4XX2A

Ohr from xylella fastidiosa in oxidized state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
141
Chain Sequence
MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ohr from Xylella fastidiosa in oxidized state
rcsb
source organism Xylella fastidiosa (strain 9a5c)
molecule tags Oxidoreductase
molecule keywords Organic hydroperoxide resistance protein
total genus 32
structure length 141
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4xx2A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4xx2A02
4JI3C 2K5RA 5C4XI 3S1RI 1PA4A 2KZFA 4NBEA 4DR4C 1USPA 4JI4C 1FJGC 3FKII 4X6AI 2E8FA 3GKUA 2F4MA 3GTGI 2UUBC 3R9WA 4NBGA 4DV3C 3OTOC 3VB9A 1XMQC 1DL6A 2JA7I 3GTMI 1YUAA 4JI1C 2NVQI 2F4VC 1TWGI 4B3RC 4Y52I 4BY1I 1K0RA 1X3WA 4AQYC 3S14I 1IBKC 1USPB 3VMIA 2HF1A 3PO2I 2CXCA 2KPIA 4QTUA 4A3KI 4DCSA 3J81D 2VUMI 4NXMC 3IEVA 4NBBA 2OPLB 2E2II 1WCMI 1PFTA 2PK7A 1RO4A 3GTPI 3I4MI 5IP7I 2DYJA 4JI2C 1HNWC 1EGAA 1ZB9A 3HOUI 2BJOA 4DR2C 3S1MI 4JI6C 1RLYA 2JA8I 4YHHC 3VMHA 1TWHI 3RZOI 3AF5A 4NBHA 4LF7C 4DR7C 4NBDA 3S1QI 2RBLA 4DR1C 4NOZA 2HJGA 1XNQC 1L1OC 2AKLA 4DUZC 3HOVI 4A3BI 3LUSA 2HHHC 4B3SC 4JI7C 4BXXI 4A3LI 3T1YC 2ATWA 1HNZC 2QL8A 1N2FA 3HOYI 4DV6C 3D6WA 2DE7A 2R92I 2R7ZI 2JS4A 4LF5C 2PN2A 1XMOC 1Y1VI 3I4NI 4JI8C 4A3II 1IBLC 4LF8C 4OX9C 3GTMS 3GTLI 1NUIA 4LFCC 4A3MI 1I94C 4BBRI 5BR8C 2J6AA 4DV1C 1UKKA 5FLXD 3HOWI 2D7VA 1JOSA 2UUCC 4A3DI 1X3ZA 1WW9A 2XR1A 4BSZA 5CM2M 4DR6C 4K0KC 3H3VJ 4LF9C 1N32C 2EGTA 3M3YI 1R9TI 5IT9D 4NB8A 4GKJC 4DCTA 4DUYC 2JR6A 1XNRC 3S2HI 2UXCC 4JYAC 3HOXI 1WF3A 1N34C 3CJEA 4NBCA 3S15I 3S1NI 1K83I 3PO3S 4DV4C 1KKGA 5C3EI 4BY7I 2ZM6C 2F4OA 5C44I 1IBMC 3ESWA 1TWCI 4LFBC 4YY3C 4DV2C 2VQFC 4MH4A 3VMGA 3PO3I 1Y1WI 2E2HI 2JMPA 1J5EC 4DV5C 1I3QI 3GTJI 1HH2P 2YCBA 1TFIA 4A3FI 3GCFA 4DCUA 2NVYI 5IWAC 2UXDC 1QYPA 1I6HI 4DR3C 3CQZI 2NVTI 4MTNA 1WH9A 1I50I 4DCVA 3S17I 4X66C 1HR0C 5LMNC 4LFAC 3GTQI 2JA6I 4A3EI 1QWIA 2E8CA 4A3CI 1L2FA 3S2DI 3K7AI 4JI0C 4X65C 3AF6A 2R93I 3Q87A 3M4OI 3T1HC 1N36C 1VLAA 2DE5A 3EERA 4NBAA 2JA5I 2UU9C 1SFOI 2P3YA 4XX2A 5FLMI 4X64C 2VQEC 2E5LC 1MKYA 4JI5C 4KHPC 1N33C 3U50C 4DR5C 4DV0C 3H0GI 2YU9I 3RZDI 2PT7G 4A3JI 2UUAC 2CY1A 3R9XA 4NBFA 4B3MC 2ASBA 2NVXI 3GKQA 3IEUA 3GTKI 4NXNC 1Y1VS 4A93I 5LMUC 1TWFI 4QTTA 2OPLA 2DE6A 2ONFA 4Y7NI 4B3TC 4BBSI 3GTOI 3JAMD 3J80D 1HNXC 1TWAI 4NB9A 2B63I 5C4JI 3S16I 5A2QD 2JNYA 4GKKC 2E7GA 5IP9I 1NYEA 4LF6C 1ZB8A 4A3GI 2E8EA 4DV7C 4JV5C 1LQLA 3HOZI 2E2JI 2UXBC 4X62C 4LF4C 3I07A 1ML8A
chains in the Genus database with same CATH superfamily
4JI3C 4DG9A 1LCIA 4DR4C 2QEXZ 4JI4C 1N33C 1RNIA 5A2Qb 1N8R2 1PU1A 3CC41 3OTOC 3VB9A 3UEBA 3IF8A 2F4VC 3CC4Z 2E9HA 4AQYC 3IX0A 1USPB 2IZ4A 2KPIA 3NDIA 3J80f 1KD11 4NXMC 3OW2Y 1RG9A 3LGXA 1YJW1 2E2II 1VQM1 1FLOA 1PFTA 1K732 4IR7A 5IP7I 3TDHB 4E2XA 1ZB9A 4JI6C 3PBKA 4DR2C 1S7MA 2V45A 3CCQZ 2OTJ1 2QW0X 3RZOI 3AF5A 2Y4OA 4FUQA 4DR7C 1M6XA 2JMOA 4NOZA 4A3BI 4NH1C 2PROA 1YHQ1 4A3LI 2OO4A 1RO0A 3L95X 3T1YC 1M1K1 3C5EA 5IFIA 4FUTA 4DV6C 3I08A 2R92I 3LNVA 4ZLPA 3CCJZ 1XMOC 1Y1VI 4JI8C 4LF8C 4U5YD 4BC9A 1NUIA 4NFRA 2GTIA 4DGLA 1I94C 3RG2A 5FLXD 1YIT1 1JOSA 3JAMf 1Q822 2AYAA 4DR6C 3EQ6A 4LF9C 4D57A 4NB8A 5BSVA 1S721 4GKJC 2UXCC 4JYAC 4LE5A 1VQLZ 3DHVA 2VF1A 2Z51A 5LCIA 4DV4C 3PO3S 2DPLA 2YWCA 1Q861 3NI2A 2KI7B 3D9XA 1V60A 2F4OA 2JNVA 1IBMC 3ESWA 1TWCI 2VQFC 4MD8A 4MH4A 1GPMA 4DCUA 2MCQA 2P02A 4RLFA 5T8TA 1N8R1 1QVFY 2NVTI 1WH9A 4D4IA 5KYTA 1M901 2Y4NA 1NJI2 3GTQI 1Q821 4OXIA 1QWIA 3S2DI 4RM2A 2R93I 5BSUA 5LL6f 5D1PA 3F3FC 3KIHA 4NBAA 4RV9A 2IV2X 5FLMI 4XX2A 5AE1A 3MONA 1MDFA 5GTDA 1ULTA 2VQEC 3CXCY 2V8JA 4DR5C 3CQ1A 4RVFA 4A3JI 4FTFA 3B7WA 1Z03A 3R9XA 3TQIA 1VQ6Z 2NVXI 3E7WA 4I9GA 3NH5A 5D1OB 2OZKA 1Y1VS 2VZEA 5LMUC 1TWFI 2K3RA 3IFUA 3NH8A 3VTNA 2QR1B 2ONFA 4BBSI 3ETOA 1QXFA 3GTOI 2GTHA 5K8FA 1KQSZ 2D1RA 2P2FA 2WAQA 3FCEA 4NDNA 5K85A 1MXAA 2UXBC 3CW9A 1YJN1 3O2EA 2G2KA 5C4XI 4HH4A 3CCLZ 3S1RI 4NBEA 1PA4A 1USPA 2ZAEB 1VQK1 4G36A 3FKII 4X6AI 2E8FA 1YJNZ 3IPLA 1RQFA 4R1LA 3R9WA 3GR1A 4DV3C 4GS5A 3E7XA 2QRDB 3A26A 3GTMI 4JI1C 1YUAA 2NVQI 3MZKB 4Y52I 1XRCA 1JJ2Y 3S14I 2D28C 1M6XC 2HF1A 4RVOA 4QTUA 4DCSA 5A1IA 3J81D 2P20A 4NBBA 1TH5A 3IR7A 1Q811 5D1OA 4ZJZA 3PESA 1M1K2 4JM1A 1KC82 1RLYA 2JA8I 3KXWA 1P4EC 3CPWZ 1Q862 1TWHI 3CCE1 2QA4Z 3J81b 4GXQA 4PUIA 1XNQC 2JIMA 4PUGA 1YJ91 2VSQA 2HHHC 4KTTA 4B3SC 4BXXI 2YADA 1V26A 3CCVZ 4G37A 1HNZC 3D6WA 1P9NA 1YJ7A 3I55Z 2JS4A 3H2TA 4D4GA 1N32C 4PROC 1WZNA 3CCQ1 2OTJZ 5A1GA 1IBLC 1WJ2A 3GTMS 3GTLI 4BCAA 4A3MI 3G71Z 1W2BY 4BBRI 1Q812 2QVZX 4ODJA 4L7IA 2UUCC 1X0TA 2W03A 1P7LA 1Q7Y2 4BSZA 1Z01A 2EGTA 2QVXX 2QLVB 2ZZMA 4DCTA 2JR6A 4RVHA 4GXRA 3SO4A 1VQ41 2D27A 1WIIA 2Y27A 1WF3A 1VQMZ 1NJI1 3CJEA 3UZ0A 2WD9A 2LIYA 4D56A 5BSRA 1Y8CA 5JRHA 4TNUA 2JMPA 1Y1WI 4RVGA 4DV5C 1I3QI 2YCBA 5IWAC 2NVYI 5CZVA 3J81f 4PZPA 1K9M2 1KRLA 4MTNA 1I50I 3AY0A 2D1SA 4X66C 2VUGA 3FQQA 2BH1X 5LMNC 1IB8A 2V8KA 2JIQA 2VPZA 2JA6I 2M5HA 5KEIA 1AA6A 1MXCA 4A3CI 4JI0C 3DLPX 3K7AI 3N2QA 3AF6A 4RVDA 3Q87A 2UU9C 2M6NA 4MXUA 3L8CA 4JI5C 5AE2A 1Z02A 4HGZA 1K8A2 3H0GI 2YU9I 2D1TA 3NH4A 4L4QA 2W04A 3VNSA 1KC81 1YITZ 2CY1A 3GTKI 3UX3A 1MXBA 4RMNA 2LFUA 5FLXf 1NP6A 4EATA 4RM3A 4L2ZA 3A9VA 1YJWZ 2R6MA 3A25A 1UWDA 2RT9A 4E2ZA 2M5OA 4LF6C 1QVGZ 1ZB8A 2E8EA 5CZXA 4JV5C 1LQLA 1Q16A 2E7ZA 3BG0B 3CCV1 1VQOZ 3CCRZ 3HOZI 3DAYA 3R44A 1T5HX 4X62C 4LF4C 2K5RA 2KZFA 1VQO1 3CCEZ 2P2QA 3CCL1 3GKUA 2UUBC 4NBGA 5BSTA 1XMQC 1FDIA 2JA7I 1TWGI 4B3RC 4BY1I 1K0RA 1X3WA 1VQ8Z 3HKZA 1VQP1 1WCJA 3TUFA 3PO2I 4E2WA 2D1QA 4WS9A 2VUMI 3N54B 2Q4ZA 2VPXA 1WCMI 4JI2C 2PK7A 1RO4A 3GTPI 3I4MI 2IZ3A 1HNWC 3CCMZ 1O90A 4MONA 2BJOA 3S1MI 2V8IA 4YHHC 4BC7A 2OTL1 4NBHA 1VQ61 4HGYA 4NBDA 2OOXB 2OTLZ 2HJGA 1FDOA 2RHBA 2AKLA 4DUZC 3HOVI 1S72Z 1QVGY 3LUSA 4DG8A 2KZ0A 2O53A 2JIOA 1Q7Y1 3UX2A 2QRCB 4CL1A 1N2FA 3HOYI 1JJ2Z 3CD6Z 3FCCA 2DE7A 2R7ZI 3IMLA 2PN2A 2AYDA 4A3II 2P2BA 3CD61 4LFCC 4EWCA 1VQ9Z 2J6AA 1UKKA 4A3DI 5AE3A 2QVYX 1X3ZA 2XR1A 4K0KC 5CM2M 3H3VJ 2MM9A 4MD9A 3M3YI 2KDNA 1PG4A 3J7A4 1R9TI 4TPSB 2ZZNA 1XNRC 3S2HI 1PG3A 3F3PC 3J80b 5FLXb 3HOXI 3P5JB 2YWBA 4R0MA 5AN9F 3NPDA 5BSWA 4NBCA 3S1NI 1NY8A 3A4IA 1XHJA 5IT9b 1MDBA 1YIJZ 2PMZA 2ZM6C 4LFBC 2QEX1 3LAXA 4DV2C 1W2BZ 1RO2A 3PO3I 2E2HI 2DHMA 1J5EC 1YI21 4E2YA 1TFIA 3CCU1 4A3FI 1I6HI 4DR3C 3CQZI 3TE5B 4DCVA 4G1IA 5T64A 1YJ9Z 4DQYB 1HR0C 4LFAC 2V7BA 3CCS1 5BUSA 4IZ6A 1L2FA 3MZLB 1O93A 4X65C 3T1HC 3M4OI 3EERA 2DE5A 3TR3A 4KHPC 3CCR1 4X64C 2E5LC 3G6E1 1MKYA 2P2MA 2VPYA 5BSMA 3I56Z 2QKDA 2JIRA 3VNRA 2PT7G 1P4EA 4NBFA 2ASBA 3EEDA 3GKQA 4MD7A 3VNQA 3IEUA 4A93I 3G7SA 4RS4A 3OW2Z 2OPLA 2DE6A 4I9FA 4Y7NI 4K0BA 3T4NB 2Q51A 1K9M1 1TWAI 3PROC 2B63I 5C4JI 3S16I 5H9UA 5KYVA 5A2QD 4GKKC 1MD9A 1T5DX 1JWHC 2HU9A 2E2JI 4MRIA 1EGAA 2D7VA 5BUQA 2V3VA 2WB1A 2QA41 1FJGC 3UOWA 2F4MA 3GTGI 1K8A1 3CPWY 1XRAA 2P2JA 2YX1A 3TDEA 3CCUZ 1DL6A 4E31A 4S1TA 4R1MA 3S82A 2RPRA 5T6BA 1KQSY 1IBKC 2CXCA 3VMIA 1VQPZ 1VQ81 3CC2Z 2JUBA 4A3KI 3IEVA 3CW8X 3CQ3A 2OPLB 4OYCA 4DK1A 1XRBA 4AYBA 3D2LA 1VEHA 2DYJA 3HOUI 1VQ7Z 3CMA1 3VMHA 4KTVA 3QWUA 4E30A 1VQKZ 4LF7C 3S1QI 2RBLA 4DR1C 1KD12 1L1OC 2MMAB 4RLQA 5T8SA 4JI7C 3A9UA 4E33A 5E7QA 1AMUA 2ATWA 1QF8A 1SIWA 2QL8A 4RVNA 3CCM1 4LF5C 1VQNZ 4PUHA 3I4NI 2CU6A 3FQMA 4OX9C 1ZH1A 3BG1B 3K6RA 2O4HA 1VQ51 1O9TA 1QVFZ 5BR8C 2GU2A 4DV1C 3HOWI 3G6EZ 5T67A 2P28A 1VQ5Z 3GPCA 3NYQA 1WW9A 4PHTA 5DV9A 5BURA 4E32A 1V25A 2NCLA 3CCSZ 5IT9D 3NFZA 4DUYC 3CXCZ 2M48A 1VQL1 2NAPA 2LEXA 3GR0A 1N34C 4HPVA 2I3CA 3S15I 1VQ91 1K83I 3KIFA 3JAMb 2OBVA 3LNOA 1KKGA 5C3EI 1FUGA 4BY7I 1QM4A 5C44I 2OOYB 4YY3C 3VMGA 2JIPA 5A2Qf 3G711 2WP0C 3CMEZ 1HH2P 3GTJI 2UXDC 3GCFA 1QYPA 1YI2Z 3CME1 3ETCA 3S17I 2E0GA 1RY2A 2Y0SA 4A3EI 5IT9f 1O92A 2QREB 2E8CA 2H85A 1BA3A 1N36C 1VLAA 1YIJ1 2JA5I 2VPWA 1SFOI 1VQ4Z 2P3YA 1VQN1 3U50C 2RIQA 4DV0C 3RZDI 1M902 1XS3A 2UUAC 2PM9A 5A19A 4B3MC 1VQ71 4BBYA 4WV3A 4NXNC 3CC71 3CMAZ 3NYRA 4QTTA 5ADZA 1YUKA 4B3TC 3RV2A 3CC7Z 1YHQZ 3NDJA 3G4SZ 3CC21 3JAMD 1K731 3CQ2A 3J80D 1HNXC 4NB9A 2JNYA 3G4S1 3CCJ1 2E7GA 5IP9I 3I551 1NYEA 3I561 4A3GI 4ISBA 4DV7C 3I07A 1ML8A
chains in the Genus database with same CATH topology
4JI3C 4DG9A 1LCIA 4DR4C 2QEXZ 4JI4C 1N33C 1RNIA 5A2Qb 1N8R2 3CC41 3OTOC 3VB9A 3IF8A 2F4VC 3CC4Z 2E9HA 4AQYC 3IX0A 1USPB 2IZ4A 2KPIA 3NDIA 3J80f 1KD11 4NXMC 3OW2Y 1RG9A 3LGXA 1YJW1 2E2II 1VQM1 1PFTA 1K732 4IR7A 5IP7I 3TDHB 4E2XA 1ZB9A 4JI6C 3PBKA 4DR2C 1S7MA 3CCQZ 2OTJ1 2QW0X 3RZOI 3AF5A 2Y4OA 4FUQA 4DR7C 2JMOA 4NOZA 4A3BI 4NH1C 2PROA 1YHQ1 4A3LI 2OO4A 1RO0A 3L95X 3T1YC 1M1K1 3C5EA 5IFIA 4FUTA 4DV6C 3I08A 2R92I 3LNVA 4ZLPA 3CCJZ 1XMOC 1Y1VI 4JI8C 4LF8C 4U5YD 4BC9A 1NUIA 4NFRA 2GTIA 4DGLA 1I94C 3RG2A 5FLXD 1YIT1 1JOSA 3JAMf 1Q822 2AYAA 4DR6C 3EQ6A 4LF9C 4D57A 4NB8A 5BSVA 1S721 4GKJC 2UXCC 4JYAC 4LE5A 1VQLZ 3DHVA 2VF1A 4DV4C 3PO3S 2DPLA 2YWCA 1Q861 3NI2A 2KI7B 3D9XA 2F4OA 1IBMC 3ESWA 1TWCI 2VQFC 4MD8A 4MH4A 1GPMA 4DCUA 2P02A 4RLFA 5T8TA 1N8R1 1QVFY 2NVTI 1WH9A 4D4IA 5KYTA 1M901 2Y4NA 1NJI2 3GTQI 1Q821 4OXIA 1QWIA 3S2DI 4RM2A 2R93I 5BSUA 5LL6f 5D1PA 3F3FC 3KIHA 4NBAA 4RV9A 5FLMI 4XX2A 5AE1A 3MONA 1MDFA 5GTDA 1ULTA 2VQEC 3CXCY 2V8JA 4DR5C 4RVFA 4A3JI 4FTFA 3B7WA 1Z03A 3R9XA 3TQIA 1VQ6Z 2NVXI 3E7WA 4I9GA 3NH5A 5D1OB 2OZKA 1Y1VS 2VZEA 5LMUC 1TWFI 2K3RA 3IFUA 3NH8A 3VTNA 2QR1B 2ONFA 4BBSI 3ETOA 3GTOI 2GTHA 5K8FA 1KQSZ 2D1RA 2P2FA 2WAQA 3FCEA 4NDNA 5K85A 1MXAA 2UXBC 3CW9A 1YJN1 2G2KA 5C4XI 4HH4A 3CCLZ 3S1RI 4NBEA 1PA4A 1USPA 2ZAEB 1VQK1 4G36A 3FKII 4X6AI 2E8FA 1YJNZ 3IPLA 1RQFA 4R1LA 3R9WA 3GR1A 4DV3C 4GS5A 3E7XA 2QRDB 3GTMI 4JI1C 1YUAA 2NVQI 3MZKB 4Y52I 1XRCA 1JJ2Y 3S14I 2D28C 2HF1A 4RVOA 4QTUA 4DCSA 5A1IA 3J81D 2P20A 4NBBA 1Q811 5D1OA 4ZJZA 3PESA 1M1K2 4JM1A 1KC82 1RLYA 2JA8I 3KXWA 3CPWZ 1Q862 1TWHI 3CCE1 2QA4Z 3J81b 4GXQA 1XNQC 1YJ91 2VSQA 2HHHC 4KTTA 4B3SC 4BXXI 2YADA 1V26A 3CCVZ 4G37A 1HNZC 3D6WA 1P9NA 1YJ7A 3I55Z 2JS4A 3H2TA 4D4GA 1N32C 4PROC 3CCQ1 2OTJZ 5A1GA 1IBLC 3GTMS 3GTLI 4BCAA 4A3MI 3G71Z 1W2BY 4BBRI 1Q812 2QVZX 4ODJA 4L7IA 2UUCC 1X0TA 2W03A 1P7LA 1Q7Y2 4BSZA 1Z01A 2EGTA 2QVXX 2QLVB 4DCTA 2JR6A 4RVHA 4GXRA 3SO4A 1VQ41 2D27A 1WIIA 2Y27A 1WF3A 1VQMZ 1NJI1 3CJEA 3UZ0A 2WD9A 2LIYA 4D56A 5BSRA 5JRHA 4TNUA 2JMPA 1Y1WI 4RVGA 4DV5C 1I3QI 2YCBA 5IWAC 2NVYI 5CZVA 3J81f 4PZPA 1K9M2 1KRLA 4MTNA 1I50I 2D1SA 4X66C 2VUGA 3FQQA 2BH1X 5LMNC 2V8KA 2JA6I 5KEIA 1MXCA 4A3CI 4JI0C 3DLPX 3K7AI 3N2QA 3AF6A 4RVDA 3Q87A 2UU9C 2M6NA 4MXUA 3L8CA 4JI5C 5AE2A 1Z02A 4HGZA 1K8A2 3H0GI 2YU9I 2D1TA 3NH4A 4L4QA 2W04A 3VNSA 1KC81 1YITZ 2CY1A 3GTKI 1MXBA 4RMNA 2LFUA 5FLXf 1NP6A 4EATA 4RM3A 4L2ZA 3A9VA 1YJWZ 2R6MA 2RT9A 4E2ZA 4LF6C 1QVGZ 1ZB8A 2E8EA 5CZXA 4JV5C 1LQLA 1VQOZ 3CCV1 3BG0B 3HOZI 3DAYA 3CCRZ 3R44A 4X62C 4LF4C 1T5HX 2K5RA 2KZFA 1VQO1 3CCEZ 2P2QA 3CCL1 3GKUA 2UUBC 4NBGA 5BSTA 1XMQC 2JA7I 1TWGI 4B3RC 4BY1I 1K0RA 1X3WA 1VQ8Z 3HKZA 1VQP1 3TUFA 3PO2I 4E2WA 2D1QA 4WS9A 2VUMI 3N54B 2Q4ZA 1WCMI 4JI2C 2PK7A 1RO4A 3GTPI 3I4MI 2IZ3A 1HNWC 3CCMZ 1O90A 4MONA 2BJOA 3S1MI 2V8IA 4YHHC 4BC7A 2OTL1 4NBHA 1VQ61 4HGYA 4NBDA 2OOXB 2OTLZ 2HJGA 2RHBA 2AKLA 4DUZC 3HOVI 1S72Z 1QVGY 3LUSA 4DG8A 2O53A 1Q7Y1 2QRCB 4CL1A 1N2FA 3HOYI 1JJ2Z 3CD6Z 3FCCA 2DE7A 2R7ZI 3IMLA 2PN2A 4A3II 2P2BA 3CD61 4LFCC 4EWCA 1VQ9Z 2J6AA 1UKKA 4A3DI 5AE3A 2QVYX 1X3ZA 2XR1A 4K0KC 5CM2M 3H3VJ 4MD9A 3M3YI 1PG4A 3J7A4 1R9TI 4TPSB 1XNRC 3S2HI 1PG3A 3F3PC 3J80b 5FLXb 3HOXI 3P5JB 2YWBA 4R0MA 5AN9F 3NPDA 5BSWA 4NBCA 3S1NI 3A4IA 5IT9b 1MDBA 1YIJZ 2PMZA 2ZM6C 4LFBC 2QEX1 3LAXA 4DV2C 1W2BZ 1RO2A 3PO3I 2E2HI 1J5EC 1YI21 4E2YA 1TFIA 3CCU1 4A3FI 1I6HI 4DR3C 3CQZI 3TE5B 4DCVA 4G1IA 5T64A 1YJ9Z 4DQYB 1HR0C 4LFAC 2V7BA 3CCS1 5BUSA 4IZ6A 1L2FA 3MZLB 1O93A 4X65C 3T1HC 3M4OI 3EERA 2DE5A 4KHPC 3CCR1 4X64C 2E5LC 3G6E1 1MKYA 2P2MA 5BSMA 3I56Z 2QKDA 3VNRA 2PT7G 4NBFA 2ASBA 3EEDA 3GKQA 4MD7A 3VNQA 3IEUA 4A93I 3G7SA 4RS4A 3OW2Z 2OPLA 2DE6A 4I9FA 4Y7NI 4K0BA 3T4NB 2Q51A 1K9M1 1TWAI 3PROC 2B63I 5C4JI 3S16I 5H9UA 5KYVA 5A2QD 4GKKC 1MD9A 1T5DX 1JWHC 2HU9A 2E2JI 4MRIA 1EGAA 2D7VA 5BUQA 2WB1A 2QA41 1FJGC 3UOWA 2F4MA 3GTGI 1K8A1 3CPWY 1XRAA 2P2JA 3TDEA 3CCUZ 1DL6A 4E31A 4S1TA 4R1MA 3S82A 2RPRA 5T6BA 1KQSY 1IBKC 2CXCA 3VMIA 1VQPZ 1VQ81 3CC2Z 2JUBA 4A3KI 3IEVA 3CW8X 4OYCA 2OPLB 4DK1A 1XRBA 4AYBA 2DYJA 3HOUI 1VQ7Z 3CMA1 3VMHA 4KTVA 3QWUA 4E30A 1VQKZ 4LF7C 3S1QI 2RBLA 4DR1C 1KD12 1L1OC 4RLQA 5T8SA 4JI7C 3A9UA 4E33A 5E7QA 1AMUA 2ATWA 1QF8A 2QL8A 4RVNA 3CCM1 4LF5C 1VQNZ 3I4NI 3FQMA 4OX9C 1ZH1A 3BG1B 2O4HA 1VQ51 1O9TA 1QVFZ 5BR8C 2GU2A 4DV1C 3HOWI 3G6EZ 5T67A 2P28A 1VQ5Z 3GPCA 3NYQA 1WW9A 4PHTA 5DV9A 5BURA 4E32A 1V25A 3CCSZ 5IT9D 3NFZA 4DUYC 3CXCZ 2M48A 1VQL1 3GR0A 1N34C 4HPVA 2I3CA 3S15I 1VQ91 1K83I 3KIFA 3JAMb 2OBVA 1KKGA 5C3EI 1FUGA 4BY7I 1QM4A 5C44I 2OOYB 4YY3C 3VMGA 5A2Qf 3G711 2WP0C 3CMEZ 1HH2P 3GTJI 2UXDC 3GCFA 1QYPA 1YI2Z 3CME1 3ETCA 3S17I 2E0GA 1RY2A 2Y0SA 4A3EI 5IT9f 1O92A 2QREB 2E8CA 2H85A 1BA3A 1N36C 1VLAA 1YIJ1 2JA5I 1SFOI 1VQ4Z 2P3YA 1VQN1 3U50C 2RIQA 4DV0C 3RZDI 1M902 2UUAC 2PM9A 5A19A 4B3MC 1VQ71 4BBYA 4WV3A 4NXNC 3CC71 3CMAZ 3NYRA 4QTTA 5ADZA 1YUKA 4B3TC 3RV2A 3CC7Z 1YHQZ 3NDJA 3G4SZ 3CC21 3JAMD 1K731 3J80D 1HNXC 4NB9A 2JNYA 3G4S1 3CCJ1 2E7GA 5IP9I 3I551 1NYEA 3I561 4A3GI 4ISBA 4DV7C 3I07A 1ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 C;  2K5R A;  5C4X I;  3S1R I;  1PA4 A;  2KZF A;  4NBE A;  4DR4 C;  1USP A;  4JI4 C;  1FJG C;  3FKI I;  4X6A I;  2E8F A;  3GKU A;  2F4M A;  3GTG I;  2UUB C;  3R9W A;  4NBG A;  4DV3 C;  3OTO C;  3VB9 A;  1XMQ C;  1DL6 A;  2JA7 I;  3GTM I;  1YUA A;  4JI1 C;  2NVQ I;  2F4V C;  1TWG I;  4B3R C;  4Y52 I;  4BY1 I;  1K0R A;  1X3W A;  4AQY C;  3S14 I;  1IBK C;  1USP B;  3VMI A;  2HF1 A;  3PO2 I;  2CXC A;  2KPI A;  4QTU A;  4A3K I;  4DCS A;  3J81 D;  2VUM I;  4NXM C;  3IEV A;  4NBB A;  2OPL B;  2E2I I;  1WCM I;  1PFT A;  2PK7 A;  1RO4 A;  3GTP I;  3I4M I;  5IP7 I;  2DYJ A;  4JI2 C;  1HNW C;  1EGA A;  1ZB9 A;  3HOU I;  2BJO A;  4DR2 C;  3S1M I;  4JI6 C;  1RLY A;  2JA8 I;  4YHH C;  3VMH A;  1TWH I;  3RZO I;  3AF5 A;  4NBH A;  4LF7 C;  4DR7 C;  4NBD A;  3S1Q I;  2RBL A;  4DR1 C;  4NOZ A;  2HJG A;  1XNQ C;  1L1O C;  2AKL A;  4DUZ C;  3HOV I;  4A3B I;  3LUS A;  2HHH C;  4B3S C;  4JI7 C;  4BXX I;  4A3L I;  3T1Y C;  2ATW A;  1HNZ C;  2QL8 A;  1N2F A;  3HOY I;  4DV6 C;  3D6W A;  2DE7 A;  2R92 I;  2R7Z I;  2JS4 A;  4LF5 C;  2PN2 A;  1XMO C;  1Y1V I;  3I4N I;  4JI8 C;  4A3I I;  1IBL C;  4LF8 C;  4OX9 C;  3GTM S;  3GTL I;  1NUI A;  4LFC C;  4A3M I;  1I94 C;  4BBR I;  5BR8 C;  2J6A A;  4DV1 C;  1UKK A;  5FLX D;  3HOW I;  2D7V A;  1JOS A;  2UUC C;  4A3D I;  1X3Z A;  1WW9 A;  2XR1 A;  4BSZ A;  5CM2 M;  4DR6 C;  4K0K C;  3H3V J;  4LF9 C;  1N32 C;  2EGT A;  3M3Y I;  1R9T I;  5IT9 D;  4NB8 A;  4GKJ C;  4DCT A;  4DUY C;  2JR6 A;  1XNR C;  3S2H I;  2UXC C;  4JYA C;  3HOX I;  1WF3 A;  1N34 C;  3CJE A;  4NBC A;  3S15 I;  3S1N I;  1K83 I;  3PO3 S;  4DV4 C;  1KKG A;  5C3E I;  4BY7 I;  2ZM6 C;  2F4O A;  5C44 I;  1IBM C;  3ESW A;  1TWC I;  4LFB C;  4YY3 C;  4DV2 C;  2VQF C;  4MH4 A;  3VMG A;  3PO3 I;  1Y1W I;  2E2H I;  2JMP A;  1J5E C;  4DV5 C;  1I3Q I;  3GTJ I;  1HH2 P;  2YCB A;  1TFI A;  4A3F I;  3GCF A;  4DCU A;  2NVY I;  5IWA C;  2UXD C;  1QYP A;  1I6H I;  4DR3 C;  3CQZ I;  2NVT I;  4MTN A;  1WH9 A;  1I50 I;  4DCV A;  3S17 I;  4X66 C;  1HR0 C;  5LMN C;  4LFA C;  3GTQ I;  2JA6 I;  4A3E I;  1QWI A;  2E8C A;  4A3C I;  1L2F A;  3S2D I;  3K7A I;  4JI0 C;  4X65 C;  3AF6 A;  2R93 I;  3Q87 A;  3M4O I;  3T1H C;  1N36 C;  1VLA A;  2DE5 A;  3EER A;  4NBA A;  2JA5 I;  2UU9 C;  1SFO I;  2P3Y A;  4XX2 A;  5FLM I;  4X64 C;  2VQE C;  2E5L C;  1MKY A;  4JI5 C;  4KHP C;  1N33 C;  3U50 C;  4DR5 C;  4DV0 C;  3H0G I;  2YU9 I;  3RZD I;  2PT7 G;  4A3J I;  2UUA C;  2CY1 A;  3R9X A;  4NBF A;  4B3M C;  2ASB A;  2NVX I;  3GKQ A;  3IEU A;  3GTK I;  4NXN C;  1Y1V S;  4A93 I;  5LMU C;  1TWF I;  4QTT A;  2OPL A;  2DE6 A;  2ONF A;  4Y7N I;  4B3T C;  4BBS I;  3GTO I;  3JAM D;  3J80 D;  1HNX C;  1TWA I;  4NB9 A;  2B63 I;  5C4J I;  3S16 I;  5A2Q D;  2JNY A;  4GKK C;  2E7G A;  5IP9 I;  1NYE A;  4LF6 C;  1ZB8 A;  4A3G I;  2E8E A;  4DV7 C;  4JV5 C;  1LQL A;  3HOZ I;  2E2J I;  2UXB C;  4X62 C;  4LF4 C;  3I07 A;  1ML8 A; 
#chains in the Genus database with same CATH topology
 4JI3 C;  4DG9 A;  1LCI A;  4DR4 C;  2QEX Z;  4JI4 C;  1N33 C;  1RNI A;  5A2Q b;  1N8R 2;  1PU1 A;  3CC4 1;  3OTO C;  3VB9 A;  3UEB A;  3IF8 A;  2F4V C;  3CC4 Z;  2E9H A;  4AQY C;  3IX0 A;  1USP B;  2IZ4 A;  2KPI A;  3NDI A;  3J80 f;  1KD1 1;  4NXM C;  3OW2 Y;  1RG9 A;  3LGX A;  1YJW 1;  2E2I I;  1VQM 1;  1FLO A;  1PFT A;  1K73 2;  4IR7 A;  5IP7 I;  3TDH B;  4E2X A;  1ZB9 A;  4JI6 C;  3PBK A;  4DR2 C;  1S7M A;  2V45 A;  3CCQ Z;  2OTJ 1;  2QW0 X;  3RZO I;  3AF5 A;  2Y4O A;  4FUQ A;  4DR7 C;  1M6X A;  2JMO A;  4NOZ A;  4A3B I;  4NH1 C;  2PRO A;  1YHQ 1;  4A3L I;  2OO4 A;  1RO0 A;  3L95 X;  3T1Y C;  1M1K 1;  3C5E A;  5IFI A;  4FUT A;  4DV6 C;  3I08 A;  2R92 I;  3LNV A;  4ZLP A;  3CCJ Z;  1XMO C;  1Y1V I;  4JI8 C;  4LF8 C;  4U5Y D;  4BC9 A;  1NUI A;  4NFR A;  2GTI A;  4DGL A;  1I94 C;  3RG2 A;  5FLX D;  1YIT 1;  1JOS A;  3JAM f;  1Q82 2;  2AYA A;  4DR6 C;  3EQ6 A;  4LF9 C;  4D57 A;  4NB8 A;  5BSV A;  1S72 1;  4GKJ C;  2UXC C;  4JYA C;  4LE5 A;  1VQL Z;  3DHV A;  2VF1 A;  2Z51 A;  5LCI A;  4DV4 C;  3PO3 S;  2DPL A;  2YWC A;  1Q86 1;  3NI2 A;  2KI7 B;  3D9X A;  1V60 A;  2F4O A;  2JNV A;  1IBM C;  3ESW A;  1TWC I;  2VQF C;  4MD8 A;  4MH4 A;  1GPM A;  4DCU A;  2MCQ A;  2P02 A;  4RLF A;  5T8T A;  1N8R 1;  1QVF Y;  2NVT I;  1WH9 A;  4D4I A;  5KYT A;  1M90 1;  2Y4N A;  1NJI 2;  3GTQ I;  1Q82 1;  4OXI A;  1QWI A;  3S2D I;  4RM2 A;  2R93 I;  5BSU A;  5LL6 f;  5D1P A;  3F3F C;  3KIH A;  4NBA A;  4RV9 A;  2IV2 X;  5FLM I;  4XX2 A;  5AE1 A;  3MON A;  1MDF A;  5GTD A;  1ULT A;  2VQE C;  3CXC Y;  2V8J A;  4DR5 C;  3CQ1 A;  4RVF A;  4A3J I;  4FTF A;  3B7W A;  1Z03 A;  3R9X A;  3TQI A;  1VQ6 Z;  2NVX I;  3E7W A;  4I9G A;  3NH5 A;  5D1O B;  2OZK A;  1Y1V S;  2VZE A;  5LMU C;  1TWF I;  2K3R A;  3IFU A;  3NH8 A;  3VTN A;  2QR1 B;  2ONF A;  4BBS I;  3ETO A;  1QXF A;  3GTO I;  2GTH A;  5K8F A;  1KQS Z;  2D1R A;  2P2F A;  2WAQ A;  3FCE A;  4NDN A;  5K85 A;  1MXA A;  2UXB C;  3CW9 A;  1YJN 1;  3O2E A;  2G2K A;  5C4X I;  4HH4 A;  3CCL Z;  3S1R I;  4NBE A;  1PA4 A;  1USP A;  2ZAE B;  1VQK 1;  4G36 A;  3FKI I;  4X6A I;  2E8F A;  1YJN Z;  3IPL A;  1RQF A;  4R1L A;  3R9W A;  3GR1 A;  4DV3 C;  4GS5 A;  3E7X A;  2QRD B;  3A26 A;  3GTM I;  4JI1 C;  1YUA A;  2NVQ I;  3MZK B;  4Y52 I;  1XRC A;  1JJ2 Y;  3S14 I;  2D28 C;  1M6X C;  2HF1 A;  4RVO A;  4QTU A;  4DCS A;  5A1I A;  3J81 D;  2P20 A;  4NBB A;  1TH5 A;  3IR7 A;  1Q81 1;  5D1O A;  4ZJZ A;  3PES A;  1M1K 2;  4JM1 A;  1KC8 2;  1RLY A;  2JA8 I;  3KXW A;  1P4E C;  3CPW Z;  1Q86 2;  1TWH I;  3CCE 1;  2QA4 Z;  3J81 b;  4GXQ A;  4PUI A;  1XNQ C;  2JIM A;  4PUG A;  1YJ9 1;  2VSQ A;  2HHH C;  4KTT A;  4B3S C;  4BXX I;  2YAD A;  1V26 A;  3CCV Z;  4G37 A;  1HNZ C;  3D6W A;  1P9N A;  1YJ7 A;  3I55 Z;  2JS4 A;  3H2T A;  4D4G A;  1N32 C;  4PRO C;  1WZN A;  3CCQ 1;  2OTJ Z;  5A1G A;  1IBL C;  1WJ2 A;  3GTM S;  3GTL I;  4BCA A;  4A3M I;  3G71 Z;  1W2B Y;  4BBR I;  1Q81 2;  2QVZ X;  4ODJ A;  4L7I A;  2UUC C;  1X0T A;  2W03 A;  1P7L A;  1Q7Y 2;  4BSZ A;  1Z01 A;  2EGT A;  2QVX X;  2QLV B;  2ZZM A;  4DCT A;  2JR6 A;  4RVH A;  4GXR A;  3SO4 A;  1VQ4 1;  2D27 A;  1WII A;  2Y27 A;  1WF3 A;  1VQM Z;  1NJI 1;  3CJE A;  3UZ0 A;  2WD9 A;  2LIY A;  4D56 A;  5BSR A;  1Y8C A;  5JRH A;  4TNU A;  2JMP A;  1Y1W I;  4RVG A;  4DV5 C;  1I3Q I;  2YCB A;  5IWA C;  2NVY I;  5CZV A;  3J81 f;  4PZP A;  1K9M 2;  1KRL A;  4MTN A;  1I50 I;  3AY0 A;  2D1S A;  4X66 C;  2VUG A;  3FQQ A;  2BH1 X;  5LMN C;  1IB8 A;  2V8K A;  2JIQ A;  2VPZ A;  2JA6 I;  2M5H A;  5KEI A;  1AA6 A;  1MXC A;  4A3C I;  4JI0 C;  3DLP X;  3K7A I;  3N2Q A;  3AF6 A;  4RVD A;  3Q87 A;  2UU9 C;  2M6N A;  4MXU A;  3L8C A;  4JI5 C;  5AE2 A;  1Z02 A;  4HGZ A;  1K8A 2;  3H0G I;  2YU9 I;  2D1T A;  3NH4 A;  4L4Q A;  2W04 A;  3VNS A;  1KC8 1;  1YIT Z;  2CY1 A;  3GTK I;  3UX3 A;  1MXB A;  4RMN A;  2LFU A;  5FLX f;  1NP6 A;  4EAT A;  4RM3 A;  4L2Z A;  3A9V A;  1YJW Z;  2R6M A;  3A25 A;  1UWD A;  2RT9 A;  4E2Z A;  2M5O A;  4LF6 C;  1QVG Z;  1ZB8 A;  2E8E A;  5CZX A;  4JV5 C;  1LQL A;  1Q16 A;  2E7Z A;  3BG0 B;  3CCV 1;  1VQO Z;  3CCR Z;  3HOZ I;  3DAY A;  3R44 A;  1T5H X;  4X62 C;  4LF4 C;  2K5R A;  2KZF A;  1VQO 1;  3CCE Z;  2P2Q A;  3CCL 1;  3GKU A;  2UUB C;  4NBG A;  5BST A;  1XMQ C;  1FDI A;  2JA7 I;  1TWG I;  4B3R C;  4BY1 I;  1K0R A;  1X3W A;  1VQ8 Z;  3HKZ A;  1VQP 1;  1WCJ A;  3TUF A;  3PO2 I;  4E2W A;  2D1Q A;  4WS9 A;  2VUM I;  3N54 B;  2Q4Z A;  2VPX A;  1WCM I;  4JI2 C;  2PK7 A;  1RO4 A;  3GTP I;  3I4M I;  2IZ3 A;  1HNW C;  3CCM Z;  1O90 A;  4MON A;  2BJO A;  3S1M I;  2V8I A;  4YHH C;  4BC7 A;  2OTL 1;  4NBH A;  1VQ6 1;  4HGY A;  4NBD A;  2OOX B;  2OTL Z;  2HJG A;  1FDO A;  2RHB A;  2AKL A;  4DUZ C;  3HOV I;  1S72 Z;  1QVG Y;  3LUS A;  4DG8 A;  2KZ0 A;  2O53 A;  2JIO A;  1Q7Y 1;  3UX2 A;  2QRC B;  4CL1 A;  1N2F A;  3HOY I;  1JJ2 Z;  3CD6 Z;  3FCC A;  2DE7 A;  2R7Z I;  3IML A;  2PN2 A;  2AYD A;  4A3I I;  2P2B A;  3CD6 1;  4LFC C;  4EWC A;  1VQ9 Z;  2J6A A;  1UKK A;  4A3D I;  5AE3 A;  2QVY X;  1X3Z A;  2XR1 A;  4K0K C;  5CM2 M;  3H3V J;  2MM9 A;  4MD9 A;  3M3Y I;  2KDN A;  1PG4 A;  3J7A 4;  1R9T I;  4TPS B;  2ZZN A;  1XNR C;  3S2H I;  1PG3 A;  3F3P C;  3J80 b;  5FLX b;  3HOX I;  3P5J B;  2YWB A;  4R0M A;  5AN9 F;  3NPD A;  5BSW A;  4NBC A;  3S1N I;  1NY8 A;  3A4I A;  1XHJ A;  5IT9 b;  1MDB A;  1YIJ Z;  2PMZ A;  2ZM6 C;  4LFB C;  2QEX 1;  3LAX A;  4DV2 C;  1W2B Z;  1RO2 A;  3PO3 I;  2E2H I;  2DHM A;  1J5E C;  1YI2 1;  4E2Y A;  1TFI A;  3CCU 1;  4A3F I;  1I6H I;  4DR3 C;  3CQZ I;  3TE5 B;  4DCV A;  4G1I A;  5T64 A;  1YJ9 Z;  4DQY B;  1HR0 C;  4LFA C;  2V7B A;  3CCS 1;  5BUS A;  4IZ6 A;  1L2F A;  3MZL B;  1O93 A;  4X65 C;  3T1H C;  3M4O I;  3EER A;  2DE5 A;  3TR3 A;  4KHP C;  3CCR 1;  4X64 C;  2E5L C;  3G6E 1;  1MKY A;  2P2M A;  2VPY A;  5BSM A;  3I56 Z;  2QKD A;  2JIR A;  3VNR A;  2PT7 G;  1P4E A;  4NBF A;  2ASB A;  3EED A;  3GKQ A;  4MD7 A;  3VNQ A;  3IEU A;  4A93 I;  3G7S A;  4RS4 A;  3OW2 Z;  2OPL A;  2DE6 A;  4I9F A;  4Y7N I;  4K0B A;  3T4N B;  2Q51 A;  1K9M 1;  1TWA I;  3PRO C;  2B63 I;  5C4J I;  3S16 I;  5H9U A;  5KYV A;  5A2Q D;  4GKK C;  1MD9 A;  1T5D X;  1JWH C;  2HU9 A;  2E2J I;  4MRI A;  1EGA A;  2D7V A;  5BUQ A;  2V3V A;  2WB1 A;  2QA4 1;  1FJG C;  3UOW A;  2F4M A;  3GTG I;  1K8A 1;  3CPW Y;  1XRA A;  2P2J A;  2YX1 A;  3TDE A;  3CCU Z;  1DL6 A;  4E31 A;  4S1T A;  4R1M A;  3S82 A;  2RPR A;  5T6B A;  1KQS Y;  1IBK C;  2CXC A;  3VMI A;  1VQP Z;  1VQ8 1;  3CC2 Z;  2JUB A;  4A3K I;  3IEV A;  3CW8 X;  3CQ3 A;  2OPL B;  4OYC A;  4DK1 A;  1XRB A;  4AYB A;  3D2L A;  1VEH A;  2DYJ A;  3HOU I;  1VQ7 Z;  3CMA 1;  3VMH A;  4KTV A;  3QWU A;  4E30 A;  1VQK Z;  4LF7 C;  3S1Q I;  2RBL A;  4DR1 C;  1KD1 2;  1L1O C;  2MMA B;  4RLQ A;  5T8S A;  4JI7 C;  3A9U A;  4E33 A;  5E7Q A;  1AMU A;  2ATW A;  1QF8 A;  1SIW A;  2QL8 A;  4RVN A;  3CCM 1;  4LF5 C;  1VQN Z;  4PUH A;  3I4N I;  2CU6 A;  3FQM A;  4OX9 C;  1ZH1 A;  3BG1 B;  3K6R A;  2O4H A;  1VQ5 1;  1O9T A;  1QVF Z;  5BR8 C;  2GU2 A;  4DV1 C;  3HOW I;  3G6E Z;  5T67 A;  2P28 A;  1VQ5 Z;  3GPC A;  3NYQ A;  1WW9 A;  4PHT A;  5DV9 A;  5BUR A;  4E32 A;  1V25 A;  2NCL A;  3CCS Z;  5IT9 D;  3NFZ A;  4DUY C;  3CXC Z;  2M48 A;  1VQL 1;  2NAP A;  2LEX A;  3GR0 A;  1N34 C;  4HPV A;  2I3C A;  3S15 I;  1VQ9 1;  1K83 I;  3KIF A;  3JAM b;  2OBV A;  3LNO A;  1KKG A;  5C3E I;  1FUG A;  4BY7 I;  1QM4 A;  5C44 I;  2OOY B;  4YY3 C;  3VMG A;  2JIP A;  5A2Q f;  3G71 1;  2WP0 C;  3CME Z;  1HH2 P;  3GTJ I;  2UXD C;  3GCF A;  1QYP A;  1YI2 Z;  3CME 1;  3ETC A;  3S17 I;  2E0G A;  1RY2 A;  2Y0S A;  4A3E I;  5IT9 f;  1O92 A;  2QRE B;  2E8C A;  2H85 A;  1BA3 A;  1N36 C;  1VLA A;  1YIJ 1;  2JA5 I;  2VPW A;  1SFO I;  1VQ4 Z;  2P3Y A;  1VQN 1;  3U50 C;  2RIQ A;  4DV0 C;  3RZD I;  1M90 2;  1XS3 A;  2UUA C;  2PM9 A;  5A19 A;  4B3M C;  1VQ7 1;  4BBY A;  4WV3 A;  4NXN C;  3CC7 1;  3CMA Z;  3NYR A;  4QTT A;  5ADZ A;  1YUK A;  4B3T C;  3RV2 A;  3CC7 Z;  1YHQ Z;  3NDJ A;  3G4S Z;  3CC2 1;  3JAM D;  1K73 1;  3CQ2 A;  3J80 D;  1HNX C;  4NB9 A;  2JNY A;  3G4S 1;  3CCJ 1;  2E7G A;  5IP9 I;  3I55 1;  1NYE A;  3I56 1;  4A3G I;  4ISB A;  4DV7 C;  3I07 A;  1ML8 A; 
#chains in the Genus database with same CATH homology
 4JI3 C;  4DG9 A;  1LCI A;  4DR4 C;  2QEX Z;  4JI4 C;  1N33 C;  1RNI A;  5A2Q b;  1N8R 2;  3CC4 1;  3OTO C;  3VB9 A;  3IF8 A;  2F4V C;  3CC4 Z;  2E9H A;  4AQY C;  3IX0 A;  1USP B;  2IZ4 A;  2KPI A;  3NDI A;  3J80 f;  1KD1 1;  4NXM C;  3OW2 Y;  1RG9 A;  3LGX A;  1YJW 1;  2E2I I;  1VQM 1;  1PFT A;  1K73 2;  4IR7 A;  5IP7 I;  3TDH B;  4E2X A;  1ZB9 A;  4JI6 C;  3PBK A;  4DR2 C;  1S7M A;  3CCQ Z;  2OTJ 1;  2QW0 X;  3RZO I;  3AF5 A;  2Y4O A;  4FUQ A;  4DR7 C;  2JMO A;  4NOZ A;  4A3B I;  4NH1 C;  2PRO A;  1YHQ 1;  4A3L I;  2OO4 A;  1RO0 A;  3L95 X;  3T1Y C;  1M1K 1;  3C5E A;  5IFI A;  4FUT A;  4DV6 C;  3I08 A;  2R92 I;  3LNV A;  4ZLP A;  3CCJ Z;  1XMO C;  1Y1V I;  4JI8 C;  4LF8 C;  4U5Y D;  4BC9 A;  1NUI A;  4NFR A;  2GTI A;  4DGL A;  1I94 C;  3RG2 A;  5FLX D;  1YIT 1;  1JOS A;  3JAM f;  1Q82 2;  2AYA A;  4DR6 C;  3EQ6 A;  4LF9 C;  4D57 A;  4NB8 A;  5BSV A;  1S72 1;  4GKJ C;  2UXC C;  4JYA C;  4LE5 A;  1VQL Z;  3DHV A;  2VF1 A;  4DV4 C;  3PO3 S;  2DPL A;  2YWC A;  1Q86 1;  3NI2 A;  2KI7 B;  3D9X A;  2F4O A;  1IBM C;  3ESW A;  1TWC I;  2VQF C;  4MD8 A;  4MH4 A;  1GPM A;  4DCU A;  2P02 A;  4RLF A;  5T8T A;  1N8R 1;  1QVF Y;  2NVT I;  1WH9 A;  4D4I A;  5KYT A;  1M90 1;  2Y4N A;  1NJI 2;  3GTQ I;  1Q82 1;  4OXI A;  1QWI A;  3S2D I;  4RM2 A;  2R93 I;  5BSU A;  5LL6 f;  5D1P A;  3F3F C;  3KIH A;  4NBA A;  4RV9 A;  5FLM I;  4XX2 A;  5AE1 A;  3MON A;  1MDF A;  5GTD A;  1ULT A;  2VQE C;  3CXC Y;  2V8J A;  4DR5 C;  4RVF A;  4A3J I;  4FTF A;  3B7W A;  1Z03 A;  3R9X A;  3TQI A;  1VQ6 Z;  2NVX I;  3E7W A;  4I9G A;  3NH5 A;  5D1O B;  2OZK A;  1Y1V S;  2VZE A;  5LMU C;  1TWF I;  2K3R A;  3IFU A;  3NH8 A;  3VTN A;  2QR1 B;  2ONF A;  4BBS I;  3ETO A;  3GTO I;  2GTH A;  5K8F A;  1KQS Z;  2D1R A;  2P2F A;  2WAQ A;  3FCE A;  4NDN A;  5K85 A;  1MXA A;  2UXB C;  3CW9 A;  1YJN 1;  2G2K A;  5C4X I;  4HH4 A;  3CCL Z;  3S1R I;  4NBE A;  1PA4 A;  1USP A;  2ZAE B;  1VQK 1;  4G36 A;  3FKI I;  4X6A I;  2E8F A;  1YJN Z;  3IPL A;  1RQF A;  4R1L A;  3R9W A;  3GR1 A;  4DV3 C;  4GS5 A;  3E7X A;  2QRD B;  3GTM I;  4JI1 C;  1YUA A;  2NVQ I;  3MZK B;  4Y52 I;  1XRC A;  1JJ2 Y;  3S14 I;  2D28 C;  2HF1 A;  4RVO A;  4QTU A;  4DCS A;  5A1I A;  3J81 D;  2P20 A;  4NBB A;  1Q81 1;  5D1O A;  4ZJZ A;  3PES A;  1M1K 2;  4JM1 A;  1KC8 2;  1RLY A;  2JA8 I;  3KXW A;  3CPW Z;  1Q86 2;  1TWH I;  3CCE 1;  2QA4 Z;  3J81 b;  4GXQ A;  1XNQ C;  1YJ9 1;  2VSQ A;  2HHH C;  4KTT A;  4B3S C;  4BXX I;  2YAD A;  1V26 A;  3CCV Z;  4G37 A;  1HNZ C;  3D6W A;  1P9N A;  1YJ7 A;  3I55 Z;  2JS4 A;  3H2T A;  4D4G A;  1N32 C;  4PRO C;  3CCQ 1;  2OTJ Z;  5A1G A;  1IBL C;  3GTM S;  3GTL I;  4BCA A;  4A3M I;  3G71 Z;  1W2B Y;  4BBR I;  1Q81 2;  2QVZ X;  4ODJ A;  4L7I A;  2UUC C;  1X0T A;  2W03 A;  1P7L A;  1Q7Y 2;  4BSZ A;  1Z01 A;  2EGT A;  2QVX X;  2QLV B;  4DCT A;  2JR6 A;  4RVH A;  4GXR A;  3SO4 A;  1VQ4 1;  2D27 A;  1WII A;  2Y27 A;  1WF3 A;  1VQM Z;  1NJI 1;  3CJE A;  3UZ0 A;  2WD9 A;  2LIY A;  4D56 A;  5BSR A;  5JRH A;  4TNU A;  2JMP A;  1Y1W I;  4RVG A;  4DV5 C;  1I3Q I;  2YCB A;  5IWA C;  2NVY I;  5CZV A;  3J81 f;  4PZP A;  1K9M 2;  1KRL A;  4MTN A;  1I50 I;  2D1S A;  4X66 C;  2VUG A;  3FQQ A;  2BH1 X;  5LMN C;  2V8K A;  2JA6 I;  5KEI A;  1MXC A;  4A3C I;  4JI0 C;  3DLP X;  3K7A I;  3N2Q A;  3AF6 A;  4RVD A;  3Q87 A;  2UU9 C;  2M6N A;  4MXU A;  3L8C A;  4JI5 C;  5AE2 A;  1Z02 A;  4HGZ A;  1K8A 2;  3H0G I;  2YU9 I;  2D1T A;  3NH4 A;  4L4Q A;  2W04 A;  3VNS A;  1KC8 1;  1YIT Z;  2CY1 A;  3GTK I;  1MXB A;  4RMN A;  2LFU A;  5FLX f;  1NP6 A;  4EAT A;  4RM3 A;  4L2Z A;  3A9V A;  1YJW Z;  2R6M A;  2RT9 A;  4E2Z A;  4LF6 C;  1QVG Z;  1ZB8 A;  2E8E A;  5CZX A;  4JV5 C;  1LQL A;  1VQO Z;  3CCV 1;  3BG0 B;  3HOZ I;  3DAY A;  3CCR Z;  3R44 A;  4X62 C;  4LF4 C;  1T5H X;  2K5R A;  2KZF A;  1VQO 1;  3CCE Z;  2P2Q A;  3CCL 1;  3GKU A;  2UUB C;  4NBG A;  5BST A;  1XMQ C;  2JA7 I;  1TWG I;  4B3R C;  4BY1 I;  1K0R A;  1X3W A;  1VQ8 Z;  3HKZ A;  1VQP 1;  3TUF A;  3PO2 I;  4E2W A;  2D1Q A;  4WS9 A;  2VUM I;  3N54 B;  2Q4Z A;  1WCM I;  4JI2 C;  2PK7 A;  1RO4 A;  3GTP I;  3I4M I;  2IZ3 A;  1HNW C;  3CCM Z;  1O90 A;  4MON A;  2BJO A;  3S1M I;  2V8I A;  4YHH C;  4BC7 A;  2OTL 1;  4NBH A;  1VQ6 1;  4HGY A;  4NBD A;  2OOX B;  2OTL Z;  2HJG A;  2RHB A;  2AKL A;  4DUZ C;  3HOV I;  1S72 Z;  1QVG Y;  3LUS A;  4DG8 A;  2O53 A;  1Q7Y 1;  2QRC B;  4CL1 A;  1N2F A;  3HOY I;  1JJ2 Z;  3CD6 Z;  3FCC A;  2DE7 A;  2R7Z I;  3IML A;  2PN2 A;  4A3I I;  2P2B A;  3CD6 1;  4LFC C;  4EWC A;  1VQ9 Z;  2J6A A;  1UKK A;  4A3D I;  5AE3 A;  2QVY X;  1X3Z A;  2XR1 A;  4K0K C;  5CM2 M;  3H3V J;  4MD9 A;  3M3Y I;  1PG4 A;  3J7A 4;  1R9T I;  4TPS B;  1XNR C;  3S2H I;  1PG3 A;  3F3P C;  3J80 b;  5FLX b;  3HOX I;  3P5J B;  2YWB A;  4R0M A;  5AN9 F;  3NPD A;  5BSW A;  4NBC A;  3S1N I;  3A4I A;  5IT9 b;  1MDB A;  1YIJ Z;  2PMZ A;  2ZM6 C;  4LFB C;  2QEX 1;  3LAX A;  4DV2 C;  1W2B Z;  1RO2 A;  3PO3 I;  2E2H I;  1J5E C;  1YI2 1;  4E2Y A;  1TFI A;  3CCU 1;  4A3F I;  1I6H I;  4DR3 C;  3CQZ I;  3TE5 B;  4DCV A;  4G1I A;  5T64 A;  1YJ9 Z;  4DQY B;  1HR0 C;  4LFA C;  2V7B A;  3CCS 1;  5BUS A;  4IZ6 A;  1L2F A;  3MZL B;  1O93 A;  4X65 C;  3T1H C;  3M4O I;  3EER A;  2DE5 A;  4KHP C;  3CCR 1;  4X64 C;  2E5L C;  3G6E 1;  1MKY A;  2P2M A;  5BSM A;  3I56 Z;  2QKD A;  3VNR A;  2PT7 G;  4NBF A;  2ASB A;  3EED A;  3GKQ A;  4MD7 A;  3VNQ A;  3IEU A;  4A93 I;  3G7S A;  4RS4 A;  3OW2 Z;  2OPL A;  2DE6 A;  4I9F A;  4Y7N I;  4K0B A;  3T4N B;  2Q51 A;  1K9M 1;  1TWA I;  3PRO C;  2B63 I;  5C4J I;  3S16 I;  5H9U A;  5KYV A;  5A2Q D;  4GKK C;  1MD9 A;  1T5D X;  1JWH C;  2HU9 A;  2E2J I;  4MRI A;  1EGA A;  2D7V A;  5BUQ A;  2WB1 A;  2QA4 1;  1FJG C;  3UOW A;  2F4M A;  3GTG I;  1K8A 1;  3CPW Y;  1XRA A;  2P2J A;  3TDE A;  3CCU Z;  1DL6 A;  4E31 A;  4S1T A;  4R1M A;  3S82 A;  2RPR A;  5T6B A;  1KQS Y;  1IBK C;  2CXC A;  3VMI A;  1VQP Z;  1VQ8 1;  3CC2 Z;  2JUB A;  4A3K I;  3IEV A;  3CW8 X;  4OYC A;  2OPL B;  4DK1 A;  1XRB A;  4AYB A;  2DYJ A;  3HOU I;  1VQ7 Z;  3CMA 1;  3VMH A;  4KTV A;  3QWU A;  4E30 A;  1VQK Z;  4LF7 C;  3S1Q I;  2RBL A;  4DR1 C;  1KD1 2;  1L1O C;  4RLQ A;  5T8S A;  4JI7 C;  3A9U A;  4E33 A;  5E7Q A;  1AMU A;  2ATW A;  1QF8 A;  2QL8 A;  4RVN A;  3CCM 1;  4LF5 C;  1VQN Z;  3I4N I;  3FQM A;  4OX9 C;  1ZH1 A;  3BG1 B;  2O4H A;  1VQ5 1;  1O9T A;  1QVF Z;  5BR8 C;  2GU2 A;  4DV1 C;  3HOW I;  3G6E Z;  5T67 A;  2P28 A;  1VQ5 Z;  3GPC A;  3NYQ A;  1WW9 A;  4PHT A;  5DV9 A;  5BUR A;  4E32 A;  1V25 A;  3CCS Z;  5IT9 D;  3NFZ A;  4DUY C;  3CXC Z;  2M48 A;  1VQL 1;  3GR0 A;  1N34 C;  4HPV A;  2I3C A;  3S15 I;  1VQ9 1;  1K83 I;  3KIF A;  3JAM b;  2OBV A;  1KKG A;  5C3E I;  1FUG A;  4BY7 I;  1QM4 A;  5C44 I;  2OOY B;  4YY3 C;  3VMG A;  5A2Q f;  3G71 1;  2WP0 C;  3CME Z;  1HH2 P;  3GTJ I;  2UXD C;  3GCF A;  1QYP A;  1YI2 Z;  3CME 1;  3ETC A;  3S17 I;  2E0G A;  1RY2 A;  2Y0S A;  4A3E I;  5IT9 f;  1O92 A;  2QRE B;  2E8C A;  2H85 A;  1BA3 A;  1N36 C;  1VLA A;  1YIJ 1;  2JA5 I;  1SFO I;  1VQ4 Z;  2P3Y A;  1VQN 1;  3U50 C;  2RIQ A;  4DV0 C;  3RZD I;  1M90 2;  2UUA C;  2PM9 A;  5A19 A;  4B3M C;  1VQ7 1;  4BBY A;  4WV3 A;  4NXN C;  3CC7 1;  3CMA Z;  3NYR A;  4QTT A;  5ADZ A;  1YUK A;  4B3T C;  3RV2 A;  3CC7 Z;  1YHQ Z;  3NDJ A;  3G4S Z;  3CC2 1;  3JAM D;  1K73 1;  3J80 D;  1HNX C;  4NB9 A;  2JNY A;  3G4S 1;  3CCJ 1;  2E7G A;  5IP9 I;  3I55 1;  1NYE A;  3I56 1;  4A3G I;  4ISB A;  4DV7 C;  3I07 A;  1ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...