4XX2A

Ohr from xylella fastidiosa in oxidized state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
142
structure length
141
Chain Sequence
b'MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSACFIGALKFVANKEVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Organic hydroperoxide resistance protein
publication title Ohr from Xylella fastidiosa in oxidized state
rcsb
source organism Xylella fastidiosa (strain 9a5c)
molecule tags Oxidoreductase
total genus 32
structure length 141
sequence length 142
chains with identical sequence B, C
ec nomenclature ec 1.-.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4xx2A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4xx2A02
1I94C 2JS4A 2VUMI 2JA5I 4A3II 3GKQA 4DR4C 4NB9A 4YHHC 5FLMI 4DR2C 4NBDA 2UUCC 1Y1WI 4MTNA 1QWIA 4B3SC 2E5LC 5C44I 5LMNC 2HHHC 1MKYA 1I3QI 2DE5A 4LF8C 2AKLA 1QYPA 3HOWI 2PT7G 4YY3C 4K0KC 1N2FA 4A3CI 1Y1VS 4DUYC 3PO2I 4JI0C 4JI3C 3AF5A 2R7ZI 3S2DI 1WF3A 1USPA 5IWAC 1X3WA 2J6AA 5FLXD 1HH2P 3HOXI 1WH9A 4DV2C 2B63I 2E2JI 4NBGA 3S1QI 4KHPC 4OX9C 1ML8A 3S1NI 1X3ZA 2JA8I 2QL8A 2PN2A 2NVXI 1TWCI 4NBEA 1IBLC 1PA4A 2UUBC 4JI8C 2F4OA 1N32C 1SFOI 3GCFA 4NXMC 1PFTA 4LF7C 3VB9A 4NB8A 3FKII 1XMOC 5IT9D 3PO3S 1XMQC 3H3VJ 3HOVI 3U50C 4A3MI 3IEVA 1ZB8A 4LF9C 3VMHA 4XX2A 1N36C 2E8FA 3S14I 3Q87A 2UXDC 3GTOI 2UUAC 3ESWA 3JAMD 1UKKA 4B3RC 2OPLA 5IP9I 4B3MC 2JA7I 3D6WA 1TFIA 3VMGA 4A3JI 1HNWC 4Y52I 3HOZI 1Y1VI 2JMPA 4LFBC 2ZM6C 2DE6A 2R92I 4DV4C 5C4XI 2D7VA 4QTTA 5BR8C 4JV5C 1IBKC 4JI6C 4LF6C 4JI2C 4DCSA 4A3DI 4NBBA 3S16I 1VLAA 2UU9C 4DCVA 2DE7A 5CM2M 3EERA 4DV3C 4Y7NI 3GTMI 3PO3I 1HNXC 1JOSA 3M4OI 2XR1A 1FJGC 4DV5C 4DR5C 1NYEA 1IBMC 3GTPI 3CQZI 3M3YI 1XNQC 1TWGI 2R93I 3VMIA 4DR7C 4AQYC 4DR6C 2HF1A 2ASBA 2HJGA 2CY1A 4DV7C 1I50I 2E2HI 1I6HI 3OTOC 4NBCA 3GTKI 1HR0C 2UXBC 4JYAC 3AF6A 3S17I 4BBRI 4X6AI 3I07A 2NVYI 5C4JI 2CXCA 1KKGA 4BSZA 4BY7I 4NBHA 2E7GA 3RZOI 2OPLB 3CJEA 3I4NI 4DR1C 4NXNC 2JR6A 2P3YA 4LF5C 2ATWA 4DV1C 2F4MA 2RBLA 3I4MI 4A3EI 4JI5C 3GTLI 4GKKC 3T1YC 2K5RA 4X64C 2ONFA 2E8EA 2YCBA 4BBSI 5A2QD 4NBFA 4DUZC 4A3BI 2NVTI 3HOUI 3S1MI 3J80D 1NUIA 1L2FA 1TWHI 1RLYA 3IEUA 4X66C 2JA6I 3H0GI 3HOYI 3S1RI 4X62C 4JI4C 1J5EC 1K83I 2VQFC 1R9TI 4X65C 1EGAA 1USPB 1HNZC 3GTQI 1TWFI 2E8CA 2PK7A 1RO4A 4LFCC 4DCUA 2KPIA 1L1OC 4A3GI 4LFAC 4DV0C 4A3LI 2YU9I 2DYJA 4A3FI 4DCTA 1LQLA 3LUSA 1DL6A 5IP7I 4BXXI 4NOZA 4BY1I 2E2II 2NVQI 3R9WA 2F4VC 4A93I 4JI1C 1TWAI 3RZDI 1N33C 4JI7C 3GKUA 1XNRC 3J81D 3GTGI 3T1HC 3S2HI 2BJOA 3GTMS 4B3TC 3GTJI 4QTUA 5LMUC 4DV6C 1YUAA 4GKJC 1WCMI 3K7AI 2EGTA 1K0RA 4NBAA 3S15I 1ZB9A 2VQEC 4DR3C 1WW9A 4MH4A 2UXCC 2KZFA 5C3EI 1N34C 4LF4C 3R9XA 2JNYA 4A3KI
chains in the Genus database with same CATH superfamily
3CXCY 3G711 1I94C 2P2MA 2JS4A 1VQ91 2VUMI 2JA5I 4A3II 2QEX1 3GKQA 5FLXf 1M1K1 4KTVA 5D1OA 1Y8CA 4DR4C 2VPYA 4NB9A 4PUHA 1VQK1 1RY2A 4YHHC 5FLMI 3CMAZ 3DLPX 2QLVB 1YI21 4DR2C 4NBDA 3I56Z 1Y1WI 2G2KA 4RLFA 2VUGA 4MTNA 1QWIA 2UUCC 4B3SC 1M6XC 3C5EA 2E5LC 3CD6Z 1P9NA 5C44I 1FLOA 5LMNC 4KTTA 5AE3A 1M6XA 2HHHC 3LNVA 2IZ4A 1MKYA 1I3QI 2DE5A 2IZ3A 1YHQ1 2ZAEB 1Q7Y1 4LF8C 4TPSB 2AKLA 1QYPA 4BCAA 4RVGA 3TDHB 2ZZMA 3G4SZ 2W03A 3CCVZ 3FCCA 3FCEA 3HOWI 3CCR1 2PT7G 3CCQ1 1VQ5Z 2D1TA 4E2WA 2P2QA 4YY3C 4K0KC 4MD8A 4FUTA 1N2FA 4A3CI 1Y1VS 3A26A 4DUYC 3PO2I 4JI0C 3ETOA 4JI3C 4S1TA 5IT9f 2P20A 3AF5A 2R7ZI 3S2DI 4ODJA 2WP0C 2R6MA 4MD7A 1LCIA 3CC7Z 1WF3A 4D4GA 5A1GA 1USPA 3CW9A 4AYBA 5IWAC 2QVXX 3I561 4RMNA 2V8KA 1YJ9Z 4JM1A 1X3WA 5H9UA 4NFRA 2JMOA 4OXIA 2J6AA 1WCJA 1VQOZ 1VQ41 1HH2P 2YWBA 5FLXD 3HOXI 1WH9A 2W04A 5LL6f 4I9FA 3UZ0A 4DV2C 3G6E1 2JIOA 2B63I 2E2JI 4NBGA 3LNOA 2D1QA 3VNQA 3S1QI 4KHPC 4DQYB 4D56A 4OX9C 1ML8A 1RO0A 5LCIA 3S1NI 1X3ZA 4RLQA 1N8R2 2JA8I 3E7WA 3GR1A 3IF8A 4HPVA 5KYVA 2QL8A 2Y4NA 2PN2A 2NVXI 1TWCI 4NBEA 1IBLC 4GXRA 4DK1A 1PA4A 3N2QA 2UUBC 2D1SA 4JI8C 4WS9A 2F4OA 3PROC 1N32C 1SFOI 2P28A 3GCFA 2YX1A 2OOXB 5T67A 1PFTA 4NXMC 4BC7A 2DPLA 4LF7C 3CC71 1VQNZ 3VB9A 3JAMb 1Q862 1K732 3RV2A 5JRHA 4NB8A 2V45A 3FKII 3IFUA 3TR3A 1VQO1 2OTJZ 1VQLZ 3IPLA 1XMOC 3G71Z 1PU1A 3E7XA 1VQ9Z 3NYRA 5IT9D 3PO3S 3MZLB 2QEXZ 1Q861 1K731 2PROA 1XMQC 3AY0A 3H3VJ 3NH4A 3HOVI 1SIWA 3FQMA 3U50C 1RQFA 1VQKZ 4A3MI 4IZ6A 1ZB8A 2OBVA 4L4QA 3IEVA 4LF9C 1YI2Z 3VMHA 4I9GA 4XX2A 3CCE1 1T5DX 1N36C 2E8FA 3H2TA 3TDEA 5A19A 3S14I 4E32A 3CME1 3Q87A 2UXDC 3GTOI 4GXQA 2GU2A 3ESWA 2UUAC 3JAMD 1UKKA 1WIIA 1VQN1 4B3RC 5ADZA 4K0BA 2OPLA 5IP9I 1O92A 2P2BA 3NH5A 4CL1A 2O4HA 4E2ZA 4B3MC 3CCUZ 2D28C 3I551 4G37A 3I08A 3CCRZ 1WZNA 2OTJ1 2JA7I 3D6WA 1TFIA 3CQ1A 3VMGA 4A3JI 2OTL1 1X0TA 4Y52I 1HNWC 3HOZI 1Y1VI 2P02A 1Z01A 2JMPA 4PZPA 4DGLA 3F3FC 4LFBC 2WAQA 3A9UA 2ZM6C 3CXCZ 2MM9A 2M5HA 5IFIA 3VNSA 2DE6A 1QF8A 2R92I 4WV3A 3TUFA 2MMAB 4MRIA 4DV4C 2QW0X 5C4XI 2D7VA 5T6BA 1XRCA 2Q51A 4E2XA 1VQ4Z 1MXBA 1P7LA 4QTTA 5BR8C 4JV5C 4RM2A 5FLXb 3G6EZ 1IBKC 1MXCA 3NDJA 1W2BY 3VNRA 4JI6C 1QVFY 1JWHC 4NDNA 3CCU1 4LF6C 1FUGA 3UEBA 1V26A 4DCSA 4JI2C 4A3DI 2I3CA 4PUIA 4NBBA 5BSMA 4RS4A 3S16I 3KIHA 3CCL1 4G36A 1W2BZ 4FUQA 1M902 3GR0A 1QVFZ 1QXFA 1MDFA 4E31A 2Y0SA 1VLAA 4E33A 2UU9C 4DCVA 5T8TA 4RVHA 3SO4A 2DE7A 5CM2M 3EERA 1M901 3CQ3A 1S721 2M48A 1Z03A 2QRCB 3QWUA 2JIQA 1KQSY 3KIFA 4DV3C 4RVFA 4PROC 4DG8A 4LE5A 3G7SA 2M5OA 4Y7NI 2JUBA 2ZZNA 3GTMI 1KRLA 1YIT1 3PO3I 1Z02A 5BSRA 5IT9b 1HNXC 1JOSA 4D4IA 2V8JA 3M4OI 1O90A 2XR1A 1KQSZ 1FJGC 4DV5C 1VEHA 4DR5C 3O2EA 2KZ0A 3CC21 3CPWY 2JIPA 1NYEA 1V25A 5E7QA 4MONA 3CCEZ 2QA4Z 1T5HX 5K85A 4L7IA 4DG9A 1N8R1 3CMEZ 2AYDA 5CZXA 3GPCA 1PG4A 4R0MA 2QRDB 1YIJ1 2KI7B 2NAPA 4U5YD 1IBMC 3GTPI 4PHTA 3CQZI 4IR7A 2YWCA 3M3YI 3PESA 2E0GA 1TWGI 3OW2Y 3I55Z 1XNQC 2R93I 3VMIA 2OOYB 2RT9A 1KD12 3PBKA 4DR7C 2E7ZA 3FQQA 2BH1X 2RPRA 2D27A 2P2FA 3ETCA 4AQYC 5CZVA 2JIRA 3EQ6A 4DR6C 2HF1A 2OTLZ 2HJGA 2ASBA 4NH1C 2CY1A 3S82A 3T4NB 4DV7C 2QVYX 5BSUA 1I50I 3KXWA 1KD11 1AA6A 2DHMA 2RHBA 2E2HI 2QA41 4BBYA 4RVNA 3CQ2A 3B7WA 3CCMZ 1I6HI 3OTOC 5A2Qf 5D1PA 2Y4OA 2JIMA 4NBCA 1PG3A 2HU9A 3GTKI 2LEXA 3K6RA 1O9TA 3NDIA 1HR0C 2UXBC 3J80f 4R1MA 4JYAC 3AF6A 3S17I 4BBRI 1NP6A 1YJWZ 1QVGY 3I07A 4X6AI 2AYAA 2NVYI 3NFZA 5C4JI 2CXCA 1KKGA 1KC82 4BSZA 4BY7I 4NBHA 1VQM1 5BSTA 2E7GA 3CCLZ 3RZOI 3R44A 1YJ7A 5A2Qb 2OPLB 2VZEA 3CJEA 3EEDA 1XS3A 3UX2A 5T8SA 4G1IA 2V3VA 3CCJZ 3I4NI 4DR1C 2CU6A 4NXNC 2JR6A 4GS5A 1M1K2 1S72Z 3L8CA 3CCM1 4RM3A 4HGYA 4TNUA 5D1OB 3VTNA 2P3YA 4LF5C 2ATWA 1XRAA 4DV1C 1MD9A 2F4MA 2RBLA 1WJ2A 1VQ71 3P5JB 1YITZ 3I4MI 4A3EI 2Y27A 3TQIA 2QVZX 3CCS1 4JI5C 2VF1A 4ZJZA 3GTLI 4GKKC 5AE2A 3T1YC 2K5RA 1YJW1 2OO4A 4X64C 1RG9A 2ONFA 3UOWA 5K8FA 3CC2Z 2E8EA 3CC41 2YCBA 4BBSI 1XHJA 4E30A 5A2QD 2LIYA 1Q7Y2 4NBFA 2Z51A 1MDBA 4DUZC 4A3BI 2NVTI 3HOUI 3S1MI 3J80D 1NUIA 1L2FA 1TWHI 3CCJ1 1YIJZ 1UWDA 4MXUA 1RLYA 1RO2A 3IEUA 1S7MA 2VSQA 4X66C 3NI2A 4OYCA 1VQ61 2WB1A 2JA6I 2D1RA 3H0GI 3BG1B 3J81f 3HOYI 3D9XA 2RIQA 3MZKB 3S1RI 1VQ8Z 4X62C 4JI4C 3DAYA 2P2JA 1J5EC 2KDNA 1K83I 1Q16A 2VQFC 2QR1B 2M6NA 1R9TI 4X65C 1EGAA 1USPB 1TH5A 4ZLPA 1BA3A 1HNZC 3GTQI 3LGXA 1TWFI 2E8CA 3A25A 5AE1A 3IX0A 2VPZA 2PK7A 3CMA1 3DHVA 2K3RA 1K9M2 1RO4A 1V60A 3A4IA 1IB8A 2GTIA 3J7A4 5A1IA 3J81b 1NJI2 4PUGA 1ULTA 4LFCC 1VQPZ 4DCUA 2KPIA 3CD61 1L1OC 3BG0B 1XRBA 3NH8A 1K9M1 2QREB 4FTFA 1Q822 3A9VA 4A3GI 3NYQA 3CPWZ 1K8A2 4LFAC 4DV0C 1YJNZ 4A3LI 1NY8A 1NJI1 2YU9I 2DYJA 5T64A 4A3FI 2NCLA 4HH4A 3N54B 4L2ZA 1LQLA 3JAMf 2H85A 3LUSA 5DV9A 4DCTA 5BURA 2E9HA 1DL6A 2IV2X 3G4S1 5IP7I 3CCV1 1Q821 1VQ81 4EWCA 4BXXI 4NOZA 1K8A1 5BSVA 3IMLA 2V7BA 5BSWA 4BY1I 1VQMZ 1VQ51 2E2II 2NVQI 4R1LA 2PMZA 4D57A 2OZKA 3R9WA 1JJ2Y 4A93I 2F4VC 2LFUA 4JI1C 3CW8X 4HGZA 1TWAI 5AN9F 3RZDI 2JNVA 1N33C 4JI7C 2MCQA 3OW2Z 3GKUA 4ISBA 2O53A 1XNRC 3J81D 3MONA 1QM4A 3GTGI 5BUQA 1JJ2Z 2YADA 1ZH1A 1YJ91 3T1HC 1FDIA 3S2HI 1VQP1 2Q4ZA 3L95X 2BJOA 3F3PC 1VQ7Z 1GPMA 3GTMS 3D2LA 1YJN1 4B3TC 3LAXA 3GTJI 2GTHA 2PM9A 3CCSZ 4QTUA 4BC9A 1AMUA 5LMUC 4DV6C 1Q812 1YUAA 2VPWA 4GKJC 1WCMI 2EGTA 3K7AI 1RNIA 2QKDA 3CC4Z 3NPDA 1K0RA 4NBAA 1O93A 2WD9A 5GTDA 2VPXA 4MD9A 4RVOA 3S15I 1ZB9A 2VQEC 4EATA 5KEIA 4DR3C 5BUSA 1MXAA 1Q811 1WW9A 5KYTA 4MH4A 2V8IA 1QVGZ 1YUKA 3RG2A 1KC81 4E2YA 1YHQZ 2UXCC 3TE5B 4RV9A 3J80b 4RVDA 2KZFA 5C3EI 1N34C 4LF4C 1FDOA 1VQ6Z 1P4EC 3R9XA 2JNYA 3IR7A 1P4EA 3CCQZ 3HKZA 3UX3A 4A3KI 1VQL1
chains in the Genus database with same CATH topology
3CXCY 3G711 1I94C 2P2MA 2JS4A 1VQ91 2VUMI 2JA5I 4A3II 2QEX1 3GKQA 5FLXf 1M1K1 4KTVA 5D1OA 4DR4C 4NB9A 1VQK1 1RY2A 4YHHC 5FLMI 3CMAZ 3DLPX 2QLVB 1YI21 4DR2C 4NBDA 3I56Z 1Y1WI 2G2KA 4RLFA 2VUGA 4MTNA 1QWIA 2UUCC 4B3SC 3C5EA 2E5LC 3CD6Z 1P9NA 5C44I 5LMNC 4KTTA 5AE3A 2HHHC 3LNVA 2IZ4A 1MKYA 1I3QI 2DE5A 2IZ3A 1YHQ1 2ZAEB 1Q7Y1 4LF8C 4TPSB 2AKLA 1QYPA 4BCAA 4RVGA 3TDHB 3G4SZ 2W03A 3CCVZ 3FCCA 3FCEA 3HOWI 3CCR1 2PT7G 3CCQ1 1VQ5Z 2D1TA 4E2WA 2P2QA 4YY3C 4K0KC 4MD8A 4FUTA 1N2FA 4A3CI 1Y1VS 4DUYC 3PO2I 4JI0C 3ETOA 4JI3C 4S1TA 5IT9f 2P20A 3AF5A 2R7ZI 3S2DI 4ODJA 2WP0C 2R6MA 4MD7A 1LCIA 3CC7Z 1WF3A 4D4GA 5A1GA 1USPA 3CW9A 4AYBA 5IWAC 2QVXX 3I561 4RMNA 2V8KA 1YJ9Z 4JM1A 1X3WA 5H9UA 4NFRA 2JMOA 4OXIA 2J6AA 5FLXD 1VQOZ 1VQ41 1HH2P 2YWBA 3HOXI 1WH9A 2W04A 5LL6f 4I9FA 3UZ0A 4DV2C 3G6E1 2B63I 2E2JI 4NBGA 2D1QA 3VNQA 3S1QI 4KHPC 4DQYB 4D56A 4OX9C 1ML8A 1RO0A 3S1NI 1X3ZA 4RLQA 1N8R2 2JA8I 3E7WA 3GR1A 3IF8A 4HPVA 5KYVA 2QL8A 2Y4NA 2PN2A 2NVXI 1TWCI 4NBEA 1IBLC 4GXRA 4DK1A 1PA4A 3N2QA 2UUBC 2D1SA 4JI8C 4WS9A 2F4OA 3PROC 1N32C 1SFOI 2P28A 3GCFA 2OOXB 5T67A 1PFTA 4NXMC 4BC7A 2DPLA 4LF7C 3CC71 1VQNZ 3VB9A 3JAMb 1Q862 1K732 3RV2A 5JRHA 4NB8A 3FKII 3IFUA 1VQO1 2OTJZ 1VQLZ 3IPLA 1XMOC 3G71Z 3E7XA 3NYRA 1VQ9Z 5IT9D 3PO3S 3MZLB 2QEXZ 1Q861 1K731 2PROA 1XMQC 3H3VJ 3NH4A 3HOVI 3FQMA 3U50C 1RQFA 1VQKZ 4A3MI 4IZ6A 1ZB8A 2OBVA 4L4QA 3IEVA 4LF9C 1YI2Z 3VMHA 4I9GA 4XX2A 3CCE1 1T5DX 1N36C 2E8FA 3H2TA 3TDEA 5A19A 3S14I 4E32A 3CME1 3Q87A 2UXDC 3GTOI 4GXQA 2GU2A 3ESWA 2UUAC 3JAMD 1UKKA 1WIIA 1VQN1 4B3RC 5ADZA 4K0BA 2OPLA 5IP9I 1O92A 2P2BA 3NH5A 4CL1A 2O4HA 4E2ZA 4B3MC 3CCUZ 2D28C 3I551 4G37A 3I08A 3CCRZ 2OTJ1 2JA7I 3D6WA 1TFIA 3VMGA 4A3JI 2OTL1 1X0TA 4Y52I 1HNWC 3HOZI 1Y1VI 2P02A 1Z01A 2JMPA 4PZPA 4DGLA 3F3FC 4LFBC 2WAQA 3A9UA 2ZM6C 3CXCZ 5IFIA 3VNSA 2DE6A 1QF8A 2R92I 4WV3A 3TUFA 4DV4C 4MRIA 2QW0X 5C4XI 2D7VA 5T6BA 1XRCA 2Q51A 4E2XA 1VQ4Z 1MXBA 1P7LA 4QTTA 5BR8C 4JV5C 4RM2A 5FLXb 3G6EZ 1IBKC 1MXCA 3NDJA 1W2BY 3VNRA 4JI6C 1QVFY 1JWHC 4NDNA 3CCU1 4LF6C 1FUGA 4JI2C 1V26A 4DCSA 4A3DI 2I3CA 4NBBA 5BSMA 4RS4A 3S16I 3KIHA 3CCL1 4G36A 1W2BZ 4FUQA 1M902 3GR0A 1QVFZ 1MDFA 4E31A 2Y0SA 1VLAA 4E33A 2UU9C 4DCVA 5T8TA 4RVHA 3SO4A 2DE7A 5CM2M 3EERA 1M901 1S721 2M48A 1Z03A 2QRCB 3QWUA 4DV3C 1KQSY 3KIFA 4RVFA 4PROC 4DG8A 4LE5A 3G7SA 4Y7NI 2JUBA 3GTMI 1KRLA 1YIT1 3PO3I 1Z02A 5BSRA 5IT9b 1HNXC 1JOSA 4D4IA 2V8JA 3M4OI 1O90A 2XR1A 1KQSZ 1FJGC 4DV5C 4DR5C 3CC21 3CPWY 1NYEA 1V25A 5E7QA 4MONA 3CCEZ 2QA4Z 1T5HX 5K85A 4L7IA 4DG9A 1N8R1 3CMEZ 5CZXA 3GPCA 1PG4A 4R0MA 2QRDB 1YIJ1 2KI7B 4U5YD 1IBMC 3GTPI 4PHTA 3CQZI 4IR7A 2YWCA 3M3YI 3PESA 2E0GA 1TWGI 3OW2Y 3I55Z 1XNQC 2R93I 3VMIA 2OOYB 2RT9A 1KD12 3PBKA 4DR7C 3FQQA 2BH1X 2RPRA 2D27A 2P2FA 3ETCA 4AQYC 5CZVA 3EQ6A 4DR6C 2HF1A 2OTLZ 2HJGA 2ASBA 4NH1C 2CY1A 3S82A 3T4NB 4DV7C 2QVYX 5BSUA 1I50I 3KXWA 1KD11 2RHBA 2E2HI 2QA41 4BBYA 4RVNA 3B7WA 3CCMZ 1I6HI 3OTOC 5A2Qf 5D1PA 2Y4OA 1PG3A 4NBCA 2HU9A 3GTKI 1O9TA 3NDIA 1HR0C 2UXBC 3J80f 4R1MA 4JYAC 3AF6A 3S17I 4BBRI 1NP6A 1YJWZ 1QVGY 3I07A 4X6AI 2AYAA 2NVYI 3NFZA 5C4JI 2CXCA 1KKGA 1KC82 4BSZA 4BY7I 4NBHA 1VQM1 5BSTA 2E7GA 3CCLZ 3RZOI 3R44A 1YJ7A 5A2Qb 2OPLB 2VZEA 3CJEA 3EEDA 5T8SA 4G1IA 3CCJZ 3I4NI 4DR1C 4NXNC 2JR6A 4GS5A 1M1K2 1S72Z 3L8CA 3CCM1 4RM3A 4HGYA 4TNUA 5D1OB 3VTNA 2P3YA 4LF5C 2ATWA 1XRAA 4DV1C 1MD9A 2F4MA 2RBLA 1VQ71 3P5JB 1YITZ 3I4MI 4A3EI 2Y27A 3TQIA 2QVZX 3CCS1 4JI5C 2VF1A 4ZJZA 3GTLI 4GKKC 5AE2A 3T1YC 2K5RA 1YJW1 2OO4A 4X64C 1RG9A 2ONFA 3UOWA 5K8FA 3CC2Z 2E8EA 3CC41 2YCBA 4BBSI 4E30A 5A2QD 2LIYA 1Q7Y2 4NBFA 1MDBA 4DUZC 4A3BI 2NVTI 3HOUI 3S1MI 3J80D 1NUIA 1L2FA 1TWHI 3CCJ1 1YIJZ 4MXUA 1RLYA 1RO2A 3IEUA 1S7MA 2VSQA 4X66C 3NI2A 4OYCA 1VQ61 2WB1A 2JA6I 2D1RA 3H0GI 3BG1B 3J81f 3HOYI 3D9XA 2RIQA 3MZKB 3S1RI 1VQ8Z 4X62C 4JI4C 3DAYA 2P2JA 1J5EC 1K83I 2VQFC 2QR1B 2M6NA 1R9TI 4X65C 1EGAA 1USPB 4ZLPA 1BA3A 1HNZC 3GTQI 3LGXA 1TWFI 2E8CA 5AE1A 3IX0A 3CMA1 2PK7A 3DHVA 2K3RA 1K9M2 1RO4A 3A4IA 2GTIA 3J7A4 5A1IA 3J81b 1NJI2 1ULTA 4LFCC 1VQPZ 4DCUA 2KPIA 3CD61 1L1OC 3BG0B 1XRBA 3NH8A 1K9M1 2QREB 4FTFA 1Q822 3A9VA 4A3GI 3NYQA 3CPWZ 1K8A2 4LFAC 4DV0C 1YJNZ 4A3LI 1NJI1 2YU9I 2DYJA 5T64A 4A3FI 4HH4A 3N54B 4L2ZA 1LQLA 3JAMf 2H85A 3LUSA 5DV9A 4DCTA 5BURA 2E9HA 1DL6A 3G4S1 5IP7I 3CCV1 1Q821 1VQ81 4EWCA 4BXXI 4NOZA 1K8A1 5BSVA 3IMLA 2V7BA 5BSWA 4BY1I 1VQMZ 1VQ51 2E2II 2NVQI 4R1LA 2PMZA 4D57A 2OZKA 3R9WA 1JJ2Y 4A93I 2F4VC 2LFUA 4JI1C 3CW8X 4HGZA 1TWAI 5AN9F 3RZDI 1N33C 4JI7C 3OW2Z 3GKUA 4ISBA 2O53A 1XNRC 3J81D 3MONA 1QM4A 3GTGI 5BUQA 1JJ2Z 2YADA 1ZH1A 1YJ91 3T1HC 3S2HI 1VQP1 2Q4ZA 3L95X 2BJOA 3F3PC 1VQ7Z 1GPMA 3GTMS 1YJN1 4B3TC 3LAXA 3GTJI 2GTHA 2PM9A 3CCSZ 4QTUA 4BC9A 1AMUA 5LMUC 4DV6C 1Q812 1YUAA 4GKJC 1WCMI 2EGTA 3K7AI 1RNIA 2QKDA 3CC4Z 3NPDA 1K0RA 4NBAA 1O93A 2WD9A 5GTDA 4MD9A 4RVOA 3S15I 1ZB9A 2VQEC 4EATA 5KEIA 4DR3C 5BUSA 1MXAA 1Q811 1WW9A 5KYTA 4MH4A 2V8IA 1QVGZ 1YUKA 3RG2A 1KC81 4E2YA 1YHQZ 2UXCC 3TE5B 4RV9A 3J80b 4RVDA 2KZFA 5C3EI 1N34C 4LF4C 1VQ6Z 3R9XA 2JNYA 3CCQZ 3HKZA 4A3KI 1VQL1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 C;  2JS4 A;  2VUM I;  2JA5 I;  4A3I I;  3GKQ A;  4DR4 C;  4NB9 A;  4YHH C;  5FLM I;  4DR2 C;  4NBD A;  2UUC C;  1Y1W I;  4MTN A;  1QWI A;  4B3S C;  2E5L C;  5C44 I;  5LMN C;  2HHH C;  1MKY A;  1I3Q I;  2DE5 A;  4LF8 C;  2AKL A;  1QYP A;  3HOW I;  2PT7 G;  4YY3 C;  4K0K C;  1N2F A;  4A3C I;  1Y1V S;  4DUY C;  3PO2 I;  4JI0 C;  4JI3 C;  3AF5 A;  2R7Z I;  3S2D I;  1WF3 A;  1USP A;  5IWA C;  1X3W A;  2J6A A;  5FLX D;  1HH2 P;  3HOX I;  1WH9 A;  4DV2 C;  2B63 I;  2E2J I;  4NBG A;  3S1Q I;  4KHP C;  4OX9 C;  1ML8 A;  3S1N I;  1X3Z A;  2JA8 I;  2QL8 A;  2PN2 A;  2NVX I;  1TWC I;  4NBE A;  1IBL C;  1PA4 A;  2UUB C;  4JI8 C;  2F4O A;  1N32 C;  1SFO I;  3GCF A;  4NXM C;  1PFT A;  4LF7 C;  3VB9 A;  4NB8 A;  3FKI I;  1XMO C;  5IT9 D;  3PO3 S;  1XMQ C;  3H3V J;  3HOV I;  3U50 C;  4A3M I;  3IEV A;  1ZB8 A;  4LF9 C;  3VMH A;  4XX2 A;  1N36 C;  2E8F A;  3S14 I;  3Q87 A;  2UXD C;  3GTO I;  2UUA C;  3ESW A;  3JAM D;  1UKK A;  4B3R C;  2OPL A;  5IP9 I;  4B3M C;  2JA7 I;  3D6W A;  1TFI A;  3VMG A;  4A3J I;  1HNW C;  4Y52 I;  3HOZ I;  1Y1V I;  2JMP A;  4LFB C;  2ZM6 C;  2DE6 A;  2R92 I;  4DV4 C;  5C4X I;  2D7V A;  4QTT A;  5BR8 C;  4JV5 C;  1IBK C;  4JI6 C;  4LF6 C;  4JI2 C;  4DCS A;  4A3D I;  4NBB A;  3S16 I;  1VLA A;  2UU9 C;  4DCV A;  2DE7 A;  5CM2 M;  3EER A;  4DV3 C;  4Y7N I;  3GTM I;  3PO3 I;  1HNX C;  1JOS A;  3M4O I;  2XR1 A;  1FJG C;  4DV5 C;  4DR5 C;  1NYE A;  1IBM C;  3GTP I;  3CQZ I;  3M3Y I;  1XNQ C;  1TWG I;  2R93 I;  3VMI A;  4DR7 C;  4AQY C;  4DR6 C;  2HF1 A;  2ASB A;  2HJG A;  2CY1 A;  4DV7 C;  1I50 I;  2E2H I;  1I6H I;  3OTO C;  4NBC A;  3GTK I;  1HR0 C;  2UXB C;  4JYA C;  3AF6 A;  3S17 I;  4BBR I;  4X6A I;  3I07 A;  2NVY I;  5C4J I;  2CXC A;  1KKG A;  4BSZ A;  4BY7 I;  4NBH A;  2E7G A;  3RZO I;  2OPL B;  3CJE A;  3I4N I;  4DR1 C;  4NXN C;  2JR6 A;  2P3Y A;  4LF5 C;  2ATW A;  4DV1 C;  2F4M A;  2RBL A;  3I4M I;  4A3E I;  4JI5 C;  3GTL I;  4GKK C;  3T1Y C;  2K5R A;  4X64 C;  2ONF A;  2E8E A;  2YCB A;  4BBS I;  5A2Q D;  4NBF A;  4DUZ C;  4A3B I;  2NVT I;  3HOU I;  3S1M I;  3J80 D;  1NUI A;  1L2F A;  1TWH I;  1RLY A;  3IEU A;  4X66 C;  2JA6 I;  3H0G I;  3HOY I;  3S1R I;  4X62 C;  4JI4 C;  1J5E C;  1K83 I;  2VQF C;  1R9T I;  4X65 C;  1EGA A;  1USP B;  1HNZ C;  3GTQ I;  1TWF I;  2E8C A;  2PK7 A;  1RO4 A;  4LFC C;  4DCU A;  2KPI A;  1L1O C;  4A3G I;  4LFA C;  4DV0 C;  4A3L I;  2YU9 I;  2DYJ A;  4A3F I;  4DCT A;  1LQL A;  3LUS A;  1DL6 A;  5IP7 I;  4BXX I;  4NOZ A;  4BY1 I;  2E2I I;  2NVQ I;  3R9W A;  2F4V C;  4A93 I;  4JI1 C;  1TWA I;  3RZD I;  1N33 C;  4JI7 C;  3GKU A;  1XNR C;  3J81 D;  3GTG I;  3T1H C;  3S2H I;  2BJO A;  3GTM S;  4B3T C;  3GTJ I;  4QTU A;  5LMU C;  4DV6 C;  1YUA A;  4GKJ C;  1WCM I;  3K7A I;  2EGT A;  1K0R A;  4NBA A;  3S15 I;  1ZB9 A;  2VQE C;  4DR3 C;  1WW9 A;  4MH4 A;  2UXC C;  2KZF A;  5C3E I;  1N34 C;  4LF4 C;  3R9X A;  2JNY A;  4A3K I; 
#chains in the Genus database with same CATH topology
 3CXC Y;  3G71 1;  1I94 C;  2P2M A;  2JS4 A;  1VQ9 1;  2VUM I;  2JA5 I;  4A3I I;  2QEX 1;  3GKQ A;  5FLX f;  1M1K 1;  4KTV A;  5D1O A;  1Y8C A;  4DR4 C;  2VPY A;  4NB9 A;  4PUH A;  1VQK 1;  1RY2 A;  4YHH C;  5FLM I;  3CMA Z;  3DLP X;  2QLV B;  1YI2 1;  4DR2 C;  4NBD A;  3I56 Z;  1Y1W I;  2G2K A;  4RLF A;  2VUG A;  4MTN A;  1QWI A;  2UUC C;  4B3S C;  1M6X C;  3C5E A;  2E5L C;  3CD6 Z;  1P9N A;  5C44 I;  1FLO A;  5LMN C;  4KTT A;  5AE3 A;  1M6X A;  2HHH C;  3LNV A;  2IZ4 A;  1MKY A;  1I3Q I;  2DE5 A;  2IZ3 A;  1YHQ 1;  2ZAE B;  1Q7Y 1;  4LF8 C;  4TPS B;  2AKL A;  1QYP A;  4BCA A;  4RVG A;  3TDH B;  2ZZM A;  3G4S Z;  2W03 A;  3CCV Z;  3FCC A;  3FCE A;  3HOW I;  3CCR 1;  2PT7 G;  3CCQ 1;  1VQ5 Z;  2D1T A;  4E2W A;  2P2Q A;  4YY3 C;  4K0K C;  4MD8 A;  4FUT A;  1N2F A;  4A3C I;  1Y1V S;  3A26 A;  4DUY C;  3PO2 I;  4JI0 C;  3ETO A;  4JI3 C;  4S1T A;  5IT9 f;  2P20 A;  3AF5 A;  2R7Z I;  3S2D I;  4ODJ A;  2WP0 C;  2R6M A;  4MD7 A;  1LCI A;  3CC7 Z;  1WF3 A;  4D4G A;  5A1G A;  1USP A;  3CW9 A;  4AYB A;  5IWA C;  2QVX X;  3I56 1;  4RMN A;  2V8K A;  1YJ9 Z;  4JM1 A;  1X3W A;  5H9U A;  4NFR A;  2JMO A;  4OXI A;  2J6A A;  1WCJ A;  1VQO Z;  1VQ4 1;  1HH2 P;  2YWB A;  5FLX D;  3HOX I;  1WH9 A;  2W04 A;  5LL6 f;  4I9F A;  3UZ0 A;  4DV2 C;  3G6E 1;  2JIO A;  2B63 I;  2E2J I;  4NBG A;  3LNO A;  2D1Q A;  3VNQ A;  3S1Q I;  4KHP C;  4DQY B;  4D56 A;  4OX9 C;  1ML8 A;  1RO0 A;  5LCI A;  3S1N I;  1X3Z A;  4RLQ A;  1N8R 2;  2JA8 I;  3E7W A;  3GR1 A;  3IF8 A;  4HPV A;  5KYV A;  2QL8 A;  2Y4N A;  2PN2 A;  2NVX I;  1TWC I;  4NBE A;  1IBL C;  4GXR A;  4DK1 A;  1PA4 A;  3N2Q A;  2UUB C;  2D1S A;  4JI8 C;  4WS9 A;  2F4O A;  3PRO C;  1N32 C;  1SFO I;  2P28 A;  3GCF A;  2YX1 A;  2OOX B;  5T67 A;  1PFT A;  4NXM C;  4BC7 A;  2DPL A;  4LF7 C;  3CC7 1;  1VQN Z;  3VB9 A;  3JAM b;  1Q86 2;  1K73 2;  3RV2 A;  5JRH A;  4NB8 A;  2V45 A;  3FKI I;  3IFU A;  3TR3 A;  1VQO 1;  2OTJ Z;  1VQL Z;  3IPL A;  1XMO C;  3G71 Z;  1PU1 A;  3E7X A;  1VQ9 Z;  3NYR A;  5IT9 D;  3PO3 S;  3MZL B;  2QEX Z;  1Q86 1;  1K73 1;  2PRO A;  1XMQ C;  3AY0 A;  3H3V J;  3NH4 A;  3HOV I;  1SIW A;  3FQM A;  3U50 C;  1RQF A;  1VQK Z;  4A3M I;  4IZ6 A;  1ZB8 A;  2OBV A;  4L4Q A;  3IEV A;  4LF9 C;  1YI2 Z;  3VMH A;  4I9G A;  4XX2 A;  3CCE 1;  1T5D X;  1N36 C;  2E8F A;  3H2T A;  3TDE A;  5A19 A;  3S14 I;  4E32 A;  3CME 1;  3Q87 A;  2UXD C;  3GTO I;  4GXQ A;  2GU2 A;  3ESW A;  2UUA C;  3JAM D;  1UKK A;  1WII A;  1VQN 1;  4B3R C;  5ADZ A;  4K0B A;  2OPL A;  5IP9 I;  1O92 A;  2P2B A;  3NH5 A;  4CL1 A;  2O4H A;  4E2Z A;  4B3M C;  3CCU Z;  2D28 C;  3I55 1;  4G37 A;  3I08 A;  3CCR Z;  1WZN A;  2OTJ 1;  2JA7 I;  3D6W A;  1TFI A;  3CQ1 A;  3VMG A;  4A3J I;  2OTL 1;  1X0T A;  4Y52 I;  1HNW C;  3HOZ I;  1Y1V I;  2P02 A;  1Z01 A;  2JMP A;  4PZP A;  4DGL A;  3F3F C;  4LFB C;  2WAQ A;  3A9U A;  2ZM6 C;  3CXC Z;  2MM9 A;  2M5H A;  5IFI A;  3VNS A;  2DE6 A;  1QF8 A;  2R92 I;  4WV3 A;  3TUF A;  2MMA B;  4MRI A;  4DV4 C;  2QW0 X;  5C4X I;  2D7V A;  5T6B A;  1XRC A;  2Q51 A;  4E2X A;  1VQ4 Z;  1MXB A;  1P7L A;  4QTT A;  5BR8 C;  4JV5 C;  4RM2 A;  5FLX b;  3G6E Z;  1IBK C;  1MXC A;  3NDJ A;  1W2B Y;  3VNR A;  4JI6 C;  1QVF Y;  1JWH C;  4NDN A;  3CCU 1;  4LF6 C;  1FUG A;  3UEB A;  1V26 A;  4DCS A;  4JI2 C;  4A3D I;  2I3C A;  4PUI A;  4NBB A;  5BSM A;  4RS4 A;  3S16 I;  3KIH A;  3CCL 1;  4G36 A;  1W2B Z;  4FUQ A;  1M90 2;  3GR0 A;  1QVF Z;  1QXF A;  1MDF A;  4E31 A;  2Y0S A;  1VLA A;  4E33 A;  2UU9 C;  4DCV A;  5T8T A;  4RVH A;  3SO4 A;  2DE7 A;  5CM2 M;  3EER A;  1M90 1;  3CQ3 A;  1S72 1;  2M48 A;  1Z03 A;  2QRC B;  3QWU A;  2JIQ A;  1KQS Y;  3KIF A;  4DV3 C;  4RVF A;  4PRO C;  4DG8 A;  4LE5 A;  3G7S A;  2M5O A;  4Y7N I;  2JUB A;  2ZZN A;  3GTM I;  1KRL A;  1YIT 1;  3PO3 I;  1Z02 A;  5BSR A;  5IT9 b;  1HNX C;  1JOS A;  4D4I A;  2V8J A;  3M4O I;  1O90 A;  2XR1 A;  1KQS Z;  1FJG C;  4DV5 C;  1VEH A;  4DR5 C;  3O2E A;  2KZ0 A;  3CC2 1;  3CPW Y;  2JIP A;  1NYE A;  1V25 A;  5E7Q A;  4MON A;  3CCE Z;  2QA4 Z;  1T5H X;  5K85 A;  4L7I A;  4DG9 A;  1N8R 1;  3CME Z;  2AYD A;  5CZX A;  3GPC A;  1PG4 A;  4R0M A;  2QRD B;  1YIJ 1;  2KI7 B;  2NAP A;  4U5Y D;  1IBM C;  3GTP I;  4PHT A;  3CQZ I;  4IR7 A;  2YWC A;  3M3Y I;  3PES A;  2E0G A;  1TWG I;  3OW2 Y;  3I55 Z;  1XNQ C;  2R93 I;  3VMI A;  2OOY B;  2RT9 A;  1KD1 2;  3PBK A;  4DR7 C;  2E7Z A;  3FQQ A;  2BH1 X;  2RPR A;  2D27 A;  2P2F A;  3ETC A;  4AQY C;  5CZV A;  2JIR A;  3EQ6 A;  4DR6 C;  2HF1 A;  2OTL Z;  2HJG A;  2ASB A;  4NH1 C;  2CY1 A;  3S82 A;  3T4N B;  4DV7 C;  2QVY X;  5BSU A;  1I50 I;  3KXW A;  1KD1 1;  1AA6 A;  2DHM A;  2RHB A;  2E2H I;  2QA4 1;  4BBY A;  4RVN A;  3CQ2 A;  3B7W A;  3CCM Z;  1I6H I;  3OTO C;  5A2Q f;  5D1P A;  2Y4O A;  2JIM A;  4NBC A;  1PG3 A;  2HU9 A;  3GTK I;  2LEX A;  3K6R A;  1O9T A;  3NDI A;  1HR0 C;  2UXB C;  3J80 f;  4R1M A;  4JYA C;  3AF6 A;  3S17 I;  4BBR I;  1NP6 A;  1YJW Z;  1QVG Y;  3I07 A;  4X6A I;  2AYA A;  2NVY I;  3NFZ A;  5C4J I;  2CXC A;  1KKG A;  1KC8 2;  4BSZ A;  4BY7 I;  4NBH A;  1VQM 1;  5BST A;  2E7G A;  3CCL Z;  3RZO I;  3R44 A;  1YJ7 A;  5A2Q b;  2OPL B;  2VZE A;  3CJE A;  3EED A;  1XS3 A;  3UX2 A;  5T8S A;  4G1I A;  2V3V A;  3CCJ Z;  3I4N I;  4DR1 C;  2CU6 A;  4NXN C;  2JR6 A;  4GS5 A;  1M1K 2;  1S72 Z;  3L8C A;  3CCM 1;  4RM3 A;  4HGY A;  4TNU A;  5D1O B;  3VTN A;  2P3Y A;  4LF5 C;  2ATW A;  1XRA A;  4DV1 C;  1MD9 A;  2F4M A;  2RBL A;  1WJ2 A;  1VQ7 1;  3P5J B;  1YIT Z;  3I4M I;  4A3E I;  2Y27 A;  3TQI A;  2QVZ X;  3CCS 1;  4JI5 C;  2VF1 A;  4ZJZ A;  3GTL I;  4GKK C;  5AE2 A;  3T1Y C;  2K5R A;  1YJW 1;  2OO4 A;  4X64 C;  1RG9 A;  2ONF A;  3UOW A;  5K8F A;  3CC2 Z;  2E8E A;  3CC4 1;  2YCB A;  4BBS I;  1XHJ A;  4E30 A;  5A2Q D;  2LIY A;  1Q7Y 2;  4NBF A;  2Z51 A;  1MDB A;  4DUZ C;  4A3B I;  2NVT I;  3HOU I;  3S1M I;  3J80 D;  1NUI A;  1L2F A;  1TWH I;  3CCJ 1;  1YIJ Z;  1UWD A;  4MXU A;  1RLY A;  1RO2 A;  3IEU A;  1S7M A;  2VSQ A;  4X66 C;  3NI2 A;  4OYC A;  1VQ6 1;  2WB1 A;  2JA6 I;  2D1R A;  3H0G I;  3BG1 B;  3J81 f;  3HOY I;  3D9X A;  2RIQ A;  3MZK B;  3S1R I;  1VQ8 Z;  4X62 C;  4JI4 C;  3DAY A;  2P2J A;  1J5E C;  2KDN A;  1K83 I;  1Q16 A;  2VQF C;  2QR1 B;  2M6N A;  1R9T I;  4X65 C;  1EGA A;  1USP B;  1TH5 A;  4ZLP A;  1BA3 A;  1HNZ C;  3GTQ I;  3LGX A;  1TWF I;  2E8C A;  3A25 A;  5AE1 A;  3IX0 A;  2VPZ A;  2PK7 A;  3CMA 1;  3DHV A;  2K3R A;  1K9M 2;  1RO4 A;  1V60 A;  3A4I A;  1IB8 A;  2GTI A;  3J7A 4;  5A1I A;  3J81 b;  1NJI 2;  4PUG A;  1ULT A;  4LFC C;  1VQP Z;  4DCU A;  2KPI A;  3CD6 1;  1L1O C;  3BG0 B;  1XRB A;  3NH8 A;  1K9M 1;  2QRE B;  4FTF A;  1Q82 2;  3A9V A;  4A3G I;  3NYQ A;  3CPW Z;  1K8A 2;  4LFA C;  4DV0 C;  1YJN Z;  4A3L I;  1NY8 A;  1NJI 1;  2YU9 I;  2DYJ A;  5T64 A;  4A3F I;  2NCL A;  4HH4 A;  3N54 B;  4L2Z A;  1LQL A;  3JAM f;  2H85 A;  3LUS A;  5DV9 A;  4DCT A;  5BUR A;  2E9H A;  1DL6 A;  2IV2 X;  3G4S 1;  5IP7 I;  3CCV 1;  1Q82 1;  1VQ8 1;  4EWC A;  4BXX I;  4NOZ A;  1K8A 1;  5BSV A;  3IML A;  2V7B A;  5BSW A;  4BY1 I;  1VQM Z;  1VQ5 1;  2E2I I;  2NVQ I;  4R1L A;  2PMZ A;  4D57 A;  2OZK A;  3R9W A;  1JJ2 Y;  4A93 I;  2F4V C;  2LFU A;  4JI1 C;  3CW8 X;  4HGZ A;  1TWA I;  5AN9 F;  3RZD I;  2JNV A;  1N33 C;  4JI7 C;  2MCQ A;  3OW2 Z;  3GKU A;  4ISB A;  2O53 A;  1XNR C;  3J81 D;  3MON A;  1QM4 A;  3GTG I;  5BUQ A;  1JJ2 Z;  2YAD A;  1ZH1 A;  1YJ9 1;  3T1H C;  1FDI A;  3S2H I;  1VQP 1;  2Q4Z A;  3L95 X;  2BJO A;  3F3P C;  1VQ7 Z;  1GPM A;  3GTM S;  3D2L A;  1YJN 1;  4B3T C;  3LAX A;  3GTJ I;  2GTH A;  2PM9 A;  3CCS Z;  4QTU A;  4BC9 A;  1AMU A;  5LMU C;  4DV6 C;  1Q81 2;  1YUA A;  2VPW A;  4GKJ C;  1WCM I;  2EGT A;  3K7A I;  1RNI A;  2QKD A;  3CC4 Z;  3NPD A;  1K0R A;  4NBA A;  1O93 A;  2WD9 A;  5GTD A;  2VPX A;  4MD9 A;  4RVO A;  3S15 I;  1ZB9 A;  2VQE C;  4EAT A;  5KEI A;  4DR3 C;  5BUS A;  1MXA A;  1Q81 1;  1WW9 A;  5KYT A;  4MH4 A;  2V8I A;  1QVG Z;  1YUK A;  3RG2 A;  1KC8 1;  4E2Y A;  1YHQ Z;  2UXC C;  3TE5 B;  4RV9 A;  3J80 b;  4RVD A;  2KZF A;  5C3E I;  1N34 C;  4LF4 C;  1FDO A;  1VQ6 Z;  1P4E C;  3R9X A;  2JNY A;  3IR7 A;  1P4E A;  3CCQ Z;  3HKZ A;  3UX3 A;  4A3K I;  1VQL 1; 
#chains in the Genus database with same CATH homology
 3CXC Y;  3G71 1;  1I94 C;  2P2M A;  2JS4 A;  1VQ9 1;  2VUM I;  2JA5 I;  4A3I I;  2QEX 1;  3GKQ A;  5FLX f;  1M1K 1;  4KTV A;  5D1O A;  4DR4 C;  4NB9 A;  1VQK 1;  1RY2 A;  4YHH C;  5FLM I;  3CMA Z;  3DLP X;  2QLV B;  1YI2 1;  4DR2 C;  4NBD A;  3I56 Z;  1Y1W I;  2G2K A;  4RLF A;  2VUG A;  4MTN A;  1QWI A;  2UUC C;  4B3S C;  3C5E A;  2E5L C;  3CD6 Z;  1P9N A;  5C44 I;  5LMN C;  4KTT A;  5AE3 A;  2HHH C;  3LNV A;  2IZ4 A;  1MKY A;  1I3Q I;  2DE5 A;  2IZ3 A;  1YHQ 1;  2ZAE B;  1Q7Y 1;  4LF8 C;  4TPS B;  2AKL A;  1QYP A;  4BCA A;  4RVG A;  3TDH B;  3G4S Z;  2W03 A;  3CCV Z;  3FCC A;  3FCE A;  3HOW I;  3CCR 1;  2PT7 G;  3CCQ 1;  1VQ5 Z;  2D1T A;  4E2W A;  2P2Q A;  4YY3 C;  4K0K C;  4MD8 A;  4FUT A;  1N2F A;  4A3C I;  1Y1V S;  4DUY C;  3PO2 I;  4JI0 C;  3ETO A;  4JI3 C;  4S1T A;  5IT9 f;  2P20 A;  3AF5 A;  2R7Z I;  3S2D I;  4ODJ A;  2WP0 C;  2R6M A;  4MD7 A;  1LCI A;  3CC7 Z;  1WF3 A;  4D4G A;  5A1G A;  1USP A;  3CW9 A;  4AYB A;  5IWA C;  2QVX X;  3I56 1;  4RMN A;  2V8K A;  1YJ9 Z;  4JM1 A;  1X3W A;  5H9U A;  4NFR A;  2JMO A;  4OXI A;  2J6A A;  5FLX D;  1VQO Z;  1VQ4 1;  1HH2 P;  2YWB A;  3HOX I;  1WH9 A;  2W04 A;  5LL6 f;  4I9F A;  3UZ0 A;  4DV2 C;  3G6E 1;  2B63 I;  2E2J I;  4NBG A;  2D1Q A;  3VNQ A;  3S1Q I;  4KHP C;  4DQY B;  4D56 A;  4OX9 C;  1ML8 A;  1RO0 A;  3S1N I;  1X3Z A;  4RLQ A;  1N8R 2;  2JA8 I;  3E7W A;  3GR1 A;  3IF8 A;  4HPV A;  5KYV A;  2QL8 A;  2Y4N A;  2PN2 A;  2NVX I;  1TWC I;  4NBE A;  1IBL C;  4GXR A;  4DK1 A;  1PA4 A;  3N2Q A;  2UUB C;  2D1S A;  4JI8 C;  4WS9 A;  2F4O A;  3PRO C;  1N32 C;  1SFO I;  2P28 A;  3GCF A;  2OOX B;  5T67 A;  1PFT A;  4NXM C;  4BC7 A;  2DPL A;  4LF7 C;  3CC7 1;  1VQN Z;  3VB9 A;  3JAM b;  1Q86 2;  1K73 2;  3RV2 A;  5JRH A;  4NB8 A;  3FKI I;  3IFU A;  1VQO 1;  2OTJ Z;  1VQL Z;  3IPL A;  1XMO C;  3G71 Z;  3E7X A;  3NYR A;  1VQ9 Z;  5IT9 D;  3PO3 S;  3MZL B;  2QEX Z;  1Q86 1;  1K73 1;  2PRO A;  1XMQ C;  3H3V J;  3NH4 A;  3HOV I;  3FQM A;  3U50 C;  1RQF A;  1VQK Z;  4A3M I;  4IZ6 A;  1ZB8 A;  2OBV A;  4L4Q A;  3IEV A;  4LF9 C;  1YI2 Z;  3VMH A;  4I9G A;  4XX2 A;  3CCE 1;  1T5D X;  1N36 C;  2E8F A;  3H2T A;  3TDE A;  5A19 A;  3S14 I;  4E32 A;  3CME 1;  3Q87 A;  2UXD C;  3GTO I;  4GXQ A;  2GU2 A;  3ESW A;  2UUA C;  3JAM D;  1UKK A;  1WII A;  1VQN 1;  4B3R C;  5ADZ A;  4K0B A;  2OPL A;  5IP9 I;  1O92 A;  2P2B A;  3NH5 A;  4CL1 A;  2O4H A;  4E2Z A;  4B3M C;  3CCU Z;  2D28 C;  3I55 1;  4G37 A;  3I08 A;  3CCR Z;  2OTJ 1;  2JA7 I;  3D6W A;  1TFI A;  3VMG A;  4A3J I;  2OTL 1;  1X0T A;  4Y52 I;  1HNW C;  3HOZ I;  1Y1V I;  2P02 A;  1Z01 A;  2JMP A;  4PZP A;  4DGL A;  3F3F C;  4LFB C;  2WAQ A;  3A9U A;  2ZM6 C;  3CXC Z;  5IFI A;  3VNS A;  2DE6 A;  1QF8 A;  2R92 I;  4WV3 A;  3TUF A;  4DV4 C;  4MRI A;  2QW0 X;  5C4X I;  2D7V A;  5T6B A;  1XRC A;  2Q51 A;  4E2X A;  1VQ4 Z;  1MXB A;  1P7L A;  4QTT A;  5BR8 C;  4JV5 C;  4RM2 A;  5FLX b;  3G6E Z;  1IBK C;  1MXC A;  3NDJ A;  1W2B Y;  3VNR A;  4JI6 C;  1QVF Y;  1JWH C;  4NDN A;  3CCU 1;  4LF6 C;  1FUG A;  4JI2 C;  1V26 A;  4DCS A;  4A3D I;  2I3C A;  4NBB A;  5BSM A;  4RS4 A;  3S16 I;  3KIH A;  3CCL 1;  4G36 A;  1W2B Z;  4FUQ A;  1M90 2;  3GR0 A;  1QVF Z;  1MDF A;  4E31 A;  2Y0S A;  1VLA A;  4E33 A;  2UU9 C;  4DCV A;  5T8T A;  4RVH A;  3SO4 A;  2DE7 A;  5CM2 M;  3EER A;  1M90 1;  1S72 1;  2M48 A;  1Z03 A;  2QRC B;  3QWU A;  4DV3 C;  1KQS Y;  3KIF A;  4RVF A;  4PRO C;  4DG8 A;  4LE5 A;  3G7S A;  4Y7N I;  2JUB A;  3GTM I;  1KRL A;  1YIT 1;  3PO3 I;  1Z02 A;  5BSR A;  5IT9 b;  1HNX C;  1JOS A;  4D4I A;  2V8J A;  3M4O I;  1O90 A;  2XR1 A;  1KQS Z;  1FJG C;  4DV5 C;  4DR5 C;  3CC2 1;  3CPW Y;  1NYE A;  1V25 A;  5E7Q A;  4MON A;  3CCE Z;  2QA4 Z;  1T5H X;  5K85 A;  4L7I A;  4DG9 A;  1N8R 1;  3CME Z;  5CZX A;  3GPC A;  1PG4 A;  4R0M A;  2QRD B;  1YIJ 1;  2KI7 B;  4U5Y D;  1IBM C;  3GTP I;  4PHT A;  3CQZ I;  4IR7 A;  2YWC A;  3M3Y I;  3PES A;  2E0G A;  1TWG I;  3OW2 Y;  3I55 Z;  1XNQ C;  2R93 I;  3VMI A;  2OOY B;  2RT9 A;  1KD1 2;  3PBK A;  4DR7 C;  3FQQ A;  2BH1 X;  2RPR A;  2D27 A;  2P2F A;  3ETC A;  4AQY C;  5CZV A;  3EQ6 A;  4DR6 C;  2HF1 A;  2OTL Z;  2HJG A;  2ASB A;  4NH1 C;  2CY1 A;  3S82 A;  3T4N B;  4DV7 C;  2QVY X;  5BSU A;  1I50 I;  3KXW A;  1KD1 1;  2RHB A;  2E2H I;  2QA4 1;  4BBY A;  4RVN A;  3B7W A;  3CCM Z;  1I6H I;  3OTO C;  5A2Q f;  5D1P A;  2Y4O A;  1PG3 A;  4NBC A;  2HU9 A;  3GTK I;  1O9T A;  3NDI A;  1HR0 C;  2UXB C;  3J80 f;  4R1M A;  4JYA C;  3AF6 A;  3S17 I;  4BBR I;  1NP6 A;  1YJW Z;  1QVG Y;  3I07 A;  4X6A I;  2AYA A;  2NVY I;  3NFZ A;  5C4J I;  2CXC A;  1KKG A;  1KC8 2;  4BSZ A;  4BY7 I;  4NBH A;  1VQM 1;  5BST A;  2E7G A;  3CCL Z;  3RZO I;  3R44 A;  1YJ7 A;  5A2Q b;  2OPL B;  2VZE A;  3CJE A;  3EED A;  5T8S A;  4G1I A;  3CCJ Z;  3I4N I;  4DR1 C;  4NXN C;  2JR6 A;  4GS5 A;  1M1K 2;  1S72 Z;  3L8C A;  3CCM 1;  4RM3 A;  4HGY A;  4TNU A;  5D1O B;  3VTN A;  2P3Y A;  4LF5 C;  2ATW A;  1XRA A;  4DV1 C;  1MD9 A;  2F4M A;  2RBL A;  1VQ7 1;  3P5J B;  1YIT Z;  3I4M I;  4A3E I;  2Y27 A;  3TQI A;  2QVZ X;  3CCS 1;  4JI5 C;  2VF1 A;  4ZJZ A;  3GTL I;  4GKK C;  5AE2 A;  3T1Y C;  2K5R A;  1YJW 1;  2OO4 A;  4X64 C;  1RG9 A;  2ONF A;  3UOW A;  5K8F A;  3CC2 Z;  2E8E A;  3CC4 1;  2YCB A;  4BBS I;  4E30 A;  5A2Q D;  2LIY A;  1Q7Y 2;  4NBF A;  1MDB A;  4DUZ C;  4A3B I;  2NVT I;  3HOU I;  3S1M I;  3J80 D;  1NUI A;  1L2F A;  1TWH I;  3CCJ 1;  1YIJ Z;  4MXU A;  1RLY A;  1RO2 A;  3IEU A;  1S7M A;  2VSQ A;  4X66 C;  3NI2 A;  4OYC A;  1VQ6 1;  2WB1 A;  2JA6 I;  2D1R A;  3H0G I;  3BG1 B;  3J81 f;  3HOY I;  3D9X A;  2RIQ A;  3MZK B;  3S1R I;  1VQ8 Z;  4X62 C;  4JI4 C;  3DAY A;  2P2J A;  1J5E C;  1K83 I;  2VQF C;  2QR1 B;  2M6N A;  1R9T I;  4X65 C;  1EGA A;  1USP B;  4ZLP A;  1BA3 A;  1HNZ C;  3GTQ I;  3LGX A;  1TWF I;  2E8C A;  5AE1 A;  3IX0 A;  3CMA 1;  2PK7 A;  3DHV A;  2K3R A;  1K9M 2;  1RO4 A;  3A4I A;  2GTI A;  3J7A 4;  5A1I A;  3J81 b;  1NJI 2;  1ULT A;  4LFC C;  1VQP Z;  4DCU A;  2KPI A;  3CD6 1;  1L1O C;  3BG0 B;  1XRB A;  3NH8 A;  1K9M 1;  2QRE B;  4FTF A;  1Q82 2;  3A9V A;  4A3G I;  3NYQ A;  3CPW Z;  1K8A 2;  4LFA C;  4DV0 C;  1YJN Z;  4A3L I;  1NJI 1;  2YU9 I;  2DYJ A;  5T64 A;  4A3F I;  4HH4 A;  3N54 B;  4L2Z A;  1LQL A;  3JAM f;  2H85 A;  3LUS A;  5DV9 A;  4DCT A;  5BUR A;  2E9H A;  1DL6 A;  3G4S 1;  5IP7 I;  3CCV 1;  1Q82 1;  1VQ8 1;  4EWC A;  4BXX I;  4NOZ A;  1K8A 1;  5BSV A;  3IML A;  2V7B A;  5BSW A;  4BY1 I;  1VQM Z;  1VQ5 1;  2E2I I;  2NVQ I;  4R1L A;  2PMZ A;  4D57 A;  2OZK A;  3R9W A;  1JJ2 Y;  4A93 I;  2F4V C;  2LFU A;  4JI1 C;  3CW8 X;  4HGZ A;  1TWA I;  5AN9 F;  3RZD I;  1N33 C;  4JI7 C;  3OW2 Z;  3GKU A;  4ISB A;  2O53 A;  1XNR C;  3J81 D;  3MON A;  1QM4 A;  3GTG I;  5BUQ A;  1JJ2 Z;  2YAD A;  1ZH1 A;  1YJ9 1;  3T1H C;  3S2H I;  1VQP 1;  2Q4Z A;  3L95 X;  2BJO A;  3F3P C;  1VQ7 Z;  1GPM A;  3GTM S;  1YJN 1;  4B3T C;  3LAX A;  3GTJ I;  2GTH A;  2PM9 A;  3CCS Z;  4QTU A;  4BC9 A;  1AMU A;  5LMU C;  4DV6 C;  1Q81 2;  1YUA A;  4GKJ C;  1WCM I;  2EGT A;  3K7A I;  1RNI A;  2QKD A;  3CC4 Z;  3NPD A;  1K0R A;  4NBA A;  1O93 A;  2WD9 A;  5GTD A;  4MD9 A;  4RVO A;  3S15 I;  1ZB9 A;  2VQE C;  4EAT A;  5KEI A;  4DR3 C;  5BUS A;  1MXA A;  1Q81 1;  1WW9 A;  5KYT A;  4MH4 A;  2V8I A;  1QVG Z;  1YUK A;  3RG2 A;  1KC8 1;  4E2Y A;  1YHQ Z;  2UXC C;  3TE5 B;  4RV9 A;  3J80 b;  4RVD A;  2KZF A;  5C3E I;  1N34 C;  4LF4 C;  1VQ6 Z;  3R9X A;  2JNY A;  3CCQ Z;  3HKZ A;  4A3K I;  1VQL 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...