2D7VA

Structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
155
structure length
155
Chain Sequence
SMSEHSAIVTWKRKDSEAFTDNQYSRAHTWEFDGGSKILASASPHVVPVPLSVEANVDPEEAFVAALSSCHMLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKMHHLAHENCFIANSVETEVVTEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical protein VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein VCA0330
total genus 32
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d7vA00
4LF4C 4LFCC 4DV1C 2UUAC 1NYEA 1ZB9A 3CJEA 2CY1A 2ATWA 2ONFA 1J5EC 1UKKA 1WH9A 2JMPA 4DUZC 4JI2C 4GKKC 4DV7C 3LUSA 4GKJC 4DR5C 2OPLB 3OTOC 2PN2A 5LMNC 2D7VA 3AF5A 2E7GA 4NOZA 1XMOC 3EERA 2UXBC 1USPB 2HHHC 2YCBA 4LF9C 1XNRC 2UUBC 2XR1A 3R9XA 3IEVA 1N32C 3I07A 2E8FA 1HNWC 4B3MC 1I94C 4B3RC 1EGAA 3IEUA 1N34C 2UU9C 4JV5C 4K0KC 2PT7G 4JI3C 4DR3C 4X66C 4JI7C 1USPA 4MTNA 1VLAA 4DR6C 2DYJA 1L2FA 2E8EA 4DV5C 4DR7C 1N2FA 2HJGA 4DUYC 4DV3C 1XMQC 2UXDC 2E8CA 3J80D 3R9WA 1LQLA 3T1HC 2VQFC 2CXCA 1K0RA 5IT9D 3JAMD 4BSZA 4MH4A 4OX9C 3J81D 1KKGA 4DR1C 2OPLA 1HH2P 1IBLC 2EGTA 4DCVA 4LFAC 2ZM6C 1ZB8A 4DV0C 4DV6C 5A2QD 4DR2C 1ML8A 2ASBA 4YY3C 1HNZC 1IBKC 1WF3A 2KZFA 4JI5C 5FLXD 3GKUA 4XX2A 5IWAC 2E5LC 3T1YC 4DV4C 2F4VC 1XNQC 2QL8A 2BJOA 2UXCC 4B3SC 4JI8C 4JYAC 4LFBC 2VQEC 1QWIA 4NXNC 1HR0C 1HNXC 4B3TC 1MKYA 4LF6C 4LF7C 1JOSA 4JI4C 1PA4A 4NXMC 4X64C 4X62C 4LF8C 4JI6C 1IBMC 1FJGC 4AQYC 4LF5C 4X65C 5LMUC 4DCUA 4JI1C 4DCTA 4JI0C 2UUCC 4YHHC 4KHPC 5BR8C 4DR4C 4DV2C 1N36C 4DCSA 3AF6A 1N33C
chains in the Genus database with same CATH superfamily
4LFCC 2P02A 2ZZNA 2UUAC 2DHMA 2VSQA 4D4IA 4IZ6A 5ADZA 1WH9A 4RLQA 4GKKC 5KYVA 3LNVA 3EQ6A 2M5OA 2YWBA 4TPSB 3AF5A 5DV9A 3ETOA 4WS9A 2HHHC 4FTFA 5BURA 2XR1A 3R9XA 3RG2A 2KDNA 4B3RC 1EGAA 2BH1X 4I9FA 4K0KC 2PT7G 5KEIA 3UEBA 1RY2A 4JI7C 1USPA 4MTNA 1VLAA 4DR6C 2DYJA 4PUIA 4RM3A 1T5HX 4DV5C 4DR7C 1O93A 1XMQC 4BSZA 4OX9C 2OPLA 1WCJA 1HH2P 2MM9A 4G1IA 3PROC 2EGTA 4OYCA 4HPVA 1M6XC 1XRBA 3CQ3A 3N54B 1BA3A 1P4EA 1UWDA 1RG9A 3C5EA 2P2FA 1MDBA 3FCEA 3GKUA 4RMNA 5IWAC 3DLPX 2QW0X 3LAXA 2Y4NA 5BSVA 2BJOA 3PBKA 4LFBC 2VQEC 1QWIA 1HR0C 4B3TC 4LF7C 1JOSA 4BC7A 4NXMC 5BUQA 4X62C 4D4GA 4LF8C 2AYAA 4JI6C 4LF5C 3S82A 4K0BA 4KTTA 1YJ7A 1NY8A 1ULTA 4G37A 5BR8C 2D1QA 4DR4C 3N2QA 4GKJC 4LF4C 3NYRA 5E7QA 1NYEA 3IMLA 4L4QA 2ATWA 2ONFA 3A4IA 4JI2C 2M5HA 4DR5C 2OPLB 3A25A 3OTOC 2PN2A 1FUGA 2E7GA 1XMOC 1PG3A 1LCIA 3RV2A 1PU1A 3IEVA 1MD9A 2E8FA 4L2ZA 1TH5A 1XS3A 2PROA 4PUHA 4JI3C 4DR3C 3CW9A 2MCQA 3GR0A 5AE3A 2MMAB 1N2FA 4DUYC 3TR3A 1PG4A 2E8CA 1O90A 1K0RA 4MH4A 3J81D 1M6XA 5AE1A 5T8TA 5JRHA 4RVNA 4ZJZA 4LFAC 2ZM6C 3PESA 4DR2C 3LGXA 3UZ0A 3KXWA 3H2TA 4JI5C 1XHJA 5FLXD 2YWCA 3K6RA 2E5LC 2F4VC 1XNQC 4BC9A 4JI8C 3CQ1A 4R1LA 4KTVA 2E0GA 1HNXC 1MKYA 4LF6C 1PA4A 1P4EC 1MXBA 2OO4A 1IBMC 1FJGC 2QVZX 5LMUC 3GPCA 3SO4A 4DCSA 1IBLC 4DV1C 4RLFA 5AE2A 1ZB9A 3CJEA 2CY1A 5BSWA 1UKKA 3R44A 4DV7C 3VNQA 3L8CA 3A26A 4IR7A 4ZLPA 1GPMA 4NOZA 4ODJA 1IB8A 3E7WA 2UXBC 5BSRA 1USPB 1AMUA 2D1TA 4D57A 3E7XA 3I07A 4B3MC 4DG8A 2P2BA 5LCIA 1I94C 5CZXA 3TDEA 4X66C 2NCLA 4L7IA 2E8EA 2YX1A 4DV3C 3J80D 3T1HC 2VQFC 3JAMD 4GXRA 4WV3A 5KYTA 4BBYA 4DR1C 1O9TA 5H9UA 5BUSA 1ZB8A 4DV0C 3UX2A 1ML8A 1HNZC 5K85A 1WF3A 4R0MA 2KZFA 3VNSA 1QM4A 3TUFA 4FUTA 3O2EA 1T5DX 4DV4C 4OXIA 2CU6A 2D1SA 4PZPA 4JYAC 1XRAA 1V60A 4JI4C 4X64C 4G36A 2Y4OA 5CZVA 5BSTA 2Z51A 4BCAA 4JI1C 2QVYX 4PHTA 2UUCC 4U5YD 4KHPC 4RM2A 4R1MA 3FCCA 4DV2C 1N36C 1N33C 3B7WA 4NDNA 4PROC 3A9VA 2JNVA 2P2JA 3DHVA 3G7SA 3AY0A 2KZ0A 1J5EC 2JMPA 4DUZC 2WD9A 3LUSA 3NYQA 5LMNC 2D7VA 2D28C 2D1RA 3EERA 2DPLA 4LF9C 2YCBA 3NPDA 5A1GA 1XNRC 2WP0C 2UUBC 1N32C 1HNWC 4FUQA 3ETCA 3IEUA 3I08A 1N34C 2UU9C 4JV5C 2V7BA 2Y27A 1O92A 4EATA 1MXAA 1V25A 4RVOA 1L2FA 2HJGA 2P2QA 4JM1A 2ZZMA 5IFIA 2UXDC 1LQLA 2CXCA 1MXCA 5IT9D 1MDFA 3CW8X 4ISBA 1KKGA 2D27A 1FLOA 1V26A 5T8SA 3TQIA 4DCVA 3CQ2A 3DAYA 4DV6C 5A2QD 2ASBA 5A19A 4YY3C 1IBKC 5BSMA 4PUGA 4DG9A 1P7LA 4XX2A 3T1YC 4I9GA 4GS5A 3IPLA 5BSUA 2QL8A 2UXCC 4B3SC 2P20A 4NXNC 3L95X 5A1IA 3NI2A 3A9UA 2VZEA 3LNOA 3UOWA 4D56A 1XRCA 5GTDA 2OBVA 1VEHA 4AQYC 3VNRA 3GR1A 4X65C 2QVXX 4DCUA 4DCTA 4JI0C 4YHHC 3UX3A 5K8FA 2P2MA 4LE5A 4GXQA 3R9WA 3AF6A
chains in the Genus database with same CATH topology
4LFCC 2P02A 2UUAC 2VSQA 4D4IA 4IZ6A 5ADZA 1WH9A 4RLQA 4GKKC 5KYVA 3LNVA 3EQ6A 2YWBA 4TPSB 3AF5A 5DV9A 3ETOA 4WS9A 2HHHC 4FTFA 5BURA 2XR1A 3R9XA 3RG2A 4B3RC 1EGAA 2BH1X 4I9FA 4K0KC 2PT7G 5KEIA 1RY2A 4JI7C 1USPA 4MTNA 1VLAA 4DR6C 2DYJA 4RM3A 1T5HX 4DV5C 4DR7C 1O93A 1XMQC 4BSZA 4OX9C 2OPLA 1HH2P 4G1IA 3PROC 2EGTA 4OYCA 4HPVA 1XRBA 3N54B 1BA3A 1RG9A 3C5EA 2P2FA 1MDBA 3FCEA 3GKUA 4RMNA 5IWAC 3DLPX 2QW0X 3LAXA 2Y4NA 5BSVA 2BJOA 3PBKA 4LFBC 2VQEC 1QWIA 1HR0C 4B3TC 4LF7C 1JOSA 4BC7A 4NXMC 5BUQA 4X62C 4D4GA 4LF8C 2AYAA 4JI6C 4LF5C 3S82A 4K0BA 4KTTA 1YJ7A 1ULTA 4G37A 5BR8C 2D1QA 4DR4C 3N2QA 4GKJC 4LF4C 3NYRA 5E7QA 1NYEA 3IMLA 4L4QA 2ATWA 2ONFA 3A4IA 4JI2C 4DR5C 2OPLB 3OTOC 2PN2A 1FUGA 2E7GA 1XMOC 1PG3A 1LCIA 3RV2A 3IEVA 1MD9A 2E8FA 4L2ZA 2PROA 4JI3C 4DR3C 3CW9A 3GR0A 5AE3A 1N2FA 4DUYC 1PG4A 2E8CA 1O90A 1K0RA 4MH4A 3J81D 5AE1A 5T8TA 5JRHA 4RVNA 4ZJZA 4LFAC 2ZM6C 3PESA 4DR2C 3LGXA 3UZ0A 3KXWA 3H2TA 4JI5C 5FLXD 2YWCA 2E5LC 2F4VC 1XNQC 4BC9A 4JI8C 4R1LA 4KTVA 2E0GA 1HNXC 1MKYA 4LF6C 1PA4A 1MXBA 2OO4A 1IBMC 1FJGC 2QVZX 5LMUC 3GPCA 3SO4A 4DCSA 1IBLC 4DV1C 4RLFA 5AE2A 1ZB9A 3CJEA 2CY1A 5BSWA 1UKKA 3R44A 4DV7C 3VNQA 3L8CA 4IR7A 4ZLPA 1GPMA 4NOZA 4ODJA 3E7WA 2UXBC 5BSRA 1USPB 1AMUA 2D1TA 4D57A 3E7XA 3I07A 4B3MC 4DG8A 2P2BA 1I94C 5CZXA 3TDEA 4X66C 4L7IA 2E8EA 4DV3C 3J80D 3T1HC 2VQFC 3JAMD 4GXRA 4WV3A 5KYTA 4BBYA 4DR1C 1O9TA 5H9UA 5BUSA 1ZB8A 4DV0C 1ML8A 1HNZC 5K85A 1WF3A 4R0MA 2KZFA 3VNSA 1QM4A 3TUFA 4FUTA 1T5DX 4DV4C 4OXIA 2D1SA 4PZPA 4JYAC 1XRAA 4JI4C 4X64C 4G36A 2Y4OA 5CZVA 5BSTA 4BCAA 4JI1C 2QVYX 4PHTA 2UUCC 4U5YD 4KHPC 4RM2A 4R1MA 3FCCA 4DV2C 1N36C 1N33C 3B7WA 4NDNA 4PROC 3A9VA 2P2JA 3G7SA 3DHVA 1J5EC 2JMPA 4DUZC 2WD9A 3LUSA 3NYQA 5LMNC 2D7VA 2D28C 2D1RA 3EERA 2DPLA 4LF9C 2YCBA 3NPDA 5A1GA 1XNRC 2WP0C 2UUBC 1N32C 1HNWC 4FUQA 3ETCA 3IEUA 3I08A 1N34C 2UU9C 4JV5C 2V7BA 2Y27A 1O92A 4EATA 1MXAA 1V25A 4RVOA 1L2FA 2HJGA 2P2QA 4JM1A 5IFIA 2UXDC 1LQLA 2CXCA 1MXCA 5IT9D 1MDFA 3CW8X 4ISBA 1KKGA 2D27A 1V26A 5T8SA 3TQIA 4DCVA 3DAYA 4DV6C 5A2QD 2ASBA 5A19A 4YY3C 1IBKC 5BSMA 4DG9A 1P7LA 4XX2A 3T1YC 4I9GA 4GS5A 3IPLA 5BSUA 2QL8A 2UXCC 4B3SC 2P20A 4NXNC 3L95X 5A1IA 3NI2A 3A9UA 2VZEA 3UOWA 4D56A 1XRCA 5GTDA 2OBVA 4AQYC 3VNRA 3GR1A 4X65C 2QVXX 4DCUA 4DCTA 4JI0C 4YHHC 5K8FA 2P2MA 4LE5A 4GXQA 3R9WA 3AF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 C;  4LFC C;  4DV1 C;  2UUA C;  1NYE A;  1ZB9 A;  3CJE A;  2CY1 A;  2ATW A;  2ONF A;  1J5E C;  1UKK A;  1WH9 A;  2JMP A;  4DUZ C;  4JI2 C;  4GKK C;  4DV7 C;  3LUS A;  4GKJ C;  4DR5 C;  2OPL B;  3OTO C;  2PN2 A;  5LMN C;  2D7V A;  3AF5 A;  2E7G A;  4NOZ A;  1XMO C;  3EER A;  2UXB C;  1USP B;  2HHH C;  2YCB A;  4LF9 C;  1XNR C;  2UUB C;  2XR1 A;  3R9X A;  3IEV A;  1N32 C;  3I07 A;  2E8F A;  1HNW C;  4B3M C;  1I94 C;  4B3R C;  1EGA A;  3IEU A;  1N34 C;  2UU9 C;  4JV5 C;  4K0K C;  2PT7 G;  4JI3 C;  4DR3 C;  4X66 C;  4JI7 C;  1USP A;  4MTN A;  1VLA A;  4DR6 C;  2DYJ A;  1L2F A;  2E8E A;  4DV5 C;  4DR7 C;  1N2F A;  2HJG A;  4DUY C;  4DV3 C;  1XMQ C;  2UXD C;  2E8C A;  3J80 D;  3R9W A;  1LQL A;  3T1H C;  2VQF C;  2CXC A;  1K0R A;  5IT9 D;  3JAM D;  4BSZ A;  4MH4 A;  4OX9 C;  3J81 D;  1KKG A;  4DR1 C;  2OPL A;  1HH2 P;  1IBL C;  2EGT A;  4DCV A;  4LFA C;  2ZM6 C;  1ZB8 A;  4DV0 C;  4DV6 C;  5A2Q D;  4DR2 C;  1ML8 A;  2ASB A;  4YY3 C;  1HNZ C;  1IBK C;  1WF3 A;  2KZF A;  4JI5 C;  5FLX D;  3GKU A;  4XX2 A;  5IWA C;  2E5L C;  3T1Y C;  4DV4 C;  2F4V C;  1XNQ C;  2QL8 A;  2BJO A;  2UXC C;  4B3S C;  4JI8 C;  4JYA C;  4LFB C;  2VQE C;  1QWI A;  4NXN C;  1HR0 C;  1HNX C;  4B3T C;  1MKY A;  4LF6 C;  4LF7 C;  1JOS A;  4JI4 C;  1PA4 A;  4NXM C;  4X64 C;  4X62 C;  4LF8 C;  4JI6 C;  1IBM C;  1FJG C;  4AQY C;  4LF5 C;  4X65 C;  5LMU C;  4DCU A;  4JI1 C;  4DCT A;  4JI0 C;  2UUC C;  4YHH C;  4KHP C;  5BR8 C;  4DR4 C;  4DV2 C;  1N36 C;  4DCS A;  3AF6 A;  1N33 C; 
#chains in the Genus database with same CATH topology
 4LFC C;  2P02 A;  2ZZN A;  2UUA C;  2DHM A;  2VSQ A;  4D4I A;  4IZ6 A;  5ADZ A;  1WH9 A;  4RLQ A;  4GKK C;  5KYV A;  3LNV A;  3EQ6 A;  2M5O A;  2YWB A;  4TPS B;  3AF5 A;  5DV9 A;  3ETO A;  4WS9 A;  2HHH C;  4FTF A;  5BUR A;  2XR1 A;  3R9X A;  3RG2 A;  2KDN A;  4B3R C;  1EGA A;  2BH1 X;  4I9F A;  4K0K C;  2PT7 G;  5KEI A;  3UEB A;  1RY2 A;  4JI7 C;  1USP A;  4MTN A;  1VLA A;  4DR6 C;  2DYJ A;  4PUI A;  4RM3 A;  1T5H X;  4DV5 C;  4DR7 C;  1O93 A;  1XMQ C;  4BSZ A;  4OX9 C;  2OPL A;  1WCJ A;  1HH2 P;  2MM9 A;  4G1I A;  3PRO C;  2EGT A;  4OYC A;  4HPV A;  1M6X C;  1XRB A;  3CQ3 A;  3N54 B;  1BA3 A;  1P4E A;  1UWD A;  1RG9 A;  3C5E A;  2P2F A;  1MDB A;  3FCE A;  3GKU A;  4RMN A;  5IWA C;  3DLP X;  2QW0 X;  3LAX A;  2Y4N A;  5BSV A;  2BJO A;  3PBK A;  4LFB C;  2VQE C;  1QWI A;  1HR0 C;  4B3T C;  4LF7 C;  1JOS A;  4BC7 A;  4NXM C;  5BUQ A;  4X62 C;  4D4G A;  4LF8 C;  2AYA A;  4JI6 C;  4LF5 C;  3S82 A;  4K0B A;  4KTT A;  1YJ7 A;  1NY8 A;  1ULT A;  4G37 A;  5BR8 C;  2D1Q A;  4DR4 C;  3N2Q A;  4GKJ C;  4LF4 C;  3NYR A;  5E7Q A;  1NYE A;  3IML A;  4L4Q A;  2ATW A;  2ONF A;  3A4I A;  4JI2 C;  2M5H A;  4DR5 C;  2OPL B;  3A25 A;  3OTO C;  2PN2 A;  1FUG A;  2E7G A;  1XMO C;  1PG3 A;  1LCI A;  3RV2 A;  1PU1 A;  3IEV A;  1MD9 A;  2E8F A;  4L2Z A;  1TH5 A;  1XS3 A;  2PRO A;  4PUH A;  4JI3 C;  4DR3 C;  3CW9 A;  2MCQ A;  3GR0 A;  5AE3 A;  2MMA B;  1N2F A;  4DUY C;  3TR3 A;  1PG4 A;  2E8C A;  1O90 A;  1K0R A;  4MH4 A;  3J81 D;  1M6X A;  5AE1 A;  5T8T A;  5JRH A;  4RVN A;  4ZJZ A;  4LFA C;  2ZM6 C;  3PES A;  4DR2 C;  3LGX A;  3UZ0 A;  3KXW A;  3H2T A;  4JI5 C;  1XHJ A;  5FLX D;  2YWC A;  3K6R A;  2E5L C;  2F4V C;  1XNQ C;  4BC9 A;  4JI8 C;  3CQ1 A;  4R1L A;  4KTV A;  2E0G A;  1HNX C;  1MKY A;  4LF6 C;  1PA4 A;  1P4E C;  1MXB A;  2OO4 A;  1IBM C;  1FJG C;  2QVZ X;  5LMU C;  3GPC A;  3SO4 A;  4DCS A;  1IBL C;  4DV1 C;  4RLF A;  5AE2 A;  1ZB9 A;  3CJE A;  2CY1 A;  5BSW A;  1UKK A;  3R44 A;  4DV7 C;  3VNQ A;  3L8C A;  3A26 A;  4IR7 A;  4ZLP A;  1GPM A;  4NOZ A;  4ODJ A;  1IB8 A;  3E7W A;  2UXB C;  5BSR A;  1USP B;  1AMU A;  2D1T A;  4D57 A;  3E7X A;  3I07 A;  4B3M C;  4DG8 A;  2P2B A;  5LCI A;  1I94 C;  5CZX A;  3TDE A;  4X66 C;  2NCL A;  4L7I A;  2E8E A;  2YX1 A;  4DV3 C;  3J80 D;  3T1H C;  2VQF C;  3JAM D;  4GXR A;  4WV3 A;  5KYT A;  4BBY A;  4DR1 C;  1O9T A;  5H9U A;  5BUS A;  1ZB8 A;  4DV0 C;  3UX2 A;  1ML8 A;  1HNZ C;  5K85 A;  1WF3 A;  4R0M A;  2KZF A;  3VNS A;  1QM4 A;  3TUF A;  4FUT A;  3O2E A;  1T5D X;  4DV4 C;  4OXI A;  2CU6 A;  2D1S A;  4PZP A;  4JYA C;  1XRA A;  1V60 A;  4JI4 C;  4X64 C;  4G36 A;  2Y4O A;  5CZV A;  5BST A;  2Z51 A;  4BCA A;  4JI1 C;  2QVY X;  4PHT A;  2UUC C;  4U5Y D;  4KHP C;  4RM2 A;  4R1M A;  3FCC A;  4DV2 C;  1N36 C;  1N33 C;  3B7W A;  4NDN A;  4PRO C;  3A9V A;  2JNV A;  2P2J A;  3DHV A;  3G7S A;  3AY0 A;  2KZ0 A;  1J5E C;  2JMP A;  4DUZ C;  2WD9 A;  3LUS A;  3NYQ A;  5LMN C;  2D7V A;  2D28 C;  2D1R A;  3EER A;  2DPL A;  4LF9 C;  2YCB A;  3NPD A;  5A1G A;  1XNR C;  2WP0 C;  2UUB C;  1N32 C;  1HNW C;  4FUQ A;  3ETC A;  3IEU A;  3I08 A;  1N34 C;  2UU9 C;  4JV5 C;  2V7B A;  2Y27 A;  1O92 A;  4EAT A;  1MXA A;  1V25 A;  4RVO A;  1L2F A;  2HJG A;  2P2Q A;  4JM1 A;  2ZZM A;  5IFI A;  2UXD C;  1LQL A;  2CXC A;  1MXC A;  5IT9 D;  1MDF A;  3CW8 X;  4ISB A;  1KKG A;  2D27 A;  1FLO A;  1V26 A;  5T8S A;  3TQI A;  4DCV A;  3CQ2 A;  3DAY A;  4DV6 C;  5A2Q D;  2ASB A;  5A19 A;  4YY3 C;  1IBK C;  5BSM A;  4PUG A;  4DG9 A;  1P7L A;  4XX2 A;  3T1Y C;  4I9G A;  4GS5 A;  3IPL A;  5BSU A;  2QL8 A;  2UXC C;  4B3S C;  2P20 A;  4NXN C;  3L95 X;  5A1I A;  3NI2 A;  3A9U A;  2VZE A;  3LNO A;  3UOW A;  4D56 A;  1XRC A;  5GTD A;  2OBV A;  1VEH A;  4AQY C;  3VNR A;  3GR1 A;  4X65 C;  2QVX X;  4DCU A;  4DCT A;  4JI0 C;  4YHH C;  3UX3 A;  5K8F A;  2P2M A;  4LE5 A;  4GXQ A;  3R9W A;  3AF6 A; 
#chains in the Genus database with same CATH homology
 4LFC C;  2P02 A;  2UUA C;  2VSQ A;  4D4I A;  4IZ6 A;  5ADZ A;  1WH9 A;  4RLQ A;  4GKK C;  5KYV A;  3LNV A;  3EQ6 A;  2YWB A;  4TPS B;  3AF5 A;  5DV9 A;  3ETO A;  4WS9 A;  2HHH C;  4FTF A;  5BUR A;  2XR1 A;  3R9X A;  3RG2 A;  4B3R C;  1EGA A;  2BH1 X;  4I9F A;  4K0K C;  2PT7 G;  5KEI A;  1RY2 A;  4JI7 C;  1USP A;  4MTN A;  1VLA A;  4DR6 C;  2DYJ A;  4RM3 A;  1T5H X;  4DV5 C;  4DR7 C;  1O93 A;  1XMQ C;  4BSZ A;  4OX9 C;  2OPL A;  1HH2 P;  4G1I A;  3PRO C;  2EGT A;  4OYC A;  4HPV A;  1XRB A;  3N54 B;  1BA3 A;  1RG9 A;  3C5E A;  2P2F A;  1MDB A;  3FCE A;  3GKU A;  4RMN A;  5IWA C;  3DLP X;  2QW0 X;  3LAX A;  2Y4N A;  5BSV A;  2BJO A;  3PBK A;  4LFB C;  2VQE C;  1QWI A;  1HR0 C;  4B3T C;  4LF7 C;  1JOS A;  4BC7 A;  4NXM C;  5BUQ A;  4X62 C;  4D4G A;  4LF8 C;  2AYA A;  4JI6 C;  4LF5 C;  3S82 A;  4K0B A;  4KTT A;  1YJ7 A;  1ULT A;  4G37 A;  5BR8 C;  2D1Q A;  4DR4 C;  3N2Q A;  4GKJ C;  4LF4 C;  3NYR A;  5E7Q A;  1NYE A;  3IML A;  4L4Q A;  2ATW A;  2ONF A;  3A4I A;  4JI2 C;  4DR5 C;  2OPL B;  3OTO C;  2PN2 A;  1FUG A;  2E7G A;  1XMO C;  1PG3 A;  1LCI A;  3RV2 A;  3IEV A;  1MD9 A;  2E8F A;  4L2Z A;  2PRO A;  4JI3 C;  4DR3 C;  3CW9 A;  3GR0 A;  5AE3 A;  1N2F A;  4DUY C;  1PG4 A;  2E8C A;  1O90 A;  1K0R A;  4MH4 A;  3J81 D;  5AE1 A;  5T8T A;  5JRH A;  4RVN A;  4ZJZ A;  4LFA C;  2ZM6 C;  3PES A;  4DR2 C;  3LGX A;  3UZ0 A;  3KXW A;  3H2T A;  4JI5 C;  5FLX D;  2YWC A;  2E5L C;  2F4V C;  1XNQ C;  4BC9 A;  4JI8 C;  4R1L A;  4KTV A;  2E0G A;  1HNX C;  1MKY A;  4LF6 C;  1PA4 A;  1MXB A;  2OO4 A;  1IBM C;  1FJG C;  2QVZ X;  5LMU C;  3GPC A;  3SO4 A;  4DCS A;  1IBL C;  4DV1 C;  4RLF A;  5AE2 A;  1ZB9 A;  3CJE A;  2CY1 A;  5BSW A;  1UKK A;  3R44 A;  4DV7 C;  3VNQ A;  3L8C A;  4IR7 A;  4ZLP A;  1GPM A;  4NOZ A;  4ODJ A;  3E7W A;  2UXB C;  5BSR A;  1USP B;  1AMU A;  2D1T A;  4D57 A;  3E7X A;  3I07 A;  4B3M C;  4DG8 A;  2P2B A;  1I94 C;  5CZX A;  3TDE A;  4X66 C;  4L7I A;  2E8E A;  4DV3 C;  3J80 D;  3T1H C;  2VQF C;  3JAM D;  4GXR A;  4WV3 A;  5KYT A;  4BBY A;  4DR1 C;  1O9T A;  5H9U A;  5BUS A;  1ZB8 A;  4DV0 C;  1ML8 A;  1HNZ C;  5K85 A;  1WF3 A;  4R0M A;  2KZF A;  3VNS A;  1QM4 A;  3TUF A;  4FUT A;  1T5D X;  4DV4 C;  4OXI A;  2D1S A;  4PZP A;  4JYA C;  1XRA A;  4JI4 C;  4X64 C;  4G36 A;  2Y4O A;  5CZV A;  5BST A;  4BCA A;  4JI1 C;  2QVY X;  4PHT A;  2UUC C;  4U5Y D;  4KHP C;  4RM2 A;  4R1M A;  3FCC A;  4DV2 C;  1N36 C;  1N33 C;  3B7W A;  4NDN A;  4PRO C;  3A9V A;  2P2J A;  3G7S A;  3DHV A;  1J5E C;  2JMP A;  4DUZ C;  2WD9 A;  3LUS A;  3NYQ A;  5LMN C;  2D7V A;  2D28 C;  2D1R A;  3EER A;  2DPL A;  4LF9 C;  2YCB A;  3NPD A;  5A1G A;  1XNR C;  2WP0 C;  2UUB C;  1N32 C;  1HNW C;  4FUQ A;  3ETC A;  3IEU A;  3I08 A;  1N34 C;  2UU9 C;  4JV5 C;  2V7B A;  2Y27 A;  1O92 A;  4EAT A;  1MXA A;  1V25 A;  4RVO A;  1L2F A;  2HJG A;  2P2Q A;  4JM1 A;  5IFI A;  2UXD C;  1LQL A;  2CXC A;  1MXC A;  5IT9 D;  1MDF A;  3CW8 X;  4ISB A;  1KKG A;  2D27 A;  1V26 A;  5T8S A;  3TQI A;  4DCV A;  3DAY A;  4DV6 C;  5A2Q D;  2ASB A;  5A19 A;  4YY3 C;  1IBK C;  5BSM A;  4DG9 A;  1P7L A;  4XX2 A;  3T1Y C;  4I9G A;  4GS5 A;  3IPL A;  5BSU A;  2QL8 A;  2UXC C;  4B3S C;  2P20 A;  4NXN C;  3L95 X;  5A1I A;  3NI2 A;  3A9U A;  2VZE A;  3UOW A;  4D56 A;  1XRC A;  5GTD A;  2OBV A;  4AQY C;  3VNR A;  3GR1 A;  4X65 C;  2QVX X;  4DCU A;  4DCT A;  4JI0 C;  4YHH C;  5K8F A;  2P2M A;  4LE5 A;  4GXQ A;  3R9W A;  3AF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...