2D7VA

Structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
155
structure length
155
Chain Sequence
SMSEHSAIVTWKRKDSEAFTDNQYSRAHTWEFDGGSKILASASPHVVPVPLSVEANVDPEEAFVAALSSCHMLVFLSIAAKQRYLVESYTDNAVGILGKNSKGKTSVTKVVLRPQVVFSGTSKPTLQQLEKMHHLAHENCFIANSVETEVVTEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein VCA0330
publication title Hypothetical protein VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar eltor
total genus 32
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2d7vA00
4JI5C 2ASBA 4DR4C 2OPLB 4DR5C 3R9WA 3IEUA 3CJEA 1XMQC 1ZB8A 4LFAC 2DYJA 2ONFA 2ZM6C 1N32C 3OTOC 4B3RC 4DUYC 2UXBC 3IEVA 2KZFA 3J80D 4DR3C 4DV0C 1HNZC 4NOZA 4DR7C 1MKYA 4YY3C 5IWAC 2HHHC 5BR8C 4JI1C 4DUZC 4JV5C 4DV5C 1IBMC 1WH9A 4YHHC 1JOSA 4DCSA 2UUCC 4DCTA 4X65C 4DV4C 3J81D 1USPB 5FLXD 2E8CA 4LFBC 2E7GA 1N36C 1NYEA 4DR6C 1L2FA 4DCUA 4DR1C 4JI3C 4AQYC 1XNRC 2VQFC 4K0KC 4X64C 4JYAC 4JI7C 3T1YC 2EGTA 3EERA 1QWIA 4GKJC 1UKKA 1PA4A 1LQLA 4JI4C 1HNXC 1KKGA 1IBKC 4B3SC 1WF3A 4X66C 1XNQC 2PT7G 2JMPA 4MH4A 5IT9D 2CXCA 4X62C 4JI2C 4LF4C 4DV3C 2UU9C 2XR1A 1ML8A 2YCBA 1HH2P 2VQEC 2BJOA 4DV6C 2ATWA 1HNWC 4NXNC 3LUSA 4LF9C 1XMOC 1N33C 4DV1C 1VLAA 2E8FA 2QL8A 2CY1A 4KHPC 4MTNA 1I94C 4LF7C 4DR2C 5LMUC 4LFCC 3R9XA 4XX2A 1K0RA 4B3MC 4DCVA 1FJGC 4LF6C 3AF6A 2OPLA 2E5LC 3AF5A 2UXCC 2D7VA 2UUAC 1USPA 1IBLC 3T1HC 5LMNC 4LF8C 1N2FA 4BSZA 4GKKC 1EGAA 2HJGA 1N34C 1J5EC 3GKUA 4JI8C 2E8EA 2UUBC 1HR0C 4B3TC 4DV7C 2F4VC 4NXMC 1ZB9A 3I07A 2UXDC 4JI6C 4LF5C 4OX9C 4JI0C 2PN2A 4DV2C 3JAMD 5A2QD
chains in the Genus database with same CATH superfamily
4HPVA 4TPSB 2ASBA 3DAYA 2D1QA 3IEUA 1MDFA 3SO4A 1T5HX 2QVYX 4DUYC 2UXBC 3J80D 5BURA 1RY2A 1NY8A 3CQ2A 2AYAA 4FTFA 4BC7A 2QVXX 4DUZC 3TUFA 3RG2A 4ZLPA 4EATA 1JOSA 5IFIA 5DV9A 4PUGA 3O2EA 4RM3A 3UEBA 1O93A 2D1RA 5K8FA 4JI3C 2VQFC 1QM4A 3CW8X 4WS9A 1P4EA 4D56A 3EERA 1QWIA 4BC9A 3UX3A 1PA4A 3LGXA 1HNXC 3UZ0A 4B3SC 5A19A 2JMPA 2CXCA 5CZXA 4JI2C 4LF4C 1XRAA 3L8CA 1PG4A 4BCAA 1XRBA 3UX2A 3TDEA 3A4IA 1T5DX 2QW0X 2DHMA 4MTNA 4XX2A 1K0RA 5BSTA 4FUQA 2ZZNA 3AF6A 5BUSA 1USPA 3T1HC 2MCQA 4BSZA 4GKKC 2MM9A 1EGAA 2HJGA 5BSRA 2E8EA 4B3TC 4NXMC 3CQ3A 4LF5C 2QVZX 4JI0C 1O9TA 3JAMD 1O92A 3TQIA 4DR4C 2OPLB 3RV2A 3CJEA 1XMQC 2DYJA 3FCCA 4PZPA 2ONFA 3KXWA 5A1IA 5AE2A 2D1TA 4I9FA 4B3RC 3NYQA 4WV3A 4DV0C 1HNZC 5KYTA 2BH1X 3NPDA 3PESA 1MKYA 4YY3C 5IWAC 3A9VA 4JI1C 4JV5C 1ULTA 3A9UA 2D28C 4DCSA 2D27A 4OYCA 2KZ0A 5BSMA 3LNOA 5FLXD 4NDNA 2E8CA 1GPMA 3N2QA 1NYEA 4DR6C 1L2FA 4DCUA 4OXIA 3ETCA 1XNRC 3DHVA 2P02A 3IMLA 4JYAC 4L4QA 3T1YC 4R1LA 3S82A 3NYRA 4GKJC 1LQLA 3CQ1A 1KKGA 1WF3A 4RLFA 5IT9D 2P2QA 4D4IA 2YCBA 1HH2P 2YWCA 2BJOA 2ATWA 1HNWC 3LUSA 2ZZMA 1YJ7A 4G36A 1VEHA 1N33C 5BSWA 4DV1C 3ETOA 2E8FA 3NI2A 4KHPC 1P4EC 4LFCC 1PU1A 1FJGC 2E5LC 3AF5A 3AY0A 1FLOA 3G7SA 3PROC 4IR7A 5LMNC 4GXQA 1J5EC 3GKUA 3FCEA 4JM1A 2UUBC 2VZEA 5E7QA 3CW9A 1ZB9A 2NCLA 2DPLA 4JI6C 2WD9A 4OX9C 4DV2C 4X66C 4RVNA 3I08A 4DR5C 3R9WA 2P2MA 1ZB8A 3GR0A 4LFAC 5GTDA 1BA3A 5JRHA 4U5YD 3H2TA 3OTOC 2D1SA 4G1IA 1MXAA 2KZFA 4K0BA 2P2FA 4DR7C 2Z51A 3EQ6A 2HHHC 4L2ZA 4PUIA 4R1MA 1WH9A 1FUGA 4RLQA 2WP0C 1XS3A 2YX1A 2Y4NA 4IZ6A 4X65C 4D4GA 4PROC 2Y4OA 1IB8A 5ADZA 4KTVA 5KEIA 4KTTA 3R44A 4DR1C 4K0KC 5T8SA 1M6XC 2P20A 2EGTA 5BUQA 1UKKA 3TR3A 3A25A 2PT7G 2OO4A 2V7BA 4DV3C 4GXRA 2XR1A 5H9UA 5LCIA 2VQEC 4DV6C 4LF9C 1VLAA 3E7WA 4FUTA 4PUHA 2CY1A 3L95X 1V60A 3LNVA 3B7WA 4LF7C 3R9XA 5LMUC 5KYVA 1XRCA 4B3MC 4DCVA 1MD9A 1TH5A 4R0MA 1UWDA 3DLPX 3VNSA 3GPCA 1PG3A 4PHTA 1P7LA 2P2JA 4JI8C 2PROA 1HR0C 2F4VC 3A26A 4ODJA 3K6RA 2OBVA 2YWBA 1MXBA 4JI5C 5A1GA 1MXCA 5AE3A 3E7XA 3GR1A 4G37A 2ZM6C 1N32C 3VNQA 3UOWA 4RMNA 5BSUA 3IEVA 1V25A 4DR3C 4D57A 4NOZA 4DG9A 4I9GA 5BR8C 5K85A 4DV5C 1IBMC 1MDBA 4YHHC 2UUCC 4GS5A 4DCTA 4DV4C 3J81D 1USPB 2VSQA 3N54B 4LFBC 2E7GA 3C5EA 1N36C 1AMUA 4AQYC 2M5OA 4X64C 4ZJZA 4JI7C 2JNVA 2CU6A 5T8TA 5AE1A 4DG8A 2E0GA 5BSVA 4JI4C 1IBKC 1XNQC 4MH4A 1RG9A 4X62C 2M5HA 3LAXA 2UU9C 1ML8A 4BBYA 4NXNC 1V26A 4RVOA 1XMOC 4ISBA 4RM2A 1O90A 2QL8A 1I94C 4DR2C 4LE5A 2OPLA 2UXCC 2D7VA 2UUAC 1IBLC 3PBKA 4LF8C 1N2FA 1WCJA 2Y27A 5CZVA 1N34C 3IPLA 1M6XA 4DV7C 2P2BA 2MMAB 2KDNA 3VNRA 1XHJA 3I07A 2UXDC 2PN2A 4LF6C 1LCIA 4L7IA 5A2QD
chains in the Genus database with same CATH topology
4HPVA 4TPSB 2ASBA 3DAYA 2D1QA 3IEUA 1MDFA 3SO4A 1T5HX 2QVYX 4DUYC 2UXBC 3J80D 5BURA 1RY2A 2AYAA 4FTFA 4BC7A 2QVXX 4DUZC 3TUFA 3RG2A 4ZLPA 4EATA 1JOSA 5IFIA 5DV9A 4RM3A 1O93A 2D1RA 5K8FA 4JI3C 2VQFC 1QM4A 3CW8X 4WS9A 4D56A 3EERA 1QWIA 4BC9A 1PA4A 3LGXA 1HNXC 3UZ0A 4B3SC 5A19A 2JMPA 2CXCA 5CZXA 4JI2C 4LF4C 1XRAA 3L8CA 1PG4A 4BCAA 1XRBA 3TDEA 3A4IA 1T5DX 2QW0X 4MTNA 4XX2A 1K0RA 5BSTA 4FUQA 3AF6A 5BUSA 1USPA 3T1HC 4BSZA 4GKKC 1EGAA 2HJGA 5BSRA 2E8EA 4B3TC 4NXMC 4LF5C 2QVZX 4JI0C 1O9TA 3JAMD 1O92A 3TQIA 4DR4C 2OPLB 3RV2A 3CJEA 1XMQC 2DYJA 3FCCA 4PZPA 2ONFA 3KXWA 5A1IA 5AE2A 2D1TA 4I9FA 4B3RC 3NYQA 4WV3A 4DV0C 1HNZC 5KYTA 2BH1X 3NPDA 3PESA 1MKYA 4YY3C 5IWAC 3A9VA 4JI1C 4JV5C 1ULTA 3A9UA 2D28C 4DCSA 2D27A 4OYCA 5BSMA 5FLXD 4NDNA 2E8CA 1GPMA 3N2QA 1NYEA 4DR6C 1L2FA 4DCUA 4OXIA 3ETCA 1XNRC 3DHVA 2P02A 3IMLA 4JYAC 4L4QA 3T1YC 4R1LA 3S82A 3NYRA 4GKJC 1LQLA 1KKGA 1WF3A 4RLFA 5IT9D 2P2QA 4D4IA 2YCBA 1HH2P 2YWCA 2BJOA 2ATWA 1HNWC 3LUSA 1YJ7A 4G36A 1N33C 5BSWA 4DV1C 3ETOA 2E8FA 3NI2A 4KHPC 4LFCC 1FJGC 2E5LC 3AF5A 3G7SA 3PROC 4IR7A 5LMNC 4GXQA 1J5EC 3GKUA 3FCEA 4JM1A 2UUBC 2VZEA 5E7QA 3CW9A 1ZB9A 2DPLA 4JI6C 2WD9A 4OX9C 4DV2C 4X66C 4RVNA 3I08A 4DR5C 3R9WA 2P2MA 1ZB8A 3GR0A 4LFAC 5GTDA 1BA3A 5JRHA 4U5YD 3H2TA 3OTOC 2D1SA 4G1IA 1MXAA 2KZFA 4K0BA 2P2FA 4DR7C 3EQ6A 2HHHC 4L2ZA 4R1MA 1WH9A 1FUGA 4RLQA 2WP0C 2Y4NA 4IZ6A 4X65C 4D4GA 4PROC 2Y4OA 5ADZA 4KTVA 5KEIA 4KTTA 3R44A 4DR1C 4K0KC 5T8SA 2P20A 2EGTA 5BUQA 1UKKA 2PT7G 2OO4A 2V7BA 4DV3C 4GXRA 2XR1A 5H9UA 2VQEC 4DV6C 4LF9C 1VLAA 3E7WA 4FUTA 2CY1A 3L95X 3LNVA 3B7WA 4LF7C 3R9XA 5LMUC 5KYVA 1XRCA 4B3MC 4DCVA 1MD9A 4R0MA 3DLPX 3VNSA 3GPCA 1PG3A 4PHTA 1P7LA 2P2JA 4JI8C 2PROA 1HR0C 2F4VC 4ODJA 2OBVA 2YWBA 1MXBA 4JI5C 5A1GA 1MXCA 5AE3A 3E7XA 3GR1A 4G37A 2ZM6C 1N32C 3VNQA 3UOWA 4RMNA 5BSUA 3IEVA 1V25A 4DR3C 4D57A 4NOZA 4DG9A 4I9GA 5BR8C 5K85A 4DV5C 1IBMC 1MDBA 4YHHC 2UUCC 4GS5A 4DCTA 4DV4C 3J81D 1USPB 2VSQA 3N54B 4LFBC 2E7GA 3C5EA 1N36C 1AMUA 4AQYC 4X64C 4ZJZA 4JI7C 5T8TA 5AE1A 4DG8A 2E0GA 5BSVA 4JI4C 1IBKC 1XNQC 4MH4A 1RG9A 4X62C 3LAXA 2UU9C 1ML8A 4BBYA 4NXNC 1V26A 4RVOA 1XMOC 4ISBA 4RM2A 1O90A 2QL8A 1I94C 4DR2C 4LE5A 2OPLA 2UXCC 2D7VA 2UUAC 1IBLC 3PBKA 4LF8C 1N2FA 2Y27A 5CZVA 1N34C 3IPLA 4DV7C 2P2BA 3VNRA 2UXDC 3I07A 2PN2A 4LF6C 1LCIA 4L7IA 5A2QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 C;  2ASB A;  4DR4 C;  2OPL B;  4DR5 C;  3R9W A;  3IEU A;  3CJE A;  1XMQ C;  1ZB8 A;  4LFA C;  2DYJ A;  2ONF A;  2ZM6 C;  1N32 C;  3OTO C;  4B3R C;  4DUY C;  2UXB C;  3IEV A;  2KZF A;  3J80 D;  4DR3 C;  4DV0 C;  1HNZ C;  4NOZ A;  4DR7 C;  1MKY A;  4YY3 C;  5IWA C;  2HHH C;  5BR8 C;  4JI1 C;  4DUZ C;  4JV5 C;  4DV5 C;  1IBM C;  1WH9 A;  4YHH C;  1JOS A;  4DCS A;  2UUC C;  4DCT A;  4X65 C;  4DV4 C;  3J81 D;  1USP B;  5FLX D;  2E8C A;  4LFB C;  2E7G A;  1N36 C;  1NYE A;  4DR6 C;  1L2F A;  4DCU A;  4DR1 C;  4JI3 C;  4AQY C;  1XNR C;  2VQF C;  4K0K C;  4X64 C;  4JYA C;  4JI7 C;  3T1Y C;  2EGT A;  3EER A;  1QWI A;  4GKJ C;  1UKK A;  1PA4 A;  1LQL A;  4JI4 C;  1HNX C;  1KKG A;  1IBK C;  4B3S C;  1WF3 A;  4X66 C;  1XNQ C;  2PT7 G;  2JMP A;  4MH4 A;  5IT9 D;  2CXC A;  4X62 C;  4JI2 C;  4LF4 C;  4DV3 C;  2UU9 C;  2XR1 A;  1ML8 A;  2YCB A;  1HH2 P;  2VQE C;  2BJO A;  4DV6 C;  2ATW A;  1HNW C;  4NXN C;  3LUS A;  4LF9 C;  1XMO C;  1N33 C;  4DV1 C;  1VLA A;  2E8F A;  2QL8 A;  2CY1 A;  4KHP C;  4MTN A;  1I94 C;  4LF7 C;  4DR2 C;  5LMU C;  4LFC C;  3R9X A;  4XX2 A;  1K0R A;  4B3M C;  4DCV A;  1FJG C;  4LF6 C;  3AF6 A;  2OPL A;  2E5L C;  3AF5 A;  2UXC C;  2D7V A;  2UUA C;  1USP A;  1IBL C;  3T1H C;  5LMN C;  4LF8 C;  1N2F A;  4BSZ A;  4GKK C;  1EGA A;  2HJG A;  1N34 C;  1J5E C;  3GKU A;  4JI8 C;  2E8E A;  2UUB C;  1HR0 C;  4B3T C;  4DV7 C;  2F4V C;  4NXM C;  1ZB9 A;  3I07 A;  2UXD C;  4JI6 C;  4LF5 C;  4OX9 C;  4JI0 C;  2PN2 A;  4DV2 C;  3JAM D;  5A2Q D; 
#chains in the Genus database with same CATH topology
 4HPV A;  4TPS B;  2ASB A;  3DAY A;  2D1Q A;  3IEU A;  1MDF A;  3SO4 A;  1T5H X;  2QVY X;  4DUY C;  2UXB C;  3J80 D;  5BUR A;  1RY2 A;  1NY8 A;  3CQ2 A;  2AYA A;  4FTF A;  4BC7 A;  2QVX X;  4DUZ C;  3TUF A;  3RG2 A;  4ZLP A;  4EAT A;  1JOS A;  5IFI A;  5DV9 A;  4PUG A;  3O2E A;  4RM3 A;  3UEB A;  1O93 A;  2D1R A;  5K8F A;  4JI3 C;  2VQF C;  1QM4 A;  3CW8 X;  4WS9 A;  1P4E A;  4D56 A;  3EER A;  1QWI A;  4BC9 A;  3UX3 A;  1PA4 A;  3LGX A;  1HNX C;  3UZ0 A;  4B3S C;  5A19 A;  2JMP A;  2CXC A;  5CZX A;  4JI2 C;  4LF4 C;  1XRA A;  3L8C A;  1PG4 A;  4BCA A;  1XRB A;  3UX2 A;  3TDE A;  3A4I A;  1T5D X;  2QW0 X;  2DHM A;  4MTN A;  4XX2 A;  1K0R A;  5BST A;  4FUQ A;  2ZZN A;  3AF6 A;  5BUS A;  1USP A;  3T1H C;  2MCQ A;  4BSZ A;  4GKK C;  2MM9 A;  1EGA A;  2HJG A;  5BSR A;  2E8E A;  4B3T C;  4NXM C;  3CQ3 A;  4LF5 C;  2QVZ X;  4JI0 C;  1O9T A;  3JAM D;  1O92 A;  3TQI A;  4DR4 C;  2OPL B;  3RV2 A;  3CJE A;  1XMQ C;  2DYJ A;  3FCC A;  4PZP A;  2ONF A;  3KXW A;  5A1I A;  5AE2 A;  2D1T A;  4I9F A;  4B3R C;  3NYQ A;  4WV3 A;  4DV0 C;  1HNZ C;  5KYT A;  2BH1 X;  3NPD A;  3PES A;  1MKY A;  4YY3 C;  5IWA C;  3A9V A;  4JI1 C;  4JV5 C;  1ULT A;  3A9U A;  2D28 C;  4DCS A;  2D27 A;  4OYC A;  2KZ0 A;  5BSM A;  3LNO A;  5FLX D;  4NDN A;  2E8C A;  1GPM A;  3N2Q A;  1NYE A;  4DR6 C;  1L2F A;  4DCU A;  4OXI A;  3ETC A;  1XNR C;  3DHV A;  2P02 A;  3IML A;  4JYA C;  4L4Q A;  3T1Y C;  4R1L A;  3S82 A;  3NYR A;  4GKJ C;  1LQL A;  3CQ1 A;  1KKG A;  1WF3 A;  4RLF A;  5IT9 D;  2P2Q A;  4D4I A;  2YCB A;  1HH2 P;  2YWC A;  2BJO A;  2ATW A;  1HNW C;  3LUS A;  2ZZM A;  1YJ7 A;  4G36 A;  1VEH A;  1N33 C;  5BSW A;  4DV1 C;  3ETO A;  2E8F A;  3NI2 A;  4KHP C;  1P4E C;  4LFC C;  1PU1 A;  1FJG C;  2E5L C;  3AF5 A;  3AY0 A;  1FLO A;  3G7S A;  3PRO C;  4IR7 A;  5LMN C;  4GXQ A;  1J5E C;  3GKU A;  3FCE A;  4JM1 A;  2UUB C;  2VZE A;  5E7Q A;  3CW9 A;  1ZB9 A;  2NCL A;  2DPL A;  4JI6 C;  2WD9 A;  4OX9 C;  4DV2 C;  4X66 C;  4RVN A;  3I08 A;  4DR5 C;  3R9W A;  2P2M A;  1ZB8 A;  3GR0 A;  4LFA C;  5GTD A;  1BA3 A;  5JRH A;  4U5Y D;  3H2T A;  3OTO C;  2D1S A;  4G1I A;  1MXA A;  2KZF A;  4K0B A;  2P2F A;  4DR7 C;  2Z51 A;  3EQ6 A;  2HHH C;  4L2Z A;  4PUI A;  4R1M A;  1WH9 A;  1FUG A;  4RLQ A;  2WP0 C;  1XS3 A;  2YX1 A;  2Y4N A;  4IZ6 A;  4X65 C;  4D4G A;  4PRO C;  2Y4O A;  1IB8 A;  5ADZ A;  4KTV A;  5KEI A;  4KTT A;  3R44 A;  4DR1 C;  4K0K C;  5T8S A;  1M6X C;  2P20 A;  2EGT A;  5BUQ A;  1UKK A;  3TR3 A;  3A25 A;  2PT7 G;  2OO4 A;  2V7B A;  4DV3 C;  4GXR A;  2XR1 A;  5H9U A;  5LCI A;  2VQE C;  4DV6 C;  4LF9 C;  1VLA A;  3E7W A;  4FUT A;  4PUH A;  2CY1 A;  3L95 X;  1V60 A;  3LNV A;  3B7W A;  4LF7 C;  3R9X A;  5LMU C;  5KYV A;  1XRC A;  4B3M C;  4DCV A;  1MD9 A;  1TH5 A;  4R0M A;  1UWD A;  3DLP X;  3VNS A;  3GPC A;  1PG3 A;  4PHT A;  1P7L A;  2P2J A;  4JI8 C;  2PRO A;  1HR0 C;  2F4V C;  3A26 A;  4ODJ A;  3K6R A;  2OBV A;  2YWB A;  1MXB A;  4JI5 C;  5A1G A;  1MXC A;  5AE3 A;  3E7X A;  3GR1 A;  4G37 A;  2ZM6 C;  1N32 C;  3VNQ A;  3UOW A;  4RMN A;  5BSU A;  3IEV A;  1V25 A;  4DR3 C;  4D57 A;  4NOZ A;  4DG9 A;  4I9G A;  5BR8 C;  5K85 A;  4DV5 C;  1IBM C;  1MDB A;  4YHH C;  2UUC C;  4GS5 A;  4DCT A;  4DV4 C;  3J81 D;  1USP B;  2VSQ A;  3N54 B;  4LFB C;  2E7G A;  3C5E A;  1N36 C;  1AMU A;  4AQY C;  2M5O A;  4X64 C;  4ZJZ A;  4JI7 C;  2JNV A;  2CU6 A;  5T8T A;  5AE1 A;  4DG8 A;  2E0G A;  5BSV A;  4JI4 C;  1IBK C;  1XNQ C;  4MH4 A;  1RG9 A;  4X62 C;  2M5H A;  3LAX A;  2UU9 C;  1ML8 A;  4BBY A;  4NXN C;  1V26 A;  4RVO A;  1XMO C;  4ISB A;  4RM2 A;  1O90 A;  2QL8 A;  1I94 C;  4DR2 C;  4LE5 A;  2OPL A;  2UXC C;  2D7V A;  2UUA C;  1IBL C;  3PBK A;  4LF8 C;  1N2F A;  1WCJ A;  2Y27 A;  5CZV A;  1N34 C;  3IPL A;  1M6X A;  4DV7 C;  2P2B A;  2MMA B;  2KDN A;  3VNR A;  1XHJ A;  3I07 A;  2UXD C;  2PN2 A;  4LF6 C;  1LCI A;  4L7I A;  5A2Q D; 
#chains in the Genus database with same CATH homology
 4HPV A;  4TPS B;  2ASB A;  3DAY A;  2D1Q A;  3IEU A;  1MDF A;  3SO4 A;  1T5H X;  2QVY X;  4DUY C;  2UXB C;  3J80 D;  5BUR A;  1RY2 A;  2AYA A;  4FTF A;  4BC7 A;  2QVX X;  4DUZ C;  3TUF A;  3RG2 A;  4ZLP A;  4EAT A;  1JOS A;  5IFI A;  5DV9 A;  4RM3 A;  1O93 A;  2D1R A;  5K8F A;  4JI3 C;  2VQF C;  1QM4 A;  3CW8 X;  4WS9 A;  4D56 A;  3EER A;  1QWI A;  4BC9 A;  1PA4 A;  3LGX A;  1HNX C;  3UZ0 A;  4B3S C;  5A19 A;  2JMP A;  2CXC A;  5CZX A;  4JI2 C;  4LF4 C;  1XRA A;  3L8C A;  1PG4 A;  4BCA A;  1XRB A;  3TDE A;  3A4I A;  1T5D X;  2QW0 X;  4MTN A;  4XX2 A;  1K0R A;  5BST A;  4FUQ A;  3AF6 A;  5BUS A;  1USP A;  3T1H C;  4BSZ A;  4GKK C;  1EGA A;  2HJG A;  5BSR A;  2E8E A;  4B3T C;  4NXM C;  4LF5 C;  2QVZ X;  4JI0 C;  1O9T A;  3JAM D;  1O92 A;  3TQI A;  4DR4 C;  2OPL B;  3RV2 A;  3CJE A;  1XMQ C;  2DYJ A;  3FCC A;  4PZP A;  2ONF A;  3KXW A;  5A1I A;  5AE2 A;  2D1T A;  4I9F A;  4B3R C;  3NYQ A;  4WV3 A;  4DV0 C;  1HNZ C;  5KYT A;  2BH1 X;  3NPD A;  3PES A;  1MKY A;  4YY3 C;  5IWA C;  3A9V A;  4JI1 C;  4JV5 C;  1ULT A;  3A9U A;  2D28 C;  4DCS A;  2D27 A;  4OYC A;  5BSM A;  5FLX D;  4NDN A;  2E8C A;  1GPM A;  3N2Q A;  1NYE A;  4DR6 C;  1L2F A;  4DCU A;  4OXI A;  3ETC A;  1XNR C;  3DHV A;  2P02 A;  3IML A;  4JYA C;  4L4Q A;  3T1Y C;  4R1L A;  3S82 A;  3NYR A;  4GKJ C;  1LQL A;  1KKG A;  1WF3 A;  4RLF A;  5IT9 D;  2P2Q A;  4D4I A;  2YCB A;  1HH2 P;  2YWC A;  2BJO A;  2ATW A;  1HNW C;  3LUS A;  1YJ7 A;  4G36 A;  1N33 C;  5BSW A;  4DV1 C;  3ETO A;  2E8F A;  3NI2 A;  4KHP C;  4LFC C;  1FJG C;  2E5L C;  3AF5 A;  3G7S A;  3PRO C;  4IR7 A;  5LMN C;  4GXQ A;  1J5E C;  3GKU A;  3FCE A;  4JM1 A;  2UUB C;  2VZE A;  5E7Q A;  3CW9 A;  1ZB9 A;  2DPL A;  4JI6 C;  2WD9 A;  4OX9 C;  4DV2 C;  4X66 C;  4RVN A;  3I08 A;  4DR5 C;  3R9W A;  2P2M A;  1ZB8 A;  3GR0 A;  4LFA C;  5GTD A;  1BA3 A;  5JRH A;  4U5Y D;  3H2T A;  3OTO C;  2D1S A;  4G1I A;  1MXA A;  2KZF A;  4K0B A;  2P2F A;  4DR7 C;  3EQ6 A;  2HHH C;  4L2Z A;  4R1M A;  1WH9 A;  1FUG A;  4RLQ A;  2WP0 C;  2Y4N A;  4IZ6 A;  4X65 C;  4D4G A;  4PRO C;  2Y4O A;  5ADZ A;  4KTV A;  5KEI A;  4KTT A;  3R44 A;  4DR1 C;  4K0K C;  5T8S A;  2P20 A;  2EGT A;  5BUQ A;  1UKK A;  2PT7 G;  2OO4 A;  2V7B A;  4DV3 C;  4GXR A;  2XR1 A;  5H9U A;  2VQE C;  4DV6 C;  4LF9 C;  1VLA A;  3E7W A;  4FUT A;  2CY1 A;  3L95 X;  3LNV A;  3B7W A;  4LF7 C;  3R9X A;  5LMU C;  5KYV A;  1XRC A;  4B3M C;  4DCV A;  1MD9 A;  4R0M A;  3DLP X;  3VNS A;  3GPC A;  1PG3 A;  4PHT A;  1P7L A;  2P2J A;  4JI8 C;  2PRO A;  1HR0 C;  2F4V C;  4ODJ A;  2OBV A;  2YWB A;  1MXB A;  4JI5 C;  5A1G A;  1MXC A;  5AE3 A;  3E7X A;  3GR1 A;  4G37 A;  2ZM6 C;  1N32 C;  3VNQ A;  3UOW A;  4RMN A;  5BSU A;  3IEV A;  1V25 A;  4DR3 C;  4D57 A;  4NOZ A;  4DG9 A;  4I9G A;  5BR8 C;  5K85 A;  4DV5 C;  1IBM C;  1MDB A;  4YHH C;  2UUC C;  4GS5 A;  4DCT A;  4DV4 C;  3J81 D;  1USP B;  2VSQ A;  3N54 B;  4LFB C;  2E7G A;  3C5E A;  1N36 C;  1AMU A;  4AQY C;  4X64 C;  4ZJZ A;  4JI7 C;  5T8T A;  5AE1 A;  4DG8 A;  2E0G A;  5BSV A;  4JI4 C;  1IBK C;  1XNQ C;  4MH4 A;  1RG9 A;  4X62 C;  3LAX A;  2UU9 C;  1ML8 A;  4BBY A;  4NXN C;  1V26 A;  4RVO A;  1XMO C;  4ISB A;  4RM2 A;  1O90 A;  2QL8 A;  1I94 C;  4DR2 C;  4LE5 A;  2OPL A;  2UXC C;  2D7V A;  2UUA C;  1IBL C;  3PBK A;  4LF8 C;  1N2F A;  2Y27 A;  5CZV A;  1N34 C;  3IPL A;  4DV7 C;  2P2B A;  3VNR A;  2UXD C;  3I07 A;  2PN2 A;  4LF6 C;  1LCI A;  4L7I A;  5A2Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...