2D7VA

Structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
155
structure length
155
Chain Sequence
SMSEHSAIVTWKRKDSEAFTDNQYSRAHTWEFDGGSKILASASPHVVPVPLSVEANVDPEEAFVAALSSCHMLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKMHHLAHENCFIANSVETEVVTEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein VCA0330
publication title Hypothetical protein VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
total genus 32
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d7vA00
1MKYA 3I07A 1N2FA 4XX2A 2VQFC 2QL8A 1LQLA 5IT9D 1FJGC 4X64C 4DR5C 1L2FA 4AQYC 5BR8C 2E5LC 2OPLA 4DV4C 1XMOC 2HHHC 1HR0C 4DR6C 3T1YC 1N33C 4K0KC 4B3MC 1USPB 3R9WA 3R9XA 2UXCC 3JAMD 1XNQC 2UUBC 3T1HC 2D7VA 2UXBC 4GKKC 4DR3C 2E8EA 4OX9C 5IWAC 4DV2C 4JI5C 1J5EC 2VQEC 4KHPC 1IBMC 4DV7C 4JI6C 2UUCC 4JI4C 3LUSA 2ASBA 1PA4A 1N34C 1N36C 1VLAA 1ZB9A 3AF6A 4JYAC 4DUYC 3IEVA 4NXMC 1KKGA 4JI7C 4DR7C 1WF3A 4JI2C 4GKJC 2UU9C 2E8FA 4B3TC 4JI0C 1HH2P 2ATWA 2UUAC 4NOZA 4YHHC 1HNWC 4DCSA 3J81D 2CXCA 2OPLB 4DV6C 4B3RC 2F4VC 3J80D 4B3SC 1EGAA 1I94C 4DR1C 1K0RA 2ZM6C 1IBKC 4LF9C 4DR2C 4JI8C 2XR1A 2EGTA 4X62C 4JI3C 1ML8A 4LF7C 4DV0C 1NYEA 4JI1C 5A2QD 4YY3C 4DUZC 3CJEA 5LMUC 4DV1C 1ZB8A 2YCBA 1XNRC 4DCUA 4JV5C 1N32C 2CY1A 1XMQC 1QWIA 4DR4C 4DCTA 2E8CA 4LF4C 2BJOA 3IEUA 4MTNA 1IBLC 1HNZC 5FLXD 3EERA 2HJGA 4X65C 2DYJA 2ONFA 4X66C 4DCVA 4MH4A 3GKUA 3OTOC 4LFAC 2UXDC 4LFCC 4LF8C 2PN2A 4DV5C 4LF5C 4BSZA 1UKKA 2E7GA 2PT7G 5LMNC 1USPA 2KZFA 1WH9A 3AF5A 1HNXC 2JMPA 4NXNC 4DV3C 1JOSA 4LFBC 4LF6C
chains in the Genus database with same CATH superfamily
5E7QA 1XRAA 1N2FA 2QL8A 5KEIA 4PHTA 1MXAA 2ZZNA 2BH1X 4DR5C 1VEHA 5A1IA 2E5LC 4OYCA 3T1YC 1N33C 4ZLPA 4B3MC 1USPB 3IMLA 4IZ6A 4DG8A 4GKKC 2VQEC 1IBMC 5BURA 3A9UA 3B7WA 4DUYC 1KKGA 5H9UA 1WF3A 3VNQA 3TUFA 2D1RA 2E0GA 1V25A 4L7IA 2WD9A 3O2EA 3UEBA 2QVYX 1V26A 3IPLA 1K0RA 5T8TA 2ZM6C 2XR1A 3CW8X 2P20A 1P7LA 1XNRC 3G7SA 3UZ0A 3CW9A 4DR4C 4NDNA 2E8CA 3LNOA 2P2MA 1HNZC 2WP0C 3TDEA 3SO4A 4LF8C 4I9FA 4RLQA 4DV5C 4ODJA 2VZEA 3AY0A 3PESA 4GXRA 5KYVA 2YWCA 3N54B 1P4EC 1MD9A 4DV3C 2DHMA 1LCIA 1T5HX 1YJ7A 1MXCA 4D56A 3FCCA 4GXQA 4D4IA 4XX2A 1AMUA 4LE5A 3RG2A 4X64C 2YX1A 1L2FA 3K6RA 2P02A 5AE2A 4I9GA 5BSVA 1XMOC 1HR0C 3R9WA 1XNQC 2KZ0A 4RMNA 4DR3C 1M6XA 5A1GA 1J5EC 1O93A 4KHPC 1FUGA 4OXIA 4DV7C 2ASBA 4JI4C 1IB8A 3GPCA 1PA4A 2YWBA 3DAYA 1O92A 3TQIA 5BSTA 4JI7C 3C5EA 3NI2A 4GKJC 5LCIA 2DPLA 4RLFA 4NOZA 4YHHC 5GTDA 4BC7A 5CZXA 1NY8A 4B3RC 3LAXA 2P2JA 5IFIA 4JI3C 3CJEA 4DV1C 2AYAA 4K0BA 2YCBA 4KTTA 1PG3A 4PUGA 1QWIA 5BSWA 2P2FA 4G36A 1MXBA 2BJOA 4LF4C 5FLXD 3A9VA 1MDFA 2D1TA 4FUTA 5A19A 2ONFA 4MH4A 4FTFA 4FUQA 4G1IA 3R44A 2QW0X 4BSZA 4R1LA 1MDBA 2KZFA 3ETCA 2M5OA 3AF5A 3UOWA 2JMPA 5T8SA 3LGXA 1MKYA 3GR1A 2Y4NA 4G37A 4DG9A 4R1MA 4TPSB 2VQFC 1GPMA 1FLOA 4PROC 3NYQA 4R0MA 2D1QA 2QVZX 5IT9D 1M6XC 4RVNA 4D57A 3ETOA 5BSUA 5BR8C 2OPLA 3RV2A 2CU6A 3PBKA 2UXCC 3R9XA 1XRBA 3VNSA 2P2QA 3N2QA 3T1HC 2D7VA 1QM4A 3DLPX 5AE1A 5IWAC 4DV2C 3S82A 3UX2A 2UUCC 1N34C 4JYAC 1ZB9A 1RG9A 4PUIA 3IEVA 4D4GA 2D1SA 3CQ1A 2UU9C 4BCAA 4B3TC 1HH2P 1BA3A 1PG4A 3PROC 4DCSA 3J81D 1PU1A 3E7XA 2QVXX 1O9TA 5BUSA 4DV6C 2F4VC 3L8CA 3J80D 1EGAA 1I94C 2PROA 1IBKC 5K8FA 4DR2C 2Z51A 3A25A 4JI8C 4L4QA 4RVOA 3TR3A 2Y27A 3A26A 4JM1A 3CQ2A 4DV0C 1NYEA 4JI1C 5A2QD 5DV9A 4DCUA 3GR0A 1T5DX 2V7BA 1N32C 2CY1A 4L2ZA 1XMQC 4DCTA 2D28C 4PUHA 4MTNA 2HJGA 4X65C 1ULTA 2DYJA 3L95X 4DCVA 3OTOC 4LFAC 3KXWA 2PN2A 1P4EA 4U5YD 4LF5C 4ISBA 2PT7G 5LMNC 4EATA 2MMAB 1USPA 3CQ3A 2OBVA 1XHJA 4RM2A 1WH9A 1HNXC 2NCLA 4NXNC 5BSMA 4LFBC 4LF6C 2M5HA 1XRCA 3NYRA 3VNRA 3I07A 5BUQA 1LQLA 1FJGC 1UWDA 1RY2A 2P2BA 4AQYC 4DV4C 5BSRA 2HHHC 5ADZA 4DR6C 4K0KC 3JAMD 2UUBC 2UXBC 2MCQA 2E8EA 5AE3A 4OX9C 4JI5C 4JI6C 3LUSA 1N36C 3A4IA 1VLAA 3AF6A 4BBYA 4NXMC 2Y4OA 1XS3A 4DR7C 4WS9A 4JI2C 4RM3A 2E8FA 4JI0C 2ATWA 2UUAC 3UX3A 1HNWC 3NPDA 1O90A 2CXCA 2OPLB 5K85A 4B3SC 3I08A 4PZPA 4GS5A 4DR1C 4LF9C 2KDNA 4WV3A 3FCEA 5CZVA 2EGTA 4X62C 4LF7C 1ML8A 4IR7A 3E7WA 3H2TA 3DHVA 4YY3C 4DUZC 5LMUC 5KYTA 1ZB8A 4JV5C 2ZZMA 4ZJZA 4BC9A 3EQ6A 3IEUA 1IBLC 3EERA 2JNVA 3LNVA 4X66C 2UXDC 5JRHA 3GKUA 4HPVA 4LFCC 2MM9A 1V60A 1TH5A 1UKKA 2E7GA 1WCJA 4KTVA 2OO4A 1JOSA 2D27A 2VSQA
chains in the Genus database with same CATH topology
5E7QA 1XRAA 1N2FA 2QL8A 5KEIA 4PHTA 1MXAA 2BH1X 4DR5C 5A1IA 2E5LC 4OYCA 3T1YC 1N33C 4ZLPA 4B3MC 1USPB 3IMLA 4IZ6A 4DG8A 4GKKC 2VQEC 1IBMC 5BURA 3A9UA 3B7WA 4DUYC 1KKGA 5H9UA 1WF3A 3VNQA 3TUFA 2D1RA 2E0GA 1V25A 4L7IA 2WD9A 2QVYX 1V26A 3IPLA 1K0RA 5T8TA 2ZM6C 2XR1A 3CW8X 2P20A 1P7LA 1XNRC 3G7SA 3UZ0A 3CW9A 4DR4C 4NDNA 2E8CA 2P2MA 1HNZC 2WP0C 3TDEA 3SO4A 4LF8C 4I9FA 4RLQA 4DV5C 4ODJA 2VZEA 3PESA 4GXRA 5KYVA 2YWCA 3N54B 1MD9A 4DV3C 1LCIA 1T5HX 1YJ7A 1MXCA 4D56A 3FCCA 4GXQA 4D4IA 4XX2A 1AMUA 4LE5A 3RG2A 4X64C 1L2FA 2P02A 5AE2A 4I9GA 5BSVA 1XMOC 1HR0C 3R9WA 1XNQC 4RMNA 4DR3C 5A1GA 1J5EC 1O93A 4KHPC 1FUGA 4OXIA 4DV7C 2ASBA 4JI4C 3GPCA 1PA4A 2YWBA 3DAYA 1O92A 3TQIA 5BSTA 4JI7C 3C5EA 3NI2A 4GKJC 2DPLA 4RLFA 4NOZA 4YHHC 5GTDA 4BC7A 5CZXA 4B3RC 3LAXA 2P2JA 5IFIA 4JI3C 3CJEA 4DV1C 2AYAA 4K0BA 2YCBA 4KTTA 1PG3A 1QWIA 5BSWA 2P2FA 4G36A 1MXBA 2BJOA 4LF4C 5FLXD 3A9VA 1MDFA 2D1TA 4FUTA 5A19A 2ONFA 4MH4A 4FTFA 4FUQA 4G1IA 3R44A 2QW0X 4BSZA 4R1LA 1MDBA 2KZFA 3ETCA 3AF5A 3UOWA 2JMPA 5T8SA 3LGXA 1MKYA 3GR1A 2Y4NA 4G37A 4DG9A 4R1MA 4TPSB 2VQFC 1GPMA 4PROC 3NYQA 4R0MA 2D1QA 2QVZX 5IT9D 4RVNA 4D57A 3ETOA 5BSUA 5BR8C 2OPLA 3RV2A 3PBKA 2UXCC 3R9XA 1XRBA 3VNSA 2P2QA 3N2QA 3T1HC 2D7VA 1QM4A 3DLPX 5AE1A 5IWAC 4DV2C 3S82A 2UUCC 1N34C 4JYAC 1ZB9A 1RG9A 3IEVA 4D4GA 2D1SA 2UU9C 4BCAA 4B3TC 1HH2P 1BA3A 1PG4A 3PROC 4DCSA 3J81D 3E7XA 2QVXX 1O9TA 5BUSA 4DV6C 2F4VC 3L8CA 3J80D 1EGAA 1I94C 2PROA 1IBKC 5K8FA 4DR2C 4JI8C 4L4QA 4RVOA 2Y27A 4JM1A 4DV0C 1NYEA 4JI1C 5A2QD 5DV9A 4DCUA 3GR0A 1T5DX 2V7BA 1N32C 2CY1A 4L2ZA 1XMQC 4DCTA 2D28C 4MTNA 2HJGA 4X65C 1ULTA 2DYJA 3L95X 4DCVA 3OTOC 4LFAC 3KXWA 2PN2A 4U5YD 4LF5C 4ISBA 2PT7G 5LMNC 4EATA 1USPA 2OBVA 4RM2A 1WH9A 1HNXC 4NXNC 5BSMA 4LFBC 4LF6C 1XRCA 3NYRA 3VNRA 3I07A 5BUQA 1LQLA 1FJGC 1RY2A 2P2BA 4AQYC 4DV4C 5BSRA 2HHHC 5ADZA 4DR6C 4K0KC 3JAMD 2UUBC 2UXBC 2E8EA 5AE3A 4OX9C 4JI5C 4JI6C 3LUSA 1N36C 3A4IA 1VLAA 3AF6A 4BBYA 4NXMC 2Y4OA 4DR7C 4WS9A 4JI2C 4RM3A 2E8FA 4JI0C 2ATWA 2UUAC 1HNWC 3NPDA 1O90A 2CXCA 2OPLB 5K85A 4B3SC 3I08A 4PZPA 4GS5A 4DR1C 4LF9C 3FCEA 4WV3A 5CZVA 4X62C 2EGTA 4LF7C 1ML8A 4IR7A 3E7WA 3H2TA 3DHVA 4YY3C 4DUZC 5LMUC 5KYTA 1ZB8A 4JV5C 4ZJZA 4BC9A 3EQ6A 3IEUA 1IBLC 3EERA 3LNVA 4X66C 2UXDC 5JRHA 3GKUA 4HPVA 4LFCC 1UKKA 2E7GA 4KTVA 2OO4A 1JOSA 2D27A 2VSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MKY A;  3I07 A;  1N2F A;  4XX2 A;  2VQF C;  2QL8 A;  1LQL A;  5IT9 D;  1FJG C;  4X64 C;  4DR5 C;  1L2F A;  4AQY C;  5BR8 C;  2E5L C;  2OPL A;  4DV4 C;  1XMO C;  2HHH C;  1HR0 C;  4DR6 C;  3T1Y C;  1N33 C;  4K0K C;  4B3M C;  1USP B;  3R9W A;  3R9X A;  2UXC C;  3JAM D;  1XNQ C;  2UUB C;  3T1H C;  2D7V A;  2UXB C;  4GKK C;  4DR3 C;  2E8E A;  4OX9 C;  5IWA C;  4DV2 C;  4JI5 C;  1J5E C;  2VQE C;  4KHP C;  1IBM C;  4DV7 C;  4JI6 C;  2UUC C;  4JI4 C;  3LUS A;  2ASB A;  1PA4 A;  1N34 C;  1N36 C;  1VLA A;  1ZB9 A;  3AF6 A;  4JYA C;  4DUY C;  3IEV A;  4NXM C;  1KKG A;  4JI7 C;  4DR7 C;  1WF3 A;  4JI2 C;  4GKJ C;  2UU9 C;  2E8F A;  4B3T C;  4JI0 C;  1HH2 P;  2ATW A;  2UUA C;  4NOZ A;  4YHH C;  1HNW C;  4DCS A;  3J81 D;  2CXC A;  2OPL B;  4DV6 C;  4B3R C;  2F4V C;  3J80 D;  4B3S C;  1EGA A;  1I94 C;  4DR1 C;  1K0R A;  2ZM6 C;  1IBK C;  4LF9 C;  4DR2 C;  4JI8 C;  2XR1 A;  2EGT A;  4X62 C;  4JI3 C;  1ML8 A;  4LF7 C;  4DV0 C;  1NYE A;  4JI1 C;  5A2Q D;  4YY3 C;  4DUZ C;  3CJE A;  5LMU C;  4DV1 C;  1ZB8 A;  2YCB A;  1XNR C;  4DCU A;  4JV5 C;  1N32 C;  2CY1 A;  1XMQ C;  1QWI A;  4DR4 C;  4DCT A;  2E8C A;  4LF4 C;  2BJO A;  3IEU A;  4MTN A;  1IBL C;  1HNZ C;  5FLX D;  3EER A;  2HJG A;  4X65 C;  2DYJ A;  2ONF A;  4X66 C;  4DCV A;  4MH4 A;  3GKU A;  3OTO C;  4LFA C;  2UXD C;  4LFC C;  4LF8 C;  2PN2 A;  4DV5 C;  4LF5 C;  4BSZ A;  1UKK A;  2E7G A;  2PT7 G;  5LMN C;  1USP A;  2KZF A;  1WH9 A;  3AF5 A;  1HNX C;  2JMP A;  4NXN C;  4DV3 C;  1JOS A;  4LFB C;  4LF6 C; 
#chains in the Genus database with same CATH topology
 5E7Q A;  1XRA A;  1N2F A;  2QL8 A;  5KEI A;  4PHT A;  1MXA A;  2ZZN A;  2BH1 X;  4DR5 C;  1VEH A;  5A1I A;  2E5L C;  4OYC A;  3T1Y C;  1N33 C;  4ZLP A;  4B3M C;  1USP B;  3IML A;  4IZ6 A;  4DG8 A;  4GKK C;  2VQE C;  1IBM C;  5BUR A;  3A9U A;  3B7W A;  4DUY C;  1KKG A;  5H9U A;  1WF3 A;  3VNQ A;  3TUF A;  2D1R A;  2E0G A;  1V25 A;  4L7I A;  2WD9 A;  3O2E A;  3UEB A;  2QVY X;  1V26 A;  3IPL A;  1K0R A;  5T8T A;  2ZM6 C;  2XR1 A;  3CW8 X;  2P20 A;  1P7L A;  1XNR C;  3G7S A;  3UZ0 A;  3CW9 A;  4DR4 C;  4NDN A;  2E8C A;  3LNO A;  2P2M A;  1HNZ C;  2WP0 C;  3TDE A;  3SO4 A;  4LF8 C;  4I9F A;  4RLQ A;  4DV5 C;  4ODJ A;  2VZE A;  3AY0 A;  3PES A;  4GXR A;  5KYV A;  2YWC A;  3N54 B;  1P4E C;  1MD9 A;  4DV3 C;  2DHM A;  1LCI A;  1T5H X;  1YJ7 A;  1MXC A;  4D56 A;  3FCC A;  4GXQ A;  4D4I A;  4XX2 A;  1AMU A;  4LE5 A;  3RG2 A;  4X64 C;  2YX1 A;  1L2F A;  3K6R A;  2P02 A;  5AE2 A;  4I9G A;  5BSV A;  1XMO C;  1HR0 C;  3R9W A;  1XNQ C;  2KZ0 A;  4RMN A;  4DR3 C;  1M6X A;  5A1G A;  1J5E C;  1O93 A;  4KHP C;  1FUG A;  4OXI A;  4DV7 C;  2ASB A;  4JI4 C;  1IB8 A;  3GPC A;  1PA4 A;  2YWB A;  3DAY A;  1O92 A;  3TQI A;  5BST A;  4JI7 C;  3C5E A;  3NI2 A;  4GKJ C;  5LCI A;  2DPL A;  4RLF A;  4NOZ A;  4YHH C;  5GTD A;  4BC7 A;  5CZX A;  1NY8 A;  4B3R C;  3LAX A;  2P2J A;  5IFI A;  4JI3 C;  3CJE A;  4DV1 C;  2AYA A;  4K0B A;  2YCB A;  4KTT A;  1PG3 A;  4PUG A;  1QWI A;  5BSW A;  2P2F A;  4G36 A;  1MXB A;  2BJO A;  4LF4 C;  5FLX D;  3A9V A;  1MDF A;  2D1T A;  4FUT A;  5A19 A;  2ONF A;  4MH4 A;  4FTF A;  4FUQ A;  4G1I A;  3R44 A;  2QW0 X;  4BSZ A;  4R1L A;  1MDB A;  2KZF A;  3ETC A;  2M5O A;  3AF5 A;  3UOW A;  2JMP A;  5T8S A;  3LGX A;  1MKY A;  3GR1 A;  2Y4N A;  4G37 A;  4DG9 A;  4R1M A;  4TPS B;  2VQF C;  1GPM A;  1FLO A;  4PRO C;  3NYQ A;  4R0M A;  2D1Q A;  2QVZ X;  5IT9 D;  1M6X C;  4RVN A;  4D57 A;  3ETO A;  5BSU A;  5BR8 C;  2OPL A;  3RV2 A;  2CU6 A;  3PBK A;  2UXC C;  3R9X A;  1XRB A;  3VNS A;  2P2Q A;  3N2Q A;  3T1H C;  2D7V A;  1QM4 A;  3DLP X;  5AE1 A;  5IWA C;  4DV2 C;  3S82 A;  3UX2 A;  2UUC C;  1N34 C;  4JYA C;  1ZB9 A;  1RG9 A;  4PUI A;  3IEV A;  4D4G A;  2D1S A;  3CQ1 A;  2UU9 C;  4BCA A;  4B3T C;  1HH2 P;  1BA3 A;  1PG4 A;  3PRO C;  4DCS A;  3J81 D;  1PU1 A;  3E7X A;  2QVX X;  1O9T A;  5BUS A;  4DV6 C;  2F4V C;  3L8C A;  3J80 D;  1EGA A;  1I94 C;  2PRO A;  1IBK C;  5K8F A;  4DR2 C;  2Z51 A;  3A25 A;  4JI8 C;  4L4Q A;  4RVO A;  3TR3 A;  2Y27 A;  3A26 A;  4JM1 A;  3CQ2 A;  4DV0 C;  1NYE A;  4JI1 C;  5A2Q D;  5DV9 A;  4DCU A;  3GR0 A;  1T5D X;  2V7B A;  1N32 C;  2CY1 A;  4L2Z A;  1XMQ C;  4DCT A;  2D28 C;  4PUH A;  4MTN A;  2HJG A;  4X65 C;  1ULT A;  2DYJ A;  3L95 X;  4DCV A;  3OTO C;  4LFA C;  3KXW A;  2PN2 A;  1P4E A;  4U5Y D;  4LF5 C;  4ISB A;  2PT7 G;  5LMN C;  4EAT A;  2MMA B;  1USP A;  3CQ3 A;  2OBV A;  1XHJ A;  4RM2 A;  1WH9 A;  1HNX C;  2NCL A;  4NXN C;  5BSM A;  4LFB C;  4LF6 C;  2M5H A;  1XRC A;  3NYR A;  3VNR A;  3I07 A;  5BUQ A;  1LQL A;  1FJG C;  1UWD A;  1RY2 A;  2P2B A;  4AQY C;  4DV4 C;  5BSR A;  2HHH C;  5ADZ A;  4DR6 C;  4K0K C;  3JAM D;  2UUB C;  2UXB C;  2MCQ A;  2E8E A;  5AE3 A;  4OX9 C;  4JI5 C;  4JI6 C;  3LUS A;  1N36 C;  3A4I A;  1VLA A;  3AF6 A;  4BBY A;  4NXM C;  2Y4O A;  1XS3 A;  4DR7 C;  4WS9 A;  4JI2 C;  4RM3 A;  2E8F A;  4JI0 C;  2ATW A;  2UUA C;  3UX3 A;  1HNW C;  3NPD A;  1O90 A;  2CXC A;  2OPL B;  5K85 A;  4B3S C;  3I08 A;  4PZP A;  4GS5 A;  4DR1 C;  4LF9 C;  2KDN A;  4WV3 A;  3FCE A;  5CZV A;  2EGT A;  4X62 C;  4LF7 C;  1ML8 A;  4IR7 A;  3E7W A;  3H2T A;  3DHV A;  4YY3 C;  4DUZ C;  5LMU C;  5KYT A;  1ZB8 A;  4JV5 C;  2ZZM A;  4ZJZ A;  4BC9 A;  3EQ6 A;  3IEU A;  1IBL C;  3EER A;  2JNV A;  3LNV A;  4X66 C;  2UXD C;  5JRH A;  3GKU A;  4HPV A;  4LFC C;  2MM9 A;  1V60 A;  1TH5 A;  1UKK A;  2E7G A;  1WCJ A;  4KTV A;  2OO4 A;  1JOS A;  2D27 A;  2VSQ A; 
#chains in the Genus database with same CATH homology
 5E7Q A;  1XRA A;  1N2F A;  2QL8 A;  5KEI A;  4PHT A;  1MXA A;  2BH1 X;  4DR5 C;  5A1I A;  2E5L C;  4OYC A;  3T1Y C;  1N33 C;  4ZLP A;  4B3M C;  1USP B;  3IML A;  4IZ6 A;  4DG8 A;  4GKK C;  2VQE C;  1IBM C;  5BUR A;  3A9U A;  3B7W A;  4DUY C;  1KKG A;  5H9U A;  1WF3 A;  3VNQ A;  3TUF A;  2D1R A;  2E0G A;  1V25 A;  4L7I A;  2WD9 A;  2QVY X;  1V26 A;  3IPL A;  1K0R A;  5T8T A;  2ZM6 C;  2XR1 A;  3CW8 X;  2P20 A;  1P7L A;  1XNR C;  3G7S A;  3UZ0 A;  3CW9 A;  4DR4 C;  4NDN A;  2E8C A;  2P2M A;  1HNZ C;  2WP0 C;  3TDE A;  3SO4 A;  4LF8 C;  4I9F A;  4RLQ A;  4DV5 C;  4ODJ A;  2VZE A;  3PES A;  4GXR A;  5KYV A;  2YWC A;  3N54 B;  1MD9 A;  4DV3 C;  1LCI A;  1T5H X;  1YJ7 A;  1MXC A;  4D56 A;  3FCC A;  4GXQ A;  4D4I A;  4XX2 A;  1AMU A;  4LE5 A;  3RG2 A;  4X64 C;  1L2F A;  2P02 A;  5AE2 A;  4I9G A;  5BSV A;  1XMO C;  1HR0 C;  3R9W A;  1XNQ C;  4RMN A;  4DR3 C;  5A1G A;  1J5E C;  1O93 A;  4KHP C;  1FUG A;  4OXI A;  4DV7 C;  2ASB A;  4JI4 C;  3GPC A;  1PA4 A;  2YWB A;  3DAY A;  1O92 A;  3TQI A;  5BST A;  4JI7 C;  3C5E A;  3NI2 A;  4GKJ C;  2DPL A;  4RLF A;  4NOZ A;  4YHH C;  5GTD A;  4BC7 A;  5CZX A;  4B3R C;  3LAX A;  2P2J A;  5IFI A;  4JI3 C;  3CJE A;  4DV1 C;  2AYA A;  4K0B A;  2YCB A;  4KTT A;  1PG3 A;  1QWI A;  5BSW A;  2P2F A;  4G36 A;  1MXB A;  2BJO A;  4LF4 C;  5FLX D;  3A9V A;  1MDF A;  2D1T A;  4FUT A;  5A19 A;  2ONF A;  4MH4 A;  4FTF A;  4FUQ A;  4G1I A;  3R44 A;  2QW0 X;  4BSZ A;  4R1L A;  1MDB A;  2KZF A;  3ETC A;  3AF5 A;  3UOW A;  2JMP A;  5T8S A;  3LGX A;  1MKY A;  3GR1 A;  2Y4N A;  4G37 A;  4DG9 A;  4R1M A;  4TPS B;  2VQF C;  1GPM A;  4PRO C;  3NYQ A;  4R0M A;  2D1Q A;  2QVZ X;  5IT9 D;  4RVN A;  4D57 A;  3ETO A;  5BSU A;  5BR8 C;  2OPL A;  3RV2 A;  3PBK A;  2UXC C;  3R9X A;  1XRB A;  3VNS A;  2P2Q A;  3N2Q A;  3T1H C;  2D7V A;  1QM4 A;  3DLP X;  5AE1 A;  5IWA C;  4DV2 C;  3S82 A;  2UUC C;  1N34 C;  4JYA C;  1ZB9 A;  1RG9 A;  3IEV A;  4D4G A;  2D1S A;  2UU9 C;  4BCA A;  4B3T C;  1HH2 P;  1BA3 A;  1PG4 A;  3PRO C;  4DCS A;  3J81 D;  3E7X A;  2QVX X;  1O9T A;  5BUS A;  4DV6 C;  2F4V C;  3L8C A;  3J80 D;  1EGA A;  1I94 C;  2PRO A;  1IBK C;  5K8F A;  4DR2 C;  4JI8 C;  4L4Q A;  4RVO A;  2Y27 A;  4JM1 A;  4DV0 C;  1NYE A;  4JI1 C;  5A2Q D;  5DV9 A;  4DCU A;  3GR0 A;  1T5D X;  2V7B A;  1N32 C;  2CY1 A;  4L2Z A;  1XMQ C;  4DCT A;  2D28 C;  4MTN A;  2HJG A;  4X65 C;  1ULT A;  2DYJ A;  3L95 X;  4DCV A;  3OTO C;  4LFA C;  3KXW A;  2PN2 A;  4U5Y D;  4LF5 C;  4ISB A;  2PT7 G;  5LMN C;  4EAT A;  1USP A;  2OBV A;  4RM2 A;  1WH9 A;  1HNX C;  4NXN C;  5BSM A;  4LFB C;  4LF6 C;  1XRC A;  3NYR A;  3VNR A;  3I07 A;  5BUQ A;  1LQL A;  1FJG C;  1RY2 A;  2P2B A;  4AQY C;  4DV4 C;  5BSR A;  2HHH C;  5ADZ A;  4DR6 C;  4K0K C;  3JAM D;  2UUB C;  2UXB C;  2E8E A;  5AE3 A;  4OX9 C;  4JI5 C;  4JI6 C;  3LUS A;  1N36 C;  3A4I A;  1VLA A;  3AF6 A;  4BBY A;  4NXM C;  2Y4O A;  4DR7 C;  4WS9 A;  4JI2 C;  4RM3 A;  2E8F A;  4JI0 C;  2ATW A;  2UUA C;  1HNW C;  3NPD A;  1O90 A;  2CXC A;  2OPL B;  5K85 A;  4B3S C;  3I08 A;  4PZP A;  4GS5 A;  4DR1 C;  4LF9 C;  3FCE A;  4WV3 A;  5CZV A;  4X62 C;  2EGT A;  4LF7 C;  1ML8 A;  4IR7 A;  3E7W A;  3H2T A;  3DHV A;  4YY3 C;  4DUZ C;  5LMU C;  5KYT A;  1ZB8 A;  4JV5 C;  4ZJZ A;  4BC9 A;  3EQ6 A;  3IEU A;  1IBL C;  3EER A;  3LNV A;  4X66 C;  2UXD C;  5JRH A;  3GKU A;  4HPV A;  4LFC C;  1UKK A;  2E7G A;  4KTV A;  2OO4 A;  1JOS A;  2D27 A;  2VSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...