I;  3HOZ I;  2NCL A;  1K8A 2;  3S1Q I;  3A4I A;  1WII A;  5IP9 I;  5BSU A;  1PA4 A;  3FQM A;  2Q51 A;  3CD6 1;  1RY2 A;  4JI8 C;  2VUM I;  4RM2 A;  4PUH A;  3S1M I;  1K73 1;  1QVG Y;  2P20 A;  2OPL B;  2NVQ I;  1KKG A;  2QW0 X;  3CD6 Z;  3CXC Z;  1USP B;  4A3J I;  5DV9 A;  1DL6 A;  2R6M A;  2AKL A;  4E30 A;  1KD1 1;  1RNI A;  2P3Y A;  2Z51 A;  4DV7 C;  4ISB A;  2KDN A;  3NYR A;  3J81 f;  1IBL C;  1KD1 2;  2RIQ A;  1T5D X;  3G4S 1;  4G37 A;  3T1Y C;  2M5H A;  3A25 A;  4L4Q A;  1I94 C;  3S2H I;  2JUB A;  1K0R A;  3R44 A;  3TDE A;  1VQ7 Z;  3HOX I;  2ONF A;  4KTT A;  4QTU A;  5FLX D;  2RPR A;  3CCE 1;  2JS4 A;  1S72 1;  1PG4 A;  1VQ4 Z;  1O90 A;  3NH5 A;  3DAY A;  2D1S A;  1VQL Z;  1VQK Z;  4EAT A;  4BBY A;  4LFB C;  3EED A;  1VQN Z;  1RLY A;  1RO4 A;  1TWC I;  1Q86 1;  3GTL I;  3UX3 A;  2RT9 A;  2W03 A;  2DE5 A;  3PO2 I;  4NBA A;  3PRO C;  4LF6 C;  2V8I A;  1RQF A;  3CC4 1;  2I3C A;  1VEH A;  2PN2 A;  3CW9 A;  3NYQ A;  4RMN A;  3IX0 A;  3CME 1;  4LF4 C;  1V26 A;  1Q82 1;  1Q81 2;  5FLX f;  1M90 2;  4D4G A;  2DE7 A;  1VQP Z;  4NB8 A;  4DR3 C;  4DGL A;  2M6N A;  4NBG A;  4A3C I;  1XS3 A;  4BC9 A;  2F4M A;  3S1R I;  2GTI A;  3JAM D;  3JAM f;  2DPL A;  2LIY A;  2OPL A;  3HOY I;  2NVY I;  2IV2 X;  3VMH A;  3GKU A;  4WV3 A;  2E8F A;  4EWC A;  2QRD B;  2VPW A;  1USP A;  1NY8 A;  3LGX A;  1VQM 1;  2ZZN A;  2OTL 1;  2B63 I;  3ETO A;  4DG9 A;  2VQE C;  3CQZ I;  5AE2 A;  2ZZM A;  1WZN A;  4I9F A;  2E2I I;  1PG3 A;  3QWU A;  3FCE A;  4DG8 A;  4BBR I;  4DV0 C;  2QVY X;  1ULT A;  1YUK A;  2WD9 A;  2MM9 A;  4G36 A;  4RVD A;  4A3I I;  1AMU A;  1NUI A;  3G6E 1;  1YIJ Z;  4DR1 C;  4LF9 C;  2OOY B;  1O92 A;  1N34 C;  3CCS Z;  4ZLP A;  4RVO A;  1WCJ A;  3G7S A;  3Q87 A;  2IZ3 A;  2H85 A;  2VF1 A;  2QEX 1;  1JJ2 Z;  1TFI A;  5BUR A;  3I07 A;  4NOZ A;  2W04 A;  1YIT Z;  2UXD C;  2M5O A;  2D1T A;  2YWC A;  5D1O A;  3VMG A;  1YI2 Z;  1R9T I;  5BR8 C;  4DCU A;  2HJG A;  3U50 C;  4A3E I;  4JYA C;  1P4E A;  3E7W A;  3CCU 1;  2OOX B;  2V45 A;  1KQS Y;  4Y52 I;  4DV2 C;  3HOV I;  4JI4 C;  4S1T A;  4L2Z A;  4B3T C;  1K8A 1;  1MXB A;  5BUS A;  4DR5 C;  4DV6 C;  1VQ5 1;  1YJ9 Z;  2E5L C;  2V7B A;  2P2Q A;  4CL1 A;  2JR6 A;  1YJN 1;  4GXR A;  4B3S C;  3TE5 B;  3UZ0 A;  4MRI A;  3P5J B;  4RVN A;  3GTO I;  1MKY A;  5CM2 M;  3LNO A;  3S15 I;  4E32 A;  4LF8 C;  2VPX A;  1K83 I;  4E31 A;  4Y7N I;  1Q7Y 2;  5H9U A;  3K6R A;  4E33 A;  5IT9 f;  3J7A 4;  3JAM b;  4JI3 C;  1Z03 A;  4DCV A;  4NBE A;  2VPZ A;  4A3L I;  5D1O B;  4DV5 C;  2PMZ A;  3GTG I;  1IBK C;  1EGA A;  4D57 A;  2YU9 I;  4HPV A;  2M48 A;  4TNU A;  3S14 I;  1TWA I;  3I55 1;  1PFT A;  5K85 A;  5D1P A;  1VLA A;  3CC7 Z;  2JA6 I;  1Y1V S;  3VNS A;  4DV4 C;  3S82 A;  2JIQ A;  1LQL A;  3GTM I;  4BXX I;  3H0G I;  3A9V A;  3CPW Z;  3GPC A;  3I56 1;  4AQY C;  1VQ9 Z;  2CY1 A;  2VPY A;  3J80 f;  2JA7 I;  2D27 A;  4BBS I;  5A1I A;  3J81 b;  4NB9 A;  1M1K 1;  1V60 A;  4E2Z A;  3O2E A;  4ODJ A;  2CXC A;  4X62 C;  1N2F A;  2BH1 X;  4NXM C;  1NYE A;  2QA4 1;  2PT7 G;  2ATW A;  4GKJ C;  2F4O A;  1VQ8 Z;  1VQO Z;  4PRO C;  4MD7 A;  2RBL A;  3TDH B;  1BA3 A;  5BSW A;  2Y27 A;  5KYV A;  3BG0 B;  2UUC C;  4RVG A;  1KQS Z;  5A19 A;  4FUT A;  3IPL A;  3CCR Z;  2CU6 A;  2AYA A;  3RZO I;  1VQ6 Z;  5IT9 b;  3GCF A;  1M6X C;  2PM9 A;  4DV3 C; 
#chains in the Genus database with same CATH homology
 4JI7 C;  2R92 I;  1XRA A;  3NFZ A;  1ZB8 A;  3NDI A;  3GTQ I;  3LNV A;  4B3R C;  4U5Y D;  4DV1 C;  1MD9 A;  3CCL Z;  3CCM 1;  4A3F I;  5ADZ A;  4A93 I;  1S7M A;  2NVX I;  3PO3 S;  1YJW 1;  3CCJ 1;  4K0B A;  2O53 A;  2E0G A;  5E7Q A;  1MDB A;  3C5E A;  4AYB A;  3E7X A;  2E7G A;  3N54 B;  3VMI A;  2QRC B;  5A1G A;  2PRO A;  4KHP C;  4RV9 A;  3CCM Z;  5CZX A;  4D56 A;  2NVT I;  5AE3 A;  2E9H A;  4E2W A;  3M4O I;  4DR2 C;  4FTF A;  3MZL B;  3CMA 1;  5T6B A;  5BSM A;  2ZM6 C;  4JI1 C;  5T67 A;  3CC2 1;  4DK1 A;  4A3K I;  4GKK C;  1Y1W I;  1I3Q I;  3EER A;  2OTJ Z;  1MDF A;  4OYC A;  2P28 A;  1VQ6 1;  1XNR C;  5IP7 I;  2VSQ A;  1HNX C;  4LE5 A;  1GPM A;  4IR7 A;  3GR1 A;  2Q4Z A;  3L95 X;  4TPS B;  4IZ6 A;  1ZH1 A;  2YCB A;  5FLM I;  2JNY A;  5AN9 F;  1VQO 1;  3G71 Z;  1VQ8 1;  3NDJ A;  2KPI A;  2QA4 Z;  4NBF A;  1K9M 2;  2JA8 I;  4PZP A;  1W2B Z;  3T4N B;  3NH4 A;  1O9T A;  2Y0S A;  2VUG A;  3RV2 A;  3D9X A;  1VQ9 1;  3CCQ Z;  3I56 Z;  3F3P C;  3CCQ 1;  1X3Z A;  2P2B A;  3HKZ A;  3LAX A;  4R1M A;  1YJ7 A;  1K73 2;  3CC7 1;  3G71 1;  3NH8 A;  3RZD I;  1T5H X;  2G2K A;  3PO3 I;  1QM4 A;  2QKD A;  1KC8 1;  4DR7 C;  3MON A;  3NI2 A;  2GTH A;  4X6A I;  4NDN A;  5K8F A;  2JMP A;  3SO4 A;  3TQI A;  1XRB A;  2JMO A;  2QR1 B;  4X65 C;  4DUY C;  2OTJ 1;  1QVG Z;  3S1N I;  5A2Q D;  1IBM C;  3CC2 Z;  3CMA Z;  2J6A A;  1K9M 1;  3RG2 A;  3AF5 A;  2IZ4 A;  5IFI A;  3TUF A;  3NPD A;  2OBV A;  3L8C A;  3OW2 Z;  3J80 D;  3AF6 A;  4MON A;  5IT9 D;  2OZK A;  4ZJZ A;  5JRH A;  3BG1 B;  3I4N I;  4A3M I;  1QF8 A;  1YJN Z;  1WF3 A;  4MD9 A;  2LFU A;  4NH1 C;  5T8T A;  3R9X A;  3CCJ Z;  4OXI A;  1YJW Z;  3ESW A;  2E8C A;  2QL8 A;  3KIF A;  2QVX X;  1N8R 2;  3S2D I;  4NBD A;  3CCL 1;  2Y4O A;  1X0T A;  3F3F C;  3CW8 X;  4QTT A;  2P2F A;  3VTN A;  2WB1 A;  1YI2 1;  5A2Q b;  2UUA C;  1NP6 A;  1M1K 2;  4RLF A;  1YIT 1;  4RS4 A;  3T1H C;  2HF1 A;  3K7A I;  4BY1 I;  1FUG A;  3VNQ A;  4NBC A;  1QVF Y;  4RVF A;  3CCR 1;  3OW2 Y;  4X66 C;  4JV5 C;  2YWB A;  4DQY B;  1I50 I;  3LUS A;  3G6E Z;  3CJE A;  5LMU C;  1N36 C;  1TWG I;  1JOS A;  4RLQ A;  5A2Q f;  2QRE B;  4JI6 C;  4D4I A;  1Z02 A;  1I6H I;  1WW9 A;  4X64 C;  1V25 A;  4DCT A;  5BSR A;  2XR1 A;  2UXC C;  3I4M I;  2OTL Z;  1RG9 A;  1J5E C;  1N33 C;  3MZK B;  3IEU A;  5IWA C;  4E2Y A;  5C44 I;  1TWF I;  1UKK A;  3H2T A;  4XX2 A;  1HNW C;  3I55 Z;  3GR0 A;  3GTK I;  1MXC A;  1VQP 1;  1NJI 1;  4GXQ A;  2DE6 A;  1RO0 A;  2D28 C;  4BCA A;  4LFC C;  1L2F A;  5BSV A;  2E8E A;  3CME Z;  3IML A;  2UUB C;  4BY7 I;  5GTD A;  2EGT A;  3CC4 Z;  3ETC A;  3IFU A;  4NBH A;  2O4H A;  1VQN 1;  2PK7 A;  4MD8 A;  1VQK 1;  2V8K A;  4JI5 C;  2QLV B;  5T64 A;  3J80 b;  1P7L A;  1N8R 1;  1N32 C;  3IF8 A;  3VB9 A;  1VQ4 1;  4HGY A;  2DYJ A;  2UXB C;  3CCE Z;  1S72 Z;  2ZAE B;  4BC7 A;  2R7Z I;  5C4J I;  2HHH C;  4R0M A;  3GTM S;  4JI2 C;  1VQ7 1;  3B7W A;  3CXC Y;  1KRL A;  2E2J I;  4DR4 C;  4FUQ A;  2P2M A;  1QWI A;  1YUA A;  4LF5 C;  1YJ9 1;  1VQ5 Z;  1L1O C;  1Q86 2;  5AE1 A;  4HH4 A;  4A3D I;  3N2Q A;  4I9G A;  4A3B I;  3CCU Z;  5LL6 f;  2K5R A;  1NJI 2;  3A9U A;  2VQF C;  4MXU A;  3M3Y I;  4KTV A;  3J81 D;  1Z01 A;  2D1R A;  2YAD A;  3IEV A;  2QEX Z;  1KC8 2;  3VNR A;  3H3V J;  5BST A;  2QVZ X;  4G1I A;  5C4X I;  3EQ6 A;  4B3M C;  3I08 A;  3R9W A;  3CCS 1;  1XNQ C;  4DR6 C;  1W2B Y;  2VZE A;  1YIJ 1;  4PHT A;  3FQQ A;  4E2X A;  4JM1 A;  1MXA A;  2V8J A;  2F4V C;  1Q82 2;  3UOW A;  4NBB A;  3S16 I;  4R1L A;  5KEI A;  2D1Q A;  2K3R A;  3S17 I;  1FJG C;  4RVH A;  1TWH I;  3HOU I;  2BJO A;  4GS5 A;  1YHQ Z;  1XMO C;  3FKI I;  5KYT A;  1VQM Z;  1HNZ C;  2D7V A;  4LF7 C;  3DHV A;  5T8S A;  2R93 I;  1XRC A;  4BSZ A;  4NFR A;  1Y1V I;  3CCV Z;  1RO2 A;  4YY3 C;  3HOW I;  1WH9 A;  2HU9 A;  4L7I A;  3D6W A;  1QVF Z;  3FCC A;  1JWH C;  1WCM I;  5LMN C;  3CCV 1;  1SFO I;  2WP0 C;  3GKQ A;  2OO4 A;  5BUQ A;  3GTP I;  4DCS A;  4K0K C;  2GU2 A;  3GTJ I;  2UU9 C;  2ASB A;  2RHB A;  1JJ2 Y;  1VQL 1;  1YHQ 1;  3DLP X;  1ML8 A;  1X3W A;  5C3E I;  3KXW A;  4JI0 C;  1O93 A;  3PES A;  4WS9 A;  1Q7Y 1;  3PBK A;  4NXN C;  4OX9 C;  1Q81 1;  1M90 1;  2Y4N A;  3CPW Y;  5CZV A;  4YHH C;  1ZB9 A;  1HH2 P;  3KIH A;  2KI7 B;  4A3G I;  2KZF A;  4DUZ C;  2JA5 I;  4LFA C;  4HGZ A;  4RM3 A;  1LCI A;  1QYP A;  2P02 A;  1XMQ C;  1HR0 C;  3G4S Z;  4MTN A;  4MH4 A;  5FLX b;  1P9N A;  3OTO C;  2P2J A;  2WAQ A;  2E2H I;  3HOZ I;  3A4I A;  1K8A 2;  3S1Q I;  5BSU A;  1WII A;  5IP9 I;  4JI8 C;  1PA4 A;  3FQM A;  2Q51 A;  3CD6 1;  1RY2 A;  2VUM I;  4RM2 A;  3S1M I;  1K73 1;  1QVG Y;  2P20 A;  2OPL B;  2NVQ I;  1KKG A;  2QW0 X;  3CD6 Z;  3CXC Z;  1USP B;  4A3J I;  5DV9 A;  1DL6 A;  2R6M A;  2AKL A;  4E30 A;  1KD1 1;  1RNI A;  2P3Y A;  4DV7 C;  4ISB A;  3NYR A;  3J81 f;  1IBL C;  1KD1 2;  2RIQ A;  1T5D X;  3G4S 1;  4G37 A;  3T1Y C;  4L4Q A;  1I94 C;  3S2H I;  2JUB A;  1K0R A;  3R44 A;  3TDE A;  1VQ7 Z;  3HOX I;  2ONF A;  4KTT A;  4QTU A;  5FLX D;  2RPR A;  3CCE 1;  2JS4 A;  1S72 1;  1PG4 A;  1VQ4 Z;  1O90 A;  3NH5 A;  3DAY A;  2D1S A;  1VQL Z;  1VQK Z;  4EAT A;  4BBY A;  4LFB C;  3EED A;  1VQN Z;  1RLY A;  1RO4 A;  1TWC I;  1Q86 1;  3GTL I;  2RT9 A;  2W03 A;  2DE5 A;  3PO2 I;  4NBA A;  3PRO C;  4LF6 C;  2V8I A;  1RQF A;  3CC4 1;  2I3C A;  2PN2 A;  3CW9 A;  3NYQ A;  4RMN A;  3IX0 A;  3CME 1;  4LF4 C;  1V26 A;  1Q82 1;  1Q81 2;  5FLX f;  1M90 2;  4D4G A;  2DE7 A;  1VQP Z;  4NB8 A;  4DR3 C;  4DGL A;  2M6N A;  4NBG A;  4A3C I;  4BC9 A;  2F4M A;  3S1R I;  2GTI A;  3JAM D;  3JAM f;  2DPL A;  2LIY A;  2OPL A;  3HOY I;  2NVY I;  3GKU A;  3VMH A;  4WV3 A;  2E8F A;  4EWC A;  2QRD B;  3LGX A;  1USP A;  1VQM 1;  2OTL 1;  2B63 I;  3ETO A;  4DG9 A;  2VQE C;  3CQZ I;  5AE2 A;  4I9F A;  2E2I I;  1PG3 A;  3QWU A;  3FCE A;  4DG8 A;  4BBR I;  4DV0 C;  2QVY X;  1ULT A;  1YUK A;  2WD9 A;  4G36 A;  4RVD A;  4A3I I;  1AMU A;  1NUI A;  3G6E 1;  1YIJ Z;  4DR1 C;  4LF9 C;  2OOY B;  1O92 A;  1N34 C;  3CCS Z;  4ZLP A;  4RVO A;  3G7S A;  3Q87 A;  2IZ3 A;  2H85 A;  2VF1 A;  2QEX 1;  1JJ2 Z;  1TFI A;  5BUR A;  3I07 A;  4NOZ A;  2W04 A;  1YIT Z;  2UXD C;  2D1T A;  2YWC A;  5D1O A;  3VMG A;  1YI2 Z;  1R9T I;  5BR8 C;  4DCU A;  2HJG A;  3U50 C;  4A3E I;  4JYA C;  3E7W A;  3CCU 1;  2OOX B;  1KQS Y;  4Y52 I;  4DV2 C;  3HOV I;  4JI4 C;  4S1T A;  4L2Z A;  4B3T C;  1K8A 1;  1MXB A;  5BUS A;  4DR5 C;  4DV6 C;  1VQ5 1;  1YJ9 Z;  2E5L C;  2V7B A;  2P2Q A;  4CL1 A;  2JR6 A;  1YJN 1;  4GXR A;  4B3S C;  3TE5 B;  3UZ0 A;  4MRI A;  3P5J B;  4RVN A;  3GTO I;  1MKY A;  5CM2 M;  3S15 I;  4E32 A;  4LF8 C;  1K83 I;  4E31 A;  4Y7N I;  1Q7Y 2;  5H9U A;  4E33 A;  5IT9 f;  3J7A 4;  3JAM b;  4JI3 C;  1Z03 A;  4DCV A;  4NBE A;  4A3L I;  5D1O B;  4DV5 C;  2PMZ A;  3GTG I;  1IBK C;  1EGA A;  4D57 A;  2YU9 I;  4HPV A;  2M48 A;  4TNU A;  3S14 I;  1TWA I;  3I55 1;  1PFT A;  5K85 A;  5D1P A;  1VLA A;  3CC7 Z;  2JA6 I;  1Y1V S;  3VNS A;  4DV4 C;  3S82 A;  1LQL A;  3GTM I;  4BXX I;  3H0G I;  3A9V A;  3CPW Z;  3GPC A;  3I56 1;  4AQY C;  1VQ9 Z;  2CY1 A;  3J80 f;  2JA7 I;  2D27 A;  4BBS I;  5A1I A;  3J81 b;  4NB9 A;  1M1K 1;  4ODJ A;  4E2Z A;  2CXC A;  4X62 C;  1N2F A;  2BH1 X;  4NXM C;  1NYE A;  2QA4 1;  2PT7 G;  2ATW A;  4GKJ C;  2F4O A;  1VQ8 Z;  1VQO Z;  4PRO C;  4MD7 A;  2RBL A;  3TDH B;  1BA3 A;  5BSW A;  2Y27 A;  5KYV A;  3BG0 B;  2UUC C;  4RVG A;  1KQS Z;  5A19 A;  4FUT A;  3IPL A;  3CCR Z;  2AYA A;  3RZO I;  1VQ6 Z;  5IT9 b;  3GCF A;  2PM9 A;  4DV3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...