4XX2A

Ohr from xylella fastidiosa in oxidized state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
141
Chain Sequence
b'MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Organic hydroperoxide resistance protein
publication title Ohr from Xylella fastidiosa in oxidized state
rcsb
source organism Xylella fastidiosa (strain 9a5c)
molecule tags Oxidoreductase
total genus 32
structure length 141
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4xx2A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4xx2A02
2UXDC 1N2FA 3HOVI 1HNXC 3HOYI 1XMQC 1L2FA 4DCSA 4LF7C 5C4XI 2NVXI 2JS4A 4BY7I 2E8FA 2E2JI 2NVYI 4LF6C 1I3QI 4DCUA 4A3LI 4NBAA 3GTQI 2UUAC 4JI7C 2NVQI 4A3MI 3ESWA 2E5LC 2R93I 2VQEC 1QWIA 2JR6A 3S1RI 1N36C 1QYPA 3D6WA 4NBCA 5BR8C 1WW9A 2JA8I 1SFOI 2PK7A 2KPIA 1FJGC 2E7GA 4DV6C 2EGTA 4X64C 4NOZA 2JA5I 3CQZI 4A3CI 3AF6A 1ML8A 2NVTI 1XNQC 3K7AI 2DE6A 1XMOC 2UXCC 2JA6I 4Y7NI 2AKLA 1TWCI 4LF8C 4NXMC 4BXXI 4NBGA 3RZOI 3GTPI 1N32C 2F4VC 4BBRI 4A3JI 4A3II 5C4JI 3VMHA 1RO4A 4A3DI 2D7VA 5FLMI 4QTUA 3VMIA 1TWHI 1VLAA 3GTLI 3OTOC 1EGAA 3HOWI 3S16I 2UUBC 1HNZC 3S2HI 2CY1A 2UXBC 4A3FI 1ZB8A 4NBEA 1NUIA 4MH4A 1XNRC 4X6AI 2DYJA 4B3TC 4OX9C 4DR2C 1WF3A 4DR6C 3J81D 1X3WA 2XR1A 2QL8A 4DV0C 2JNYA 4NBFA 2F4OA 2OPLB 3CJEA 4B3SC 1I6HI 1Y1VS 1PFTA 2DE5A 4X66C 1IBMC 1IBKC 1WCMI 1YUAA 1R9TI 2PT7G 4NXNC 4LF9C 3Q87A 1J5EC 3S1NI 2P3YA 1TWAI 4B3RC 4LFAC 3S17I 4DV2C 4NB8A 3HOUI 4QTTA 3R9XA 4DV7C 4DCVA 4BSZA 2VQFC 1USPB 2PN2A 4X62C 3EERA 2JA7I 1LQLA 1ZB9A 3S2DI 1PA4A 2BJOA 4JI8C 2DE7A 2ASBA 3PO3I 4NB9A 5FLXD 1Y1WI 1K83I 4LF4C 5A2QD 2ATWA 4KHPC 4JI1C 3S1QI 4LFBC 4JV5C 3GTOI 3S1MI 3I07A 5C3EI 4K0KC 4NBHA 3IEUA 4Y52I 4A3BI 3R9WA 3T1HC 4B3MC 2OPLA 2YU9I 5C44I 5IT9D 3GTKI 3J80D 3GTGI 1HNWC 4GKKC 1I50I 4JI6C 3U50C 4JI3C 1N34C 4LFCC 4DV3C 3GTJI 1KKGA 1IBLC 1HR0C 1WH9A 3HOZI 4JI0C 5LMNC 1TWFI 2E2II 1UKKA 3HOXI 3H0GI 1L1OC 2HF1A 4JI5C 4NBDA 2ONFA 1I94C 4LF5C 3GKQA 2K5RA 3RZDI 1USPA 4DCTA 1TWGI 1X3ZA 4GKJC 3GTMI 4DV5C 3I4NI 5LMUC 2E8CA 4DR7C 5IP9I 3T1YC 4JI2C 5CM2M 4XX2A 3JAMD 3FKII 4X65C 3GKUA 2VUMI 2JMPA 1RLYA 3IEVA 2ZM6C 3S15I 1HH2P 4BBSI 4A93I 4DR3C 3M3YI 2R92I 4YY3C 1DL6A 2E8EA 4DR1C 2R7ZI 3GTMS 1K0RA 3M4OI 4DR5C 4A3EI 4BY1I 4A3KI 1TFIA 4DUYC 2RBLA 2CXCA 3PO2I 3AF5A 1MKYA 3GCFA 5IP7I 4NBBA 2UUCC 2HJGA 5IWAC 1NYEA 1Y1VI 2E2HI 2KZFA 3VMGA 1N33C 4JI4C 2UU9C 4JYAC 4YHHC 4DV4C 4AQYC 3LUSA 2B63I 1JOSA 3VB9A 2YCBA 3S14I 3PO3S 4A3GI 4DV1C 4MTNA 3I4MI 2J6AA 4DUZC 2F4MA 2HHHC 4DR4C 3H3VJ
chains in the Genus database with same CATH superfamily
2QRCB 3CCS1 1Q812 2UXDC 1N2FA 3TE5B 4FUQA 3HOVI 1HNXC 3HOYI 1XMQC 1L2FA 3VNSA 4DCSA 1VQ61 1N8R2 5C4XI 1P4EC 4LF7C 2NVXI 1YIJ1 2JS4A 3KIFA 2D28C 3T4NB 3CC41 4BY7I 2E8FA 4D4GA 1Q811 2E2JI 2NVYI 3G7SA 4LF6C 2OBVA 3CCR1 1YJNZ 2OTLZ 2MM9A 2HU9A 1I3QI 4DCUA 1QVGZ 4MD8A 3MZKB 4NBAA 3GTQI 4A3LI 2QEX1 3CCUZ 2NVQI 1MD9A 2UUAC 4JI7C 4A3MI 1N8R1 2Q4ZA 3CCMZ 1WCJA 2GTIA 3ESWA 2E5LC 3A9UA 2R93I 1YUKA 3E7XA 2VQEC 4MD7A 3CD61 4RVNA 1QWIA 4E31A 1Q7Y2 1PG4A 2P02A 4IZ6A 4L2ZA 4E33A 2JR6A 4D57A 3S1RI 4PUGA 2NCLA 1QYPA 1Y8CA 2RPRA 2V8IA 1N36C 1GPMA 3D6WA 4NBCA 2M48A 3I561 5BR8C 1WW9A 4R1MA 2JA8I 2VPZA 1SFOI 1Q7Y1 2BH1X 2PK7A 2KPIA 2MMAB 2DPLA 2PROA 4MONA 1VQ81 4ZJZA 1FJGC 2E7GA 4RLFA 1QXFA 4DV6C 3G6EZ 2EGTA 3J81f 4RVGA 4X64C 3CPWZ 1VQ5Z 4L4QA 1JJ2Y 4MD9A 4NOZA 4E2ZA 2P2FA 3CW8X 4BBYA 2JA5I 3G6E1 2QA41 2YADA 3CQZI 4A3CI 3AF6A 1ML8A 2NVTI 1XNQC 1MDFA 3MONA 1KQSY 3K7AI 2DE6A 1XMOC 2QLVB 2D1TA 3DHVA 2UXCC 2JA6I 4PHTA 4Y7NI 2AKLA 4BC9A 4CL1A 2KDNA 1VQKZ 1RY2A 1XNRC 4PZPA 1TWCI 3CCJ1 4LF8C 2D1QA 4BXXI 4NXMC 2LFUA 4NBGA 4NFRA 1Q16A 2W04A 3RZOI 1YITZ 1PU1A 4R1LA 1M901 2DHMA 3GTPI 2Y4NA 4U5YD 1N32C 2RT9A 2F4VC 4I9GA 4BBRI 1XHJA 1M1K2 4PROC 4A3JI 2JMOA 3IX0A 4A3II 5C4JI 3VMHA 2QVYX 1Z02A 1RO4A 4A3DI 4RLQA 3J7A4 5LCIA 2MCQA 1FDOA 1BA3A 5FLMI 4QTUA 1VQ7Z 2D7VA 3I551 3E7WA 3VMIA 5T8SA 1VQN1 4IR7A 1TWHI 2I3CA 1VLAA 4RS4A 4D4IA 1S72Z 3GTLI 4RVFA 3OTOC 5AE1A 1M1K1 5T67A 3HOWI 1EGAA 3S16I 2UUBC 2H85A 3UX3A 3CC7Z 2WP0C 2VPXA 1HNZC 1RQFA 3S2HI 2D1RA 2CY1A 1FLOA 2UXBC 4A3FI 1ZB8A 4NBEA 5T64A 3DLPX 1XRAA 3LAXA 1WJ2A 1NUIA 4MH4A 2GTHA 2RIQA 4GXRA 2P2JA 4JM1A 1W2BZ 3CCE1 4X6AI 1Z01A 2AYAA 2LEXA 2DYJA 1TH5A 4B3TC 1VQPZ 1VQO1 4OX9C 2Q51A 2Y27A 3G4S1 4DR2C 5FLXb 1WF3A 3CME1 1VQ41 4E32A 1X0TA 4HGZA 1YI2Z 4DR6C 3J81D 1MXCA 1X3WA 2XR1A 2QL8A 4DV0C 2KI7B 2QKDA 3IF8A 2JNYA 4D56A 5A2Qb 1VQ91 2Z51A 2P20A 3NDIA 4NBFA 2F4OA 5FLXf 2OPLB 3CJEA 1Z03A 5BUQA 4GS5A 3CQ1A 3ETOA 4PUHA 2QVZX 4B3SC 4R0MA 3EEDA 2JNVA 3D9XA 5A2Qf 4ZLPA 3KXWA 1I6HI 5A19A 2IZ3A 1Y1VS 1PFTA 3AY0A 2DE5A 4X66C 2Y0SA 4NDNA 1IBKC 1IBMC 1WCMI 4E2XA 2V8JA 1YJN1 1YUAA 2OTL1 2IZ4A 3B7WA 5CZVA 1R9TI 3FCEA 3CMAZ 2PT7G 4NXNC 4DQYB 3CCU1 2VUGA 3L8CA 3Q87A 1J5EC 4LF9C 3CCM1 3IMLA 3S1NI 2P3YA 2M5HA 5IT9b 4NH1C 2KZ0A 4WV3A 2ZZNA 5JRHA 3CXCY 1TWAI 4B3RC 3IPLA 3J80b 2VPWA 5AE2A 2PMZA 4GXQA 1KQSZ 4LFAC 4HH4A 3O2EA 3S17I 3QWUA 4DV2C 4NB8A 3J81b 1RNIA 3HOUI 5IT9f 2V3VA 4QTTA 3TDHB 2E0GA 3R9XA 3J80f 4DV7C 3NPDA 2E9HA 4DCVA 4BSZA 2VQFC 1USPB 2PN2A 4OYCA 4X62C 1M6XA 2O53A 1SIWA 1P7LA 3EERA 2JA7I 1LQLA 3G71Z 1O92A 1MXAA 3D2LA 2K3RA 5A1GA 2V7BA 1ZB9A 2RHBA 1VQ51 2QR1B 3S2DI 3DAYA 4RVOA 5KEIA 1PA4A 3CC2Z 1M902 2BJOA 4JI8C 1YJWZ 2P2MA 4S1TA 2DE7A 2YX1A 2ASBA 3PO3I 3OW2Y 3PROC 2JUBA 3IR7A 1YJ7A 4NB9A 5FLXD 3TDEA 1Y1WI 3IFUA 5AN9F 1T5DX 3FQMA 5BUSA 4DGLA 5IFIA 1VQLZ 4EATA 1K83I 4LF4C 1VQK1 5A2QD 3NH4A 1QM4A 1V60A 4I9FA 1VQMZ 2ATWA 4KHPC 1YIT1 4HPVA 4JI1C 2P2QA 3CQ2A 3S1QI 3TQIA 2IV2X 1XS3A 4LFBC 4JV5C 3GTOI 5BSRA 3JAMb 2M6NA 1P9NA 3S1MI 3I07A 2CU6A 5C3EI 4K0KC 2QRDB 2OOYB 4NBHA 1XRBA 5E7QA 3IEUA 3L95X 2YWCA 2Y4OA 3S82A 4Y52I 1VQ71 3CCVZ 5D1OB 4BC7A 1YJ9Z 3JAMf 1KD12 2WB1A 3CCLZ 3CPWY 3H2TA 3PBKA 1S721 1K9M2 4A3BI 5ADZA 4HGYA 1KC82 3R9WA 3T1HC 4B3MC 2OPLA 4FUTA 2YU9I 5KYTA 5C44I 5BURA 3CC71 5IT9D 4G1IA 5K85A 3A9VA 2R6MA 2D27A 5BSMA 3GR1A 3GTKI 3J80D 3P5JB 2AYDA 2JIOA 3CCQZ 1KD11 3GTGI 3A26A 5AE3A 1K9M1 1HNWC 4GKKC 2VF1A 2OZKA 1KC81 1VQP1 1Q862 4DG9A 1I50I 3NDJA 5T6BA 4JI6C 3U50C 3F3PC 3NYQA 4JI3C 1O93A 1N34C 1JWHC 3CQ3A 5BSTA 4PUIA 1YI21 4LFCC 3A4IA 3CXCZ 4DV3C 2M5OA 4RVDA 3GTJI 1KKGA 1IBLC 3NH5A 1HR0C 3CCSZ 1WH9A 3HOZI 5H9UA 4JI0C 5LMNC 1TWFI 1Q861 2E2II 1WZNA 1UKKA 3TUFA 3GR0A 3HOXI 3H0GI 2PM9A 2NAPA 1L1OC 2HF1A 4JI5C 2O4HA 1K732 4NBDA 1VQ6Z 2ONFA 3CW9A 1I94C 3MZLB 4OXIA 1YIJZ 2JIMA 2ZAEB 2QREB 3UOWA 3CC4Z 4LF5C 3GKQA 1O90A 1UWDA 5LL6f 1QVFY 1JJ2Z 2K5RA 3RZDI 5K8FA 3CCRZ 1P4EA 2YWBA 1USPA 4DCTA 1TWGI 1X3ZA 5BSWA 2QEXZ 1V25A 4GKJC 3GTMI 1K731 3K6RA 3VNRA 4RV9A 3CMA1 4E2YA 4DV5C 3I4NI 1W2BY 2P2BA 4TNUA 4K0BA 5LMUC 2G2KA 3OW2Z 2E8CA 4E30A 1QF8A 1RO2A 1NJI2 3CD6Z 2QW0X 5IP9I 3N54B 5A1IA 4DR7C 4TPSB 3T1YC 4JI2C 3LNVA 3KIHA 2V45A 3R44A 5CM2M 5CZXA 4XX2A 3NI2A 3JAMD 3FKII 3VTNA 3A25A 5D1PA 2V8KA 3RG2A 1M6XC 1FDIA 3I56Z 1LCIA 4X65C 2D1SA 3LGXA 1NJI1 3N2QA 3BG0B 3PESA 4WS9A 2W03A 3GKUA 1ZH1A 2VUMI 5BSUA 3F3FC 2JMPA 3I08A 1VQ8Z 4RM3A 3G711 3C5EA 4G37A 3EQ6A 1QVGY 1RLYA 1NP6A 2WAQA 4L7IA 3IEVA 2GU2A 4BCAA 2ZM6C 3S15I 4FTFA 3CC21 3BG1B 4LE5A 2QA4Z 1YJW1 2E7ZA 4MRIA 1HH2P 1T5HX 1O9TA 4BBSI 1FUGA 3NH8A 2VSQA 4A93I 5DV9A 1RO0A 4DR3C 4EWCA 2QVXX 3UX2A 5D1OA 3M3YI 2R92I 4YY3C 4DK1A 3RV2A 1DL6A 2E8EA 1XRCA 1NY8A 4AYBA 4DR1C 3LNOA 3UEBA 2R7ZI 1PG3A 1VQL1 3GTMS 1K8A2 3CCJZ 1K0RA 3M4OI 5KYVA 4A3EI 4DR5C 4BY1I 4A3KI 1TFIA 3TR3A 4DUYC 2RBLA 4E2WA 2CXCA 1VQM1 3PO2I 3GPCA 4ODJA 3SO4A 5BSVA 1RG9A 3NFZA 1S7MA 3FQQA 3AF5A 4KTVA 1MKYA 5T8TA 3GCFA 4RMNA 1AA6A 5IP7I 2OTJZ 2P28A 4NBBA 2UUCC 1VEHA 4ISBA 2HJGA 1K8A1 1AMUA 5IWAC 2JIPA 1NYEA 1Y1VI 3ETCA 3I55Z 1Q822 1YHQZ 1VQNZ 2WD9A 3FCCA 2OTJ1 2LIYA 3CCV1 4RVHA 1YJ91 2E2HI 2KZFA 2JIQA 3CCL1 3VMGA 5GTDA 4JI4C 2UU9C 1N33C 1YHQ1 1MDBA 4YHHC 4JYAC 2VZEA 4DV4C 4AQYC 1WIIA 2JIRA 3LUSA 2B63I 1JOSA 1QVFZ 3VB9A 1Q821 2YCBA 1V26A 1ULTA 3NYRA 3S14I 3PO3S 3CCEZ 4RM2A 4A3GI 1KRLA 3CCQ1 4DV1C 3VNQA 2ZZMA 3HKZA 4MTNA 3UZ0A 1VQOZ 3I4MI 2J6AA 4DUZC 3G4SZ 3CMEZ 1VQ4Z 4MXUA 4DG8A 4KTTA 2VPYA 2F4MA 1IB8A 2OO4A 2HHHC 4DR4C 2OOXB 1MXBA 4G36A 1VQ9Z 3H3VJ
chains in the Genus database with same CATH topology
2QRCB 3CCS1 1Q812 2UXDC 1N2FA 3TE5B 4FUQA 3HOVI 1HNXC 3HOYI 1XMQC 1L2FA 3VNSA 4DCSA 1VQ61 1N8R2 5C4XI 4LF7C 2NVXI 1YIJ1 2JS4A 3KIFA 2D28C 3T4NB 3CC41 4BY7I 2E8FA 4D4GA 1Q811 2E2JI 2NVYI 3G7SA 4LF6C 2OBVA 3CCR1 1YJNZ 2OTLZ 2HU9A 1I3QI 4DCUA 1QVGZ 4MD8A 3MZKB 4NBAA 3GTQI 4A3LI 2QEX1 3CCUZ 2NVQI 1MD9A 2UUAC 4JI7C 4A3MI 1N8R1 2Q4ZA 3CCMZ 2GTIA 3ESWA 2E5LC 3A9UA 2R93I 1YUKA 3E7XA 2VQEC 4MD7A 3CD61 4RVNA 1QWIA 4E31A 1Q7Y2 1PG4A 2P02A 4IZ6A 4L2ZA 4E33A 2JR6A 4D57A 3S1RI 1N36C 1QYPA 2V8IA 2RPRA 1GPMA 3D6WA 4NBCA 2M48A 3I561 5BR8C 1WW9A 4R1MA 2JA8I 1SFOI 1Q7Y1 2BH1X 2PK7A 2KPIA 2PROA 2DPLA 4ZJZA 4MONA 1VQ81 1FJGC 2E7GA 4RLFA 4DV6C 3G6EZ 2EGTA 3J81f 4RVGA 4X64C 3CPWZ 1VQ5Z 4L4QA 1JJ2Y 4MD9A 4NOZA 4E2ZA 2P2FA 3CW8X 4BBYA 2JA5I 3G6E1 2QA41 2YADA 3CQZI 4A3CI 3AF6A 1ML8A 2NVTI 1XNQC 1MDFA 3MONA 1KQSY 3K7AI 2DE6A 1XMOC 2QLVB 2D1TA 3DHVA 2UXCC 2JA6I 4PHTA 4Y7NI 2AKLA 4BC9A 4CL1A 1VQKZ 1RY2A 4PZPA 1TWCI 3CCJ1 4LF8C 2D1QA 4BXXI 4NXMC 2LFUA 4NBGA 4NFRA 2W04A 3RZOI 4R1LA 1YITZ 4RVOA 1M901 3GTPI 2Y4NA 4U5YD 1N32C 2RT9A 2F4VC 4I9GA 4BBRI 1M1K2 4PROC 4A3JI 2JMOA 3IX0A 4A3II 5C4JI 3VMHA 2QVYX 1Z02A 1RO4A 4A3DI 4RLQA 3J7A4 1BA3A 5FLMI 4QTUA 1VQ7Z 2D7VA 3I551 3E7WA 3VMIA 5T8SA 1VQN1 4IR7A 1TWHI 2I3CA 1VLAA 4RS4A 4D4IA 1S72Z 3GTLI 4RVFA 3OTOC 5AE1A 1M1K1 5T67A 3HOWI 1EGAA 3S16I 2UUBC 2H85A 3CC7Z 2WP0C 1HNZC 1RQFA 3S2HI 2D1RA 2CY1A 2UXBC 4A3FI 1ZB8A 4NBEA 5T64A 3DLPX 1XRAA 3LAXA 1NUIA 4MH4A 2GTHA 2RIQA 4GXRA 2P2JA 4JM1A 1W2BZ 3CCE1 4X6AI 1Z01A 2AYAA 2DYJA 4B3TC 1XNRC 1VQPZ 1VQO1 4OX9C 2Q51A 2Y27A 3G4S1 4DR2C 5FLXb 1WF3A 3CME1 1VQ41 4E32A 1X0TA 4HGZA 1YI2Z 4DR6C 3J81D 1MXCA 1X3WA 2XR1A 2QL8A 4DV0C 2KI7B 2QKDA 3IF8A 2JNYA 4D56A 5A2Qb 1VQ91 2P20A 3NDIA 4NBFA 2F4OA 5FLXf 2OPLB 3CJEA 1Z03A 5BUQA 4GS5A 3ETOA 2QVZX 4B3SC 4R0MA 3EEDA 3D9XA 5A2Qf 4ZLPA 3KXWA 1I6HI 5A19A 2IZ3A 1Y1VS 1PFTA 2DE5A 4X66C 2Y0SA 4NDNA 1IBKC 1IBMC 1WCMI 4E2XA 2V8JA 1YJN1 1YUAA 2OTL1 2IZ4A 3B7WA 5CZVA 1R9TI 3FCEA 3CMAZ 2PT7G 4NXNC 4DQYB 3CCU1 2VUGA 3L8CA 3Q87A 1J5EC 4LF9C 3CCM1 3IMLA 3S1NI 2P3YA 5IT9b 4NH1C 4WV3A 5JRHA 3CXCY 1TWAI 4B3RC 3IPLA 3J80b 5AE2A 2PMZA 4GXQA 1KQSZ 4LFAC 4HH4A 3S17I 3QWUA 4DV2C 4NB8A 3J81b 1RNIA 3HOUI 5IT9f 2E0GA 4QTTA 3TDHB 3R9XA 3J80f 4DV7C 3NPDA 2E9HA 4DCVA 4BSZA 2VQFC 1USPB 2PN2A 4OYCA 4X62C 2O53A 1P7LA 3EERA 2JA7I 1LQLA 3G71Z 1O92A 1MXAA 5A1GA 2K3RA 2V7BA 1ZB9A 2RHBA 1VQ51 2QR1B 3S2DI 3DAYA 5KEIA 1PA4A 3CC2Z 1M902 2BJOA 4JI8C 1YJWZ 2P2MA 4S1TA 2DE7A 2ASBA 3PO3I 3OW2Y 3PROC 2JUBA 1YJ7A 4NB9A 5FLXD 3TDEA 1Y1WI 3IFUA 5AN9F 1T5DX 3FQMA 5BUSA 4DGLA 5IFIA 1VQLZ 4EATA 1K83I 4LF4C 1VQK1 5A2QD 3NH4A 1QM4A 4I9FA 1VQMZ 2ATWA 4KHPC 1YIT1 4HPVA 4JI1C 2P2QA 3S1QI 3TQIA 4LFBC 4JV5C 3GTOI 5BSRA 3JAMb 2M6NA 1P9NA 3S1MI 3I07A 5C3EI 4K0KC 2QRDB 2OOYB 4NBHA 1XRBA 5E7QA 3IEUA 3L95X 2YWCA 2Y4OA 3S82A 4Y52I 1VQ71 3CCVZ 5D1OB 4BC7A 1YJ9Z 3JAMf 1KD12 2WB1A 3CCLZ 3CPWY 3H2TA 3PBKA 1S721 1K9M2 4A3BI 5ADZA 4HGYA 1KC82 3R9WA 3T1HC 4B3MC 2OPLA 4FUTA 2YU9I 5KYTA 5C44I 5BURA 3CC71 5IT9D 4G1IA 5K85A 3A9VA 2R6MA 2D27A 5BSMA 3GR1A 3GTKI 3J80D 3P5JB 3CCQZ 1KD11 3GTGI 5AE3A 1K9M1 1HNWC 4GKKC 2VF1A 2OZKA 1KC81 1VQP1 1Q862 4DG9A 1I50I 3NDJA 5T6BA 4JI6C 3U50C 3F3PC 3NYQA 4JI3C 1O93A 1N34C 1JWHC 5BSTA 4LFCC 1YI21 3A4IA 3CXCZ 4DV3C 4RVDA 3GTJI 1KKGA 1IBLC 3NH5A 1HR0C 3CCSZ 1WH9A 3HOZI 5H9UA 4JI0C 5LMNC 1TWFI 1Q861 2E2II 1UKKA 3TUFA 3GR0A 3HOXI 3H0GI 2PM9A 1L1OC 2HF1A 4JI5C 2O4HA 1K732 4NBDA 1VQ6Z 2ONFA 3CW9A 1I94C 3MZLB 4OXIA 1YIJZ 2ZAEB 2QREB 3UOWA 3CC4Z 4LF5C 3GKQA 1O90A 5LL6f 1QVFY 1JJ2Z 2K5RA 3RZDI 5K8FA 3CCRZ 2YWBA 1USPA 4DCTA 1TWGI 1X3ZA 5BSWA 2QEXZ 1V25A 4GKJC 3GTMI 1K731 3VNRA 4RV9A 3CMA1 4E2YA 4DV5C 3I4NI 1W2BY 2P2BA 4TNUA 4K0BA 5LMUC 2G2KA 3OW2Z 2E8CA 4E30A 1QF8A 1RO2A 1NJI2 3CD6Z 2QW0X 5IP9I 3N54B 5A1IA 4DR7C 4TPSB 3T1YC 4JI2C 3LNVA 3KIHA 3R44A 5CM2M 5CZXA 4XX2A 3NI2A 3JAMD 3FKII 3VTNA 5D1PA 2V8KA 3RG2A 3I56Z 1LCIA 4X65C 2D1SA 3LGXA 1NJI1 3N2QA 3BG0B 3PESA 4WS9A 2W03A 3GKUA 1ZH1A 2VUMI 5BSUA 3F3FC 2JMPA 3I08A 1VQ8Z 4RM3A 3G711 3C5EA 4G37A 3EQ6A 1QVGY 1RLYA 1NP6A 2WAQA 4L7IA 3IEVA 2GU2A 4BCAA 2ZM6C 3S15I 4FTFA 3CC21 3BG1B 4LE5A 2QA4Z 1YJW1 1HH2P 4MRIA 1T5HX 1O9TA 4BBSI 1FUGA 3NH8A 2VSQA 4A93I 5DV9A 1RO0A 4DR3C 4EWCA 2QVXX 5D1OA 3M3YI 2R92I 4YY3C 4DK1A 3RV2A 1DL6A 2E8EA 1XRCA 4AYBA 4DR1C 2R7ZI 1PG3A 1VQL1 3GTMS 1K8A2 3CCJZ 1K0RA 3M4OI 5KYVA 4A3EI 4DR5C 4BY1I 4A3KI 1TFIA 4DUYC 2RBLA 4E2WA 2CXCA 1VQM1 3PO2I 3GPCA 4ODJA 3SO4A 5BSVA 1RG9A 3NFZA 1S7MA 3FQQA 3AF5A 4KTVA 1MKYA 5T8TA 3GCFA 4RMNA 5IP7I 2OTJZ 2P28A 4NBBA 2UUCC 4ISBA 2HJGA 1K8A1 1AMUA 5IWAC 1NYEA 1Y1VI 3ETCA 3I55Z 1Q822 1YHQZ 1VQNZ 2WD9A 3FCCA 2OTJ1 2LIYA 3CCV1 4RVHA 1YJ91 2E2HI 2KZFA 3CCL1 3VMGA 5GTDA 4JI4C 2UU9C 1N33C 1YHQ1 1MDBA 4YHHC 4JYAC 2VZEA 4DV4C 4AQYC 1WIIA 3LUSA 2B63I 1JOSA 1QVFZ 3VB9A 1Q821 2YCBA 1V26A 1ULTA 3NYRA 3S14I 3PO3S 3CCEZ 4RM2A 4A3GI 1KRLA 3CCQ1 4DV1C 3VNQA 3HKZA 4MTNA 3UZ0A 1VQOZ 3I4MI 2J6AA 4DUZC 3G4SZ 3CMEZ 1VQ4Z 4MXUA 4DG8A 4KTTA 2F4MA 2OO4A 2HHHC 4DR4C 2OOXB 1MXBA 4G36A 1VQ9Z 3H3VJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD C;  1N2F A;  3HOV I;  1HNX C;  3HOY I;  1XMQ C;  1L2F A;  4DCS A;  4LF7 C;  5C4X I;  2NVX I;  2JS4 A;  4BY7 I;  2E8F A;  2E2J I;  2NVY I;  4LF6 C;  1I3Q I;  4DCU A;  4A3L I;  4NBA A;  3GTQ I;  2UUA C;  4JI7 C;  2NVQ I;  4A3M I;  3ESW A;  2E5L C;  2R93 I;  2VQE C;  1QWI A;  2JR6 A;  3S1R I;  1N36 C;  1QYP A;  3D6W A;  4NBC A;  5BR8 C;  1WW9 A;  2JA8 I;  1SFO I;  2PK7 A;  2KPI A;  1FJG C;  2E7G A;  4DV6 C;  2EGT A;  4X64 C;  4NOZ A;  2JA5 I;  3CQZ I;  4A3C I;  3AF6 A;  1ML8 A;  2NVT I;  1XNQ C;  3K7A I;  2DE6 A;  1XMO C;  2UXC C;  2JA6 I;  4Y7N I;  2AKL A;  1TWC I;  4LF8 C;  4NXM C;  4BXX I;  4NBG A;  3RZO I;  3GTP I;  1N32 C;  2F4V C;  4BBR I;  4A3J I;  4A3I I;  5C4J I;  3VMH A;  1RO4 A;  4A3D I;  2D7V A;  5FLM I;  4QTU A;  3VMI A;  1TWH I;  1VLA A;  3GTL I;  3OTO C;  1EGA A;  3HOW I;  3S16 I;  2UUB C;  1HNZ C;  3S2H I;  2CY1 A;  2UXB C;  4A3F I;  1ZB8 A;  4NBE A;  1NUI A;  4MH4 A;  1XNR C;  4X6A I;  2DYJ A;  4B3T C;  4OX9 C;  4DR2 C;  1WF3 A;  4DR6 C;  3J81 D;  1X3W A;  2XR1 A;  2QL8 A;  4DV0 C;  2JNY A;  4NBF A;  2F4O A;  2OPL B;  3CJE A;  4B3S C;  1I6H I;  1Y1V S;  1PFT A;  2DE5 A;  4X66 C;  1IBM C;  1IBK C;  1WCM I;  1YUA A;  1R9T I;  2PT7 G;  4NXN C;  4LF9 C;  3Q87 A;  1J5E C;  3S1N I;  2P3Y A;  1TWA I;  4B3R C;  4LFA C;  3S17 I;  4DV2 C;  4NB8 A;  3HOU I;  4QTT A;  3R9X A;  4DV7 C;  4DCV A;  4BSZ A;  2VQF C;  1USP B;  2PN2 A;  4X62 C;  3EER A;  2JA7 I;  1LQL A;  1ZB9 A;  3S2D I;  1PA4 A;  2BJO A;  4JI8 C;  2DE7 A;  2ASB A;  3PO3 I;  4NB9 A;  5FLX D;  1Y1W I;  1K83 I;  4LF4 C;  5A2Q D;  2ATW A;  4KHP C;  4JI1 C;  3S1Q I;  4LFB C;  4JV5 C;  3GTO I;  3S1M I;  3I07 A;  5C3E I;  4K0K C;  4NBH A;  3IEU A;  4Y52 I;  4A3B I;  3R9W A;  3T1H C;  4B3M C;  2OPL A;  2YU9 I;  5C44 I;  5IT9 D;  3GTK I;  3J80 D;  3GTG I;  1HNW C;  4GKK C;  1I50 I;  4JI6 C;  3U50 C;  4JI3 C;  1N34 C;  4LFC C;  4DV3 C;  3GTJ I;  1KKG A;  1IBL C;  1HR0 C;  1WH9 A;  3HOZ I;  4JI0 C;  5LMN C;  1TWF I;  2E2I I;  1UKK A;  3HOX I;  3H0G I;  1L1O C;  2HF1 A;  4JI5 C;  4NBD A;  2ONF A;  1I94 C;  4LF5 C;  3GKQ A;  2K5R A;  3RZD I;  1USP A;  4DCT A;  1TWG I;  1X3Z A;  4GKJ C;  3GTM I;  4DV5 C;  3I4N I;  5LMU C;  2E8C A;  4DR7 C;  5IP9 I;  3T1Y C;  4JI2 C;  5CM2 M;  4XX2 A;  3JAM D;  3FKI I;  4X65 C;  3GKU A;  2VUM I;  2JMP A;  1RLY A;  3IEV A;  2ZM6 C;  3S15 I;  1HH2 P;  4BBS I;  4A93 I;  4DR3 C;  3M3Y I;  2R92 I;  4YY3 C;  1DL6 A;  2E8E A;  4DR1 C;  2R7Z I;  3GTM S;  1K0R A;  3M4O I;  4DR5 C;  4A3E I;  4BY1 I;  4A3K I;  1TFI A;  4DUY C;  2RBL A;  2CXC A;  3PO2 I;  3AF5 A;  1MKY A;  3GCF A;  5IP7 I;  4NBB A;  2UUC C;  2HJG A;  5IWA C;  1NYE A;  1Y1V I;  2E2H I;  2KZF A;  3VMG A;  1N33 C;  4JI4 C;  2UU9 C;  4JYA C;  4YHH C;  4DV4 C;  4AQY C;  3LUS A;  2B63 I;  1JOS A;  3VB9 A;  2YCB A;  3S14 I;  3PO3 S;  4A3G I;  4DV1 C;  4MTN A;  3I4M I;  2J6A A;  4DUZ C;  2F4M A;  2HHH C;  4DR4 C;  3H3V J; 
#chains in the Genus database with same CATH topology
 2QRC B;  3CCS 1;  1Q81 2;  2UXD C;  1N2F A;  3TE5 B;  4FUQ A;  3HOV I;  1HNX C;  3HOY I;  1XMQ C;  1L2F A;  3VNS A;  4DCS A;  1VQ6 1;  1N8R 2;  5C4X I;  1P4E C;  4LF7 C;  2NVX I;  1YIJ 1;  2JS4 A;  3KIF A;  2D28 C;  3T4N B;  3CC4 1;  4BY7 I;  2E8F A;  4D4G A;  1Q81 1;  2E2J I;  2NVY I;  3G7S A;  4LF6 C;  2OBV A;  3CCR 1;  1YJN Z;  2OTL Z;  2MM9 A;  2HU9 A;  1I3Q I;  4DCU A;  1QVG Z;  4MD8 A;  3MZK B;  4NBA A;  3GTQ I;  4A3L I;  2QEX 1;  3CCU Z;  2NVQ I;  1MD9 A;  2UUA C;  4JI7 C;  4A3M I;  1N8R 1;  2Q4Z A;  3CCM Z;  1WCJ A;  2GTI A;  3ESW A;  2E5L C;  3A9U A;  2R93 I;  1YUK A;  3E7X A;  2VQE C;  4MD7 A;  3CD6 1;  4RVN A;  1QWI A;  4E31 A;  1Q7Y 2;  1PG4 A;  2P02 A;  4IZ6 A;  4L2Z A;  4E33 A;  2JR6 A;  4D57 A;  3S1R I;  4PUG A;  2NCL A;  1QYP A;  1Y8C A;  2RPR A;  2V8I A;  1N36 C;  1GPM A;  3D6W A;  4NBC A;  2M48 A;  3I56 1;  5BR8 C;  1WW9 A;  4R1M A;  2JA8 I;  2VPZ A;  1SFO I;  1Q7Y 1;  2BH1 X;  2PK7 A;  2KPI A;  2MMA B;  2DPL A;  2PRO A;  4MON A;  1VQ8 1;  4ZJZ A;  1FJG C;  2E7G A;  4RLF A;  1QXF A;  4DV6 C;  3G6E Z;  2EGT A;  3J81 f;  4RVG A;  4X64 C;  3CPW Z;  1VQ5 Z;  4L4Q A;  1JJ2 Y;  4MD9 A;  4NOZ A;  4E2Z A;  2P2F A;  3CW8 X;  4BBY A;  2JA5 I;  3G6E 1;  2QA4 1;  2YAD A;  3CQZ I;  4A3C I;  3AF6 A;  1ML8 A;  2NVT I;  1XNQ C;  1MDF A;  3MON A;  1KQS Y;  3K7A I;  2DE6 A;  1XMO C;  2QLV B;  2D1T A;  3DHV A;  2UXC C;  2JA6 I;  4PHT A;  4Y7N I;  2AKL A;  4BC9 A;  4CL1 A;  2KDN A;  1VQK Z;  1RY2 A;  1XNR C;  4PZP A;  1TWC I;  3CCJ 1;  4LF8 C;  2D1Q A;  4BXX I;  4NXM C;  2LFU A;  4NBG A;  4NFR A;  1Q16 A;  2W04 A;  3RZO I;  1YIT Z;  1PU1 A;  4R1L A;  1M90 1;  2DHM A;  3GTP I;  2Y4N A;  4U5Y D;  1N32 C;  2RT9 A;  2F4V C;  4I9G A;  4BBR I;  1XHJ A;  1M1K 2;  4PRO C;  4A3J I;  2JMO A;  3IX0 A;  4A3I I;  5C4J I;  3VMH A;  2QVY X;  1Z02 A;  1RO4 A;  4A3D I;  4RLQ A;  3J7A 4;  5LCI A;  2MCQ A;  1FDO A;  1BA3 A;  5FLM I;  4QTU A;  1VQ7 Z;  2D7V A;  3I55 1;  3E7W A;  3VMI A;  5T8S A;  1VQN 1;  4IR7 A;  1TWH I;  2I3C A;  1VLA A;  4RS4 A;  4D4I A;  1S72 Z;  3GTL I;  4RVF A;  3OTO C;  5AE1 A;  1M1K 1;  5T67 A;  3HOW I;  1EGA A;  3S16 I;  2UUB C;  2H85 A;  3UX3 A;  3CC7 Z;  2WP0 C;  2VPX A;  1HNZ C;  1RQF A;  3S2H I;  2D1R A;  2CY1 A;  1FLO A;  2UXB C;  4A3F I;  1ZB8 A;  4NBE A;  5T64 A;  3DLP X;  1XRA A;  3LAX A;  1WJ2 A;  1NUI A;  4MH4 A;  2GTH A;  2RIQ A;  4GXR A;  2P2J A;  4JM1 A;  1W2B Z;  3CCE 1;  4X6A I;  1Z01 A;  2AYA A;  2LEX A;  2DYJ A;  1TH5 A;  4B3T C;  1VQP Z;  1VQO 1;  4OX9 C;  2Q51 A;  2Y27 A;  3G4S 1;  4DR2 C;  5FLX b;  1WF3 A;  3CME 1;  1VQ4 1;  4E32 A;  1X0T A;  4HGZ A;  1YI2 Z;  4DR6 C;  3J81 D;  1MXC A;  1X3W A;  2XR1 A;  2QL8 A;  4DV0 C;  2KI7 B;  2QKD A;  3IF8 A;  2JNY A;  4D56 A;  5A2Q b;  1VQ9 1;  2Z51 A;  2P20 A;  3NDI A;  4NBF A;  2F4O A;  5FLX f;  2OPL B;  3CJE A;  1Z03 A;  5BUQ A;  4GS5 A;  3CQ1 A;  3ETO A;  4PUH A;  2QVZ X;  4B3S C;  4R0M A;  3EED A;  2JNV A;  3D9X A;  5A2Q f;  4ZLP A;  3KXW A;  1I6H I;  5A19 A;  2IZ3 A;  1Y1V S;  1PFT A;  3AY0 A;  2DE5 A;  4X66 C;  2Y0S A;  4NDN A;  1IBK C;  1IBM C;  1WCM I;  4E2X A;  2V8J A;  1YJN 1;  1YUA A;  2OTL 1;  2IZ4 A;  3B7W A;  5CZV A;  1R9T I;  3FCE A;  3CMA Z;  2PT7 G;  4NXN C;  4DQY B;  3CCU 1;  2VUG A;  3L8C A;  3Q87 A;  1J5E C;  4LF9 C;  3CCM 1;  3IML A;  3S1N I;  2P3Y A;  2M5H A;  5IT9 b;  4NH1 C;  2KZ0 A;  4WV3 A;  2ZZN A;  5JRH A;  3CXC Y;  1TWA I;  4B3R C;  3IPL A;  3J80 b;  2VPW A;  5AE2 A;  2PMZ A;  4GXQ A;  1KQS Z;  4LFA C;  4HH4 A;  3O2E A;  3S17 I;  3QWU A;  4DV2 C;  4NB8 A;  3J81 b;  1RNI A;  3HOU I;  5IT9 f;  2V3V A;  4QTT A;  3TDH B;  2E0G A;  3R9X A;  3J80 f;  4DV7 C;  3NPD A;  2E9H A;  4DCV A;  4BSZ A;  2VQF C;  1USP B;  2PN2 A;  4OYC A;  4X62 C;  1M6X A;  2O53 A;  1SIW A;  1P7L A;  3EER A;  2JA7 I;  1LQL A;  3G71 Z;  1O92 A;  1MXA A;  3D2L A;  2K3R A;  5A1G A;  2V7B A;  1ZB9 A;  2RHB A;  1VQ5 1;  2QR1 B;  3S2D I;  3DAY A;  4RVO A;  5KEI A;  1PA4 A;  3CC2 Z;  1M90 2;  2BJO A;  4JI8 C;  1YJW Z;  2P2M A;  4S1T A;  2DE7 A;  2YX1 A;  2ASB A;  3PO3 I;  3OW2 Y;  3PRO C;  2JUB A;  3IR7 A;  1YJ7 A;  4NB9 A;  5FLX D;  3TDE A;  1Y1W I;  3IFU A;  5AN9 F;  1T5D X;  3FQM A;  5BUS A;  4DGL A;  5IFI A;  1VQL Z;  4EAT A;  1K83 I;  4LF4 C;  1VQK 1;  5A2Q D;  3NH4 A;  1QM4 A;  1V60 A;  4I9F A;  1VQM Z;  2ATW A;  4KHP C;  1YIT 1;  4HPV A;  4JI1 C;  2P2Q A;  3CQ2 A;  3S1Q I;  3TQI A;  2IV2 X;  1XS3 A;  4LFB C;  4JV5 C;  3GTO I;  5BSR A;  3JAM b;  2M6N A;  1P9N A;  3S1M I;  3I07 A;  2CU6 A;  5C3E I;  4K0K C;  2QRD B;  2OOY B;  4NBH A;  1XRB A;  5E7Q A;  3IEU A;  3L95 X;  2YWC A;  2Y4O A;  3S82 A;  4Y52 I;  1VQ7 1;  3CCV Z;  5D1O B;  4BC7 A;  1YJ9 Z;  3JAM f;  1KD1 2;  2WB1 A;  3CCL Z;  3CPW Y;  3H2T A;  3PBK A;  1S72 1;  1K9M 2;  4A3B I;  5ADZ A;  4HGY A;  1KC8 2;  3R9W A;  3T1H C;  4B3M C;  2OPL A;  4FUT A;  2YU9 I;  5KYT A;  5C44 I;  5BUR A;  3CC7 1;  5IT9 D;  4G1I A;  5K85 A;  3A9V A;  2R6M A;  2D27 A;  5BSM A;  3GR1 A;  3GTK I;  3J80 D;  3P5J B;  2AYD A;  2JIO A;  3CCQ Z;  1KD1 1;  3GTG I;  3A26 A;  5AE3 A;  1K9M 1;  1HNW C;  4GKK C;  2VF1 A;  2OZK A;  1KC8 1;  1VQP 1;  1Q86 2;  4DG9 A;  1I50 I;  3NDJ A;  5T6B A;  4JI6 C;  3U50 C;  3F3P C;  3NYQ A;  4JI3 C;  1O93 A;  1N34 C;  1JWH C;  3CQ3 A;  5BST A;  4PUI A;  1YI2 1;  4LFC C;  3A4I A;  3CXC Z;  4DV3 C;  2M5O A;  4RVD A;  3GTJ I;  1KKG A;  1IBL C;  3NH5 A;  1HR0 C;  3CCS Z;  1WH9 A;  3HOZ I;  5H9U A;  4JI0 C;  5LMN C;  1TWF I;  1Q86 1;  2E2I I;  1WZN A;  1UKK A;  3TUF A;  3GR0 A;  3HOX I;  3H0G I;  2PM9 A;  2NAP A;  1L1O C;  2HF1 A;  4JI5 C;  2O4H A;  1K73 2;  4NBD A;  1VQ6 Z;  2ONF A;  3CW9 A;  1I94 C;  3MZL B;  4OXI A;  1YIJ Z;  2JIM A;  2ZAE B;  2QRE B;  3UOW A;  3CC4 Z;  4LF5 C;  3GKQ A;  1O90 A;  1UWD A;  5LL6 f;  1QVF Y;  1JJ2 Z;  2K5R A;  3RZD I;  5K8F A;  3CCR Z;  1P4E A;  2YWB A;  1USP A;  4DCT A;  1TWG I;  1X3Z A;  5BSW A;  2QEX Z;  1V25 A;  4GKJ C;  3GTM I;  1K73 1;  3K6R A;  3VNR A;  4RV9 A;  3CMA 1;  4E2Y A;  4DV5 C;  3I4N I;  1W2B Y;  2P2B A;  4TNU A;  4K0B A;  5LMU C;  2G2K A;  3OW2 Z;  2E8C A;  4E30 A;  1QF8 A;  1RO2 A;  1NJI 2;  3CD6 Z;  2QW0 X;  5IP9 I;  3N54 B;  5A1I A;  4DR7 C;  4TPS B;  3T1Y C;  4JI2 C;  3LNV A;  3KIH A;  2V45 A;  3R44 A;  5CM2 M;  5CZX A;  4XX2 A;  3NI2 A;  3JAM D;  3FKI I;  3VTN A;  3A25 A;  5D1P A;  2V8K A;  3RG2 A;  1M6X C;  1FDI A;  3I56 Z;  1LCI A;  4X65 C;  2D1S A;  3LGX A;  1NJI 1;  3N2Q A;  3BG0 B;  3PES A;  4WS9 A;  2W03 A;  3GKU A;  1ZH1 A;  2VUM I;  5BSU A;  3F3F C;  2JMP A;  3I08 A;  1VQ8 Z;  4RM3 A;  3G71 1;  3C5E A;  4G37 A;  3EQ6 A;  1QVG Y;  1RLY A;  1NP6 A;  2WAQ A;  4L7I A;  3IEV A;  2GU2 A;  4BCA A;  2ZM6 C;  3S15 I;  4FTF A;  3CC2 1;  3BG1 B;  4LE5 A;  2QA4 Z;  1YJW 1;  2E7Z A;  4MRI A;  1HH2 P;  1T5H X;  1O9T A;  4BBS I;  1FUG A;  3NH8 A;  2VSQ A;  4A93 I;  5DV9 A;  1RO0 A;  4DR3 C;  4EWC A;  2QVX X;  3UX2 A;  5D1O A;  3M3Y I;  2R92 I;  4YY3 C;  4DK1 A;  3RV2 A;  1DL6 A;  2E8E A;  1XRC A;  1NY8 A;  4AYB A;  4DR1 C;  3LNO A;  3UEB A;  2R7Z I;  1PG3 A;  1VQL 1;  3GTM S;  1K8A 2;  3CCJ Z;  1K0R A;  3M4O I;  5KYV A;  4A3E I;  4DR5 C;  4BY1 I;  4A3K I;  1TFI A;  3TR3 A;  4DUY C;  2RBL A;  4E2W A;  2CXC A;  1VQM 1;  3PO2 I;  3GPC A;  4ODJ A;  3SO4 A;  5BSV A;  1RG9 A;  3NFZ A;  1S7M A;  3FQQ A;  3AF5 A;  4KTV A;  1MKY A;  5T8T A;  3GCF A;  4RMN A;  1AA6 A;  5IP7 I;  2OTJ Z;  2P28 A;  4NBB A;  2UUC C;  1VEH A;  4ISB A;  2HJG A;  1K8A 1;  1AMU A;  5IWA C;  2JIP A;  1NYE A;  1Y1V I;  3ETC A;  3I55 Z;  1Q82 2;  1YHQ Z;  1VQN Z;  2WD9 A;  3FCC A;  2OTJ 1;  2LIY A;  3CCV 1;  4RVH A;  1YJ9 1;  2E2H I;  2KZF A;  2JIQ A;  3CCL 1;  3VMG A;  5GTD A;  4JI4 C;  2UU9 C;  1N33 C;  1YHQ 1;  1MDB A;  4YHH C;  4JYA C;  2VZE A;  4DV4 C;  4AQY C;  1WII A;  2JIR A;  3LUS A;  2B63 I;  1JOS A;  1QVF Z;  3VB9 A;  1Q82 1;  2YCB A;  1V26 A;  1ULT A;  3NYR A;  3S14 I;  3PO3 S;  3CCE Z;  4RM2 A;  4A3G I;  1KRL A;  3CCQ 1;  4DV1 C;  3VNQ A;  2ZZM A;  3HKZ A;  4MTN A;  3UZ0 A;  1VQO Z;  3I4M I;  2J6A A;  4DUZ C;  3G4S Z;  3CME Z;  1VQ4 Z;  4MXU A;  4DG8 A;  4KTT A;  2VPY A;  2F4M A;  1IB8 A;  2OO4 A;  2HHH C;  4DR4 C;  2OOX B;  1MXB A;  4G36 A;  1VQ9 Z;  3H3V J; 
#chains in the Genus database with same CATH homology
 2QRC B;  3CCS 1;  1Q81 2;  2UXD C;  1N2F A;  3TE5 B;  4FUQ A;  3HOV I;  1HNX C;  3HOY I;  1XMQ C;  1L2F A;  3VNS A;  4DCS A;  1VQ6 1;  1N8R 2;  5C4X I;  4LF7 C;  2NVX I;  1YIJ 1;  2JS4 A;  3KIF A;  2D28 C;  3T4N B;  3CC4 1;  4BY7 I;  2E8F A;  4D4G A;  1Q81 1;  2E2J I;  2NVY I;  3G7S A;  4LF6 C;  2OBV A;  3CCR 1;  1YJN Z;  2OTL Z;  2HU9 A;  1I3Q I;  4DCU A;  1QVG Z;  4MD8 A;  3MZK B;  4NBA A;  3GTQ I;  4A3L I;  2QEX 1;  3CCU Z;  2NVQ I;  1MD9 A;  2UUA C;  4JI7 C;  4A3M I;  1N8R 1;  2Q4Z A;  3CCM Z;  2GTI A;  3ESW A;  2E5L C;  3A9U A;  2R93 I;  1YUK A;  3E7X A;  2VQE C;  4MD7 A;  3CD6 1;  4RVN A;  1QWI A;  4E31 A;  1Q7Y 2;  1PG4 A;  2P02 A;  4IZ6 A;  4L2Z A;  4E33 A;  2JR6 A;  4D57 A;  3S1R I;  1N36 C;  1QYP A;  2V8I A;  2RPR A;  1GPM A;  3D6W A;  4NBC A;  2M48 A;  3I56 1;  5BR8 C;  1WW9 A;  4R1M A;  2JA8 I;  1SFO I;  1Q7Y 1;  2BH1 X;  2PK7 A;  2KPI A;  2PRO A;  2DPL A;  4ZJZ A;  4MON A;  1VQ8 1;  1FJG C;  2E7G A;  4RLF A;  4DV6 C;  3G6E Z;  2EGT A;  3J81 f;  4RVG A;  4X64 C;  3CPW Z;  1VQ5 Z;  4L4Q A;  1JJ2 Y;  4MD9 A;  4NOZ A;  4E2Z A;  2P2F A;  3CW8 X;  4BBY A;  2JA5 I;  3G6E 1;  2QA4 1;  2YAD A;  3CQZ I;  4A3C I;  3AF6 A;  1ML8 A;  2NVT I;  1XNQ C;  1MDF A;  3MON A;  1KQS Y;  3K7A I;  2DE6 A;  1XMO C;  2QLV B;  2D1T A;  3DHV A;  2UXC C;  2JA6 I;  4PHT A;  4Y7N I;  2AKL A;  4BC9 A;  4CL1 A;  1VQK Z;  1RY2 A;  4PZP A;  1TWC I;  3CCJ 1;  4LF8 C;  2D1Q A;  4BXX I;  4NXM C;  2LFU A;  4NBG A;  4NFR A;  2W04 A;  3RZO I;  4R1L A;  1YIT Z;  4RVO A;  1M90 1;  3GTP I;  2Y4N A;  4U5Y D;  1N32 C;  2RT9 A;  2F4V C;  4I9G A;  4BBR I;  1M1K 2;  4PRO C;  4A3J I;  2JMO A;  3IX0 A;  4A3I I;  5C4J I;  3VMH A;  2QVY X;  1Z02 A;  1RO4 A;  4A3D I;  4RLQ A;  3J7A 4;  1BA3 A;  5FLM I;  4QTU A;  1VQ7 Z;  2D7V A;  3I55 1;  3E7W A;  3VMI A;  5T8S A;  1VQN 1;  4IR7 A;  1TWH I;  2I3C A;  1VLA A;  4RS4 A;  4D4I A;  1S72 Z;  3GTL I;  4RVF A;  3OTO C;  5AE1 A;  1M1K 1;  5T67 A;  3HOW I;  1EGA A;  3S16 I;  2UUB C;  2H85 A;  3CC7 Z;  2WP0 C;  1HNZ C;  1RQF A;  3S2H I;  2D1R A;  2CY1 A;  2UXB C;  4A3F I;  1ZB8 A;  4NBE A;  5T64 A;  3DLP X;  1XRA A;  3LAX A;  1NUI A;  4MH4 A;  2GTH A;  2RIQ A;  4GXR A;  2P2J A;  4JM1 A;  1W2B Z;  3CCE 1;  4X6A I;  1Z01 A;  2AYA A;  2DYJ A;  4B3T C;  1XNR C;  1VQP Z;  1VQO 1;  4OX9 C;  2Q51 A;  2Y27 A;  3G4S 1;  4DR2 C;  5FLX b;  1WF3 A;  3CME 1;  1VQ4 1;  4E32 A;  1X0T A;  4HGZ A;  1YI2 Z;  4DR6 C;  3J81 D;  1MXC A;  1X3W A;  2XR1 A;  2QL8 A;  4DV0 C;  2KI7 B;  2QKD A;  3IF8 A;  2JNY A;  4D56 A;  5A2Q b;  1VQ9 1;  2P20 A;  3NDI A;  4NBF A;  2F4O A;  5FLX f;  2OPL B;  3CJE A;  1Z03 A;  5BUQ A;  4GS5 A;  3ETO A;  2QVZ X;  4B3S C;  4R0M A;  3EED A;  3D9X A;  5A2Q f;  4ZLP A;  3KXW A;  1I6H I;  5A19 A;  2IZ3 A;  1Y1V S;  1PFT A;  2DE5 A;  4X66 C;  2Y0S A;  4NDN A;  1IBK C;  1IBM C;  1WCM I;  4E2X A;  2V8J A;  1YJN 1;  1YUA A;  2OTL 1;  2IZ4 A;  3B7W A;  5CZV A;  1R9T I;  3FCE A;  3CMA Z;  2PT7 G;  4NXN C;  4DQY B;  3CCU 1;  2VUG A;  3L8C A;  3Q87 A;  1J5E C;  4LF9 C;  3CCM 1;  3IML A;  3S1N I;  2P3Y A;  5IT9 b;  4NH1 C;  4WV3 A;  5JRH A;  3CXC Y;  1TWA I;  4B3R C;  3IPL A;  3J80 b;  5AE2 A;  2PMZ A;  4GXQ A;  1KQS Z;  4LFA C;  4HH4 A;  3S17 I;  3QWU A;  4DV2 C;  4NB8 A;  3J81 b;  1RNI A;  3HOU I;  5IT9 f;  2E0G A;  4QTT A;  3TDH B;  3R9X A;  3J80 f;  4DV7 C;  3NPD A;  2E9H A;  4DCV A;  4BSZ A;  2VQF C;  1USP B;  2PN2 A;  4OYC A;  4X62 C;  2O53 A;  1P7L A;  3EER A;  2JA7 I;  1LQL A;  3G71 Z;  1O92 A;  1MXA A;  5A1G A;  2K3R A;  2V7B A;  1ZB9 A;  2RHB A;  1VQ5 1;  2QR1 B;  3S2D I;  3DAY A;  5KEI A;  1PA4 A;  3CC2 Z;  1M90 2;  2BJO A;  4JI8 C;  1YJW Z;  2P2M A;  4S1T A;  2DE7 A;  2ASB A;  3PO3 I;  3OW2 Y;  3PRO C;  2JUB A;  1YJ7 A;  4NB9 A;  5FLX D;  3TDE A;  1Y1W I;  3IFU A;  5AN9 F;  1T5D X;  3FQM A;  5BUS A;  4DGL A;  5IFI A;  1VQL Z;  4EAT A;  1K83 I;  4LF4 C;  1VQK 1;  5A2Q D;  3NH4 A;  1QM4 A;  4I9F A;  1VQM Z;  2ATW A;  4KHP C;  1YIT 1;  4HPV A;  4JI1 C;  2P2Q A;  3S1Q I;  3TQI A;  4LFB C;  4JV5 C;  3GTO I;  5BSR A;  3JAM b;  2M6N A;  1P9N A;  3S1M I;  3I07 A;  5C3E I;  4K0K C;  2QRD B;  2OOY B;  4NBH A;  1XRB A;  5E7Q A;  3IEU A;  3L95 X;  2YWC A;  2Y4O A;  3S82 A;  4Y52 I;  1VQ7 1;  3CCV Z;  5D1O B;  4BC7 A;  1YJ9 Z;  3JAM f;  1KD1 2;  2WB1 A;  3CCL Z;  3CPW Y;  3H2T A;  3PBK A;  1S72 1;  1K9M 2;  4A3B I;  5ADZ A;  4HGY A;  1KC8 2;  3R9W A;  3T1H C;  4B3M C;  2OPL A;  4FUT A;  2YU9 I;  5KYT A;  5C44 I;  5BUR A;  3CC7 1;  5IT9 D;  4G1I A;  5K85 A;  3A9V A;  2R6M A;  2D27 A;  5BSM A;  3GR1 A;  3GTK I;  3J80 D;  3P5J B;  3CCQ Z;  1KD1 1;  3GTG I;  5AE3 A;  1K9M 1;  1HNW C;  4GKK C;  2VF1 A;  2OZK A;  1KC8 1;  1VQP 1;  1Q86 2;  4DG9 A;  1I50 I;  3NDJ A;  5T6B A;  4JI6 C;  3U50 C;  3F3P C;  3NYQ A;  4JI3 C;  1O93 A;  1N34 C;  1JWH C;  5BST A;  4LFC C;  1YI2 1;  3A4I A;  3CXC Z;  4DV3 C;  4RVD A;  3GTJ I;  1KKG A;  1IBL C;  3NH5 A;  1HR0 C;  3CCS Z;  1WH9 A;  3HOZ I;  5H9U A;  4JI0 C;  5LMN C;  1TWF I;  1Q86 1;  2E2I I;  1UKK A;  3TUF A;  3GR0 A;  3HOX I;  3H0G I;  2PM9 A;  1L1O C;  2HF1 A;  4JI5 C;  2O4H A;  1K73 2;  4NBD A;  1VQ6 Z;  2ONF A;  3CW9 A;  1I94 C;  3MZL B;  4OXI A;  1YIJ Z;  2ZAE B;  2QRE B;  3UOW A;  3CC4 Z;  4LF5 C;  3GKQ A;  1O90 A;  5LL6 f;  1QVF Y;  1JJ2 Z;  2K5R A;  3RZD I;  5K8F A;  3CCR Z;  2YWB A;  1USP A;  4DCT A;  1TWG I;  1X3Z A;  5BSW A;  2QEX Z;  1V25 A;  4GKJ C;  3GTM I;  1K73 1;  3VNR A;  4RV9 A;  3CMA 1;  4E2Y A;  4DV5 C;  3I4N I;  1W2B Y;  2P2B A;  4TNU A;  4K0B A;  5LMU C;  2G2K A;  3OW2 Z;  2E8C A;  4E30 A;  1QF8 A;  1RO2 A;  1NJI 2;  3CD6 Z;  2QW0 X;  5IP9 I;  3N54 B;  5A1I A;  4DR7 C;  4TPS B;  3T1Y C;  4JI2 C;  3LNV A;  3KIH A;  3R44 A;  5CM2 M;  5CZX A;  4XX2 A;  3NI2 A;  3JAM D;  3FKI I;  3VTN A;  5D1P A;  2V8K A;  3RG2 A;  3I56 Z;  1LCI A;  4X65 C;  2D1S A;  3LGX A;  1NJI 1;  3N2Q A;  3BG0 B;  3PES A;  4WS9 A;  2W03 A;  3GKU A;  1ZH1 A;  2VUM I;  5BSU A;  3F3F C;  2JMP A;  3I08 A;  1VQ8 Z;  4RM3 A;  3G71 1;  3C5E A;  4G37 A;  3EQ6 A;  1QVG Y;  1RLY A;  1NP6 A;  2WAQ A;  4L7I A;  3IEV A;  2GU2 A;  4BCA A;  2ZM6 C;  3S15 I;  4FTF A;  3CC2 1;  3BG1 B;  4LE5 A;  2QA4 Z;  1YJW 1;  1HH2 P;  4MRI A;  1T5H X;  1O9T A;  4BBS I;  1FUG A;  3NH8 A;  2VSQ A;  4A93 I;  5DV9 A;  1RO0 A;  4DR3 C;  4EWC A;  2QVX X;  5D1O A;  3M3Y I;  2R92 I;  4YY3 C;  4DK1 A;  3RV2 A;  1DL6 A;  2E8E A;  1XRC A;  4AYB A;  4DR1 C;  2R7Z I;  1PG3 A;  1VQL 1;  3GTM S;  1K8A 2;  3CCJ Z;  1K0R A;  3M4O I;  5KYV A;  4A3E I;  4DR5 C;  4BY1 I;  4A3K I;  1TFI A;  4DUY C;  2RBL A;  4E2W A;  2CXC A;  1VQM 1;  3PO2 I;  3GPC A;  4ODJ A;  3SO4 A;  5BSV A;  1RG9 A;  3NFZ A;  1S7M A;  3FQQ A;  3AF5 A;  4KTV A;  1MKY A;  5T8T A;  3GCF A;  4RMN A;  5IP7 I;  2OTJ Z;  2P28 A;  4NBB A;  2UUC C;  4ISB A;  2HJG A;  1K8A 1;  1AMU A;  5IWA C;  1NYE A;  1Y1V I;  3ETC A;  3I55 Z;  1Q82 2;  1YHQ Z;  1VQN Z;  2WD9 A;  3FCC A;  2OTJ 1;  2LIY A;  3CCV 1;  4RVH A;  1YJ9 1;  2E2H I;  2KZF A;  3CCL 1;  3VMG A;  5GTD A;  4JI4 C;  2UU9 C;  1N33 C;  1YHQ 1;  1MDB A;  4YHH C;  4JYA C;  2VZE A;  4DV4 C;  4AQY C;  1WII A;  3LUS A;  2B63 I;  1JOS A;  1QVF Z;  3VB9 A;  1Q82 1;  2YCB A;  1V26 A;  1ULT A;  3NYR A;  3S14 I;  3PO3 S;  3CCE Z;  4RM2 A;  4A3G I;  1KRL A;  3CCQ 1;  4DV1 C;  3VNQ A;  3HKZ A;  4MTN A;  3UZ0 A;  1VQO Z;  3I4M I;  2J6A A;  4DUZ C;  3G4S Z;  3CME Z;  1VQ4 Z;  4MXU A;  4DG8 A;  4KTT A;  2F4M A;  2OO4 A;  2HHH C;  4DR4 C;  2OOX B;  1MXB A;  4G36 A;  1VQ9 Z;  3H3V J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...