1XRCA

Crystal structure of s-adenosylmethionine synthetase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule tags Methyltransferase
total genus 122
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA01
1MXBA 1XRBA 4KTTA 1O90A 4NDNA 2YWCA 5A19A 3A4IA 2OBVA 3TDEA 1O9TA 4K0BA 5A1GA 2P02A 5T8TA 3RV2A 1MXAA 3TQIA 1P7LA 5T8SA 3SO4A 5A1IA 4HPVA 1QM4A 3IMLA 1GPMA 4L4QA 4L7IA 4ODJA 4L2ZA 1FUGA 1O93A 4LE5A 5H9UA 1MXCA 2DPLA 1XRCA 1XRAA 4WS9A 2YWBA 3UOWA 4KTVA 3S82A 1O92A 1RG9A
chains in the Genus database with same CATH superfamily
3UX3A 3NYQA 4K0KC 2E8CA 1IBLC 3VNQA 4JI4C 4JI2C 1JOSA 2P2FA 1V25A 1PG4A 5LMNC 1WF3A 2HHHC 1GPMA 5GTDA 5KYVA 4LE5A 4PZPA 4I9FA 2V7BA 5K85A 2QW0X 4AQYC 4PUHA 1ZB8A 1O90A 1FLOA 4RM2A 2D1RA 2NCLA 4LF4C 4TPSB 3R44A 3LUSA 4GS5A 3GPCA 3G7SA 5T8SA 5A1IA 2JNVA 5JRHA 4HPVA 4D57A 4D4IA 4L4QA 4JI6C 4G36A 3K6RA 2YWBA 2Y27A 3ETCA 4RVNA 4DCTA 4RLFA 4BCAA 3GR0A 1XHJA 4LF7C 4EATA 1BA3A 5A19A 1YJ7A 2P20A 1UWDA 1XMQC 5IFIA 2F4VC 1P7LA 2AYAA 3KXWA 4JI8C 3NI2A 4DR2C 1EGAA 2DPLA 1PU1A 3J80D 4GKKC 1RG9A 4LFCC 3EQ6A 5DV9A 2VZEA 4NOZA 1VEHA 5LMUC 3LNOA 3VNRA 3EERA 4I9GA 4RLQA 4LF8C 2OPLB 2MM9A 3FCCA 2WD9A 4ZLPA 3GKUA 3C5EA 4G1IA 4B3MC 2OO4A 4WS9A 3CQ2A 2QVXX 2BJOA 2P2BA 5A2QD 1XRBA 2KZFA 1IBMC 4K0BA 1T5DX 4JV5C 4PUGA 2UUAC 4MH4A 3NPDA 1XNQC 1XMOC 2M5HA 1RY2A 1M6XC 1P4EC 5BUQA 3LGXA 4RMNA 1FJGC 2UXDC 1KKGA 1N36C 1ZB9A 2JMPA 4NDNA 4JM1A 2UXCC 4JI1C 2QVYX 3ETOA 4OXIA 3NYRA 3T1HC 3B7WA 4L7IA 5KEIA 1PG3A 3L95X 1L2FA 2YCBA 4JI3C 4MTNA 1LCIA 5BSUA 3UEBA 3CW9A 3J81D 4D56A 3AF6A 2D1SA 5BSWA 1O9TA 2YX1A 3LAXA 2VQEC 4JI0C 4DCSA 2P2QA 1AMUA 2UU9C 2E7GA 2VQFC 2E8FA 4DUYC 3A26A 4DV4C 5CZVA 4YY3C 5BSVA 1NYEA 1ML8A 2CU6A 1XRAA 3T1YC 3R9WA 1V60A 3JAMD 4DV2C 4PUIA 4DV1C 2UUBC 4WV3A 3RV2A 2EGTA 3DAYA 2QVZX 3IPLA 4JYAC 1N33C 4GXQA 4R0MA 3E7XA 4B3TC 2VSQA 1XRCA 2HJGA 4ISBA 1HH2P 3S82A 4DV0C 4B3SC 1VLAA 4KTTA 3CQ3A 4DR4C 4ZJZA 1HNWC 1MXAA 3TUFA 4KHPC 2BH1X 5AE3A 4B3RC 1MD9A 2MCQA 2UUCC 5BSMA 1IB8A 4DR1C 3I07A 3PROC 2ZM6C 2CY1A 4DG8A 4LF6C 5IT9D 2D7VA 2Z51A 4XX2A 1O93A 4JI7C 5BR8C 3GR1A 5IWAC 3UOWA 1K0RA 3N54B 2E5LC 2P2JA 1IBKC 2M5OA 3IEVA 2YWCA 4X65C 3R9XA 2PROA 5T8TA 3O2EA 4R1LA 1N32C 4DR6C 5K8FA 1J5EC 3I08A 1N34C 2ONFA 3DHVA 4PHTA 1T5HX 3PESA 1USPB 4DV6C 4JI5C 3VNSA 1PA4A 2PT7G 2P2MA 5AE2A 2ASBA 3L8CA 2WP0C 4DR5C 1QM4A 4LFBC 2ZZNA 3A9VA 2Y4NA 4L2ZA 4DV5C 4LFAC 4NXNC 4G37A 1UKKA 3UX2A 5LCIA 4PROC 1MXCA 1HR0C 3PBKA 4BSZA 1USPA 2DHMA 3A4IA 2OBVA 4U5YD 1XS3A 3CQ1A 4DV7C 1WH9A 2ATWA 4IR7A 4LF5C 3SO4A 4RVOA 4LF9C 1FUGA 3TR3A 4NXMC 3AF5A 4IZ6A 1ULTA 3H2TA 4GKJC 4OYCA 4KTVA 1O92A 4RM3A 1MXBA 2CXCA 5FLXD 5BURA 4DCUA 1HNXC 2E8EA 2ZZMA 4R1MA 2D27A 2KZ0A 4D4GA 3E7WA 4BC9A 3TQIA 1NY8A 1M6XA 1P4EA 3DLPX 1MKYA 1MDBA 4YHHC 5H9UA 5CZXA 3LNVA 3N2QA 1V26A 4DCVA 1I94C 2DYJA 4DUZC 2UXBC 4X62C 5BUSA 3AY0A 3UZ0A 5BSTA 4DV3C 5KYTA 1TH5A 5ADZA 3TDEA 1N2FA 5E7QA 3OTOC 4DG9A 2E0GA 4OX9C 2QL8A 4DR3C 3CW8X 3A25A 3IMLA 4FUQA 4ODJA 2D1TA 4BBYA 2D28C 4FTFA 1QWIA 3IEUA 4X66C 1HNZC 3FCEA 4FUTA 4BC7A 3RG2A 5A1GA 2P02A 4GXRA 2KDNA 2Y4OA 5BSRA 2XR1A 1WCJA 2D1QA 4DR7C 1MDFA 3A9UA 2PN2A 4X64C 2OPLA 1XNRC 2MMAB 1LQLA 3CJEA 5AE1A
chains in the Genus database with same CATH topology
3NYQA 4K0KC 2E8CA 1IBLC 3VNQA 4JI4C 4JI2C 1JOSA 2P2FA 1V25A 1PG4A 5LMNC 1WF3A 2HHHC 1GPMA 5GTDA 5KYVA 4LE5A 4PZPA 4I9FA 2V7BA 5K85A 2QW0X 4AQYC 1ZB8A 1O90A 4RM2A 2D1RA 4LF4C 4TPSB 3R44A 3LUSA 3GPCA 3G7SA 5T8SA 5A1IA 5JRHA 4HPVA 4D57A 4D4IA 4L4QA 4JI6C 4G36A 2YWBA 2Y27A 3ETCA 4RVNA 4DCTA 4RLFA 4BCAA 3GR0A 4LF7C 4EATA 1BA3A 5A19A 1YJ7A 2P20A 1XMQC 5IFIA 2F4VC 1P7LA 2AYAA 3KXWA 4JI8C 3NI2A 4DR2C 1EGAA 2DPLA 3J80D 4GKKC 1RG9A 4LFCC 3EQ6A 5DV9A 2VZEA 4NOZA 5LMUC 3VNRA 3EERA 4I9GA 4RLQA 4LF8C 2OPLB 3FCCA 2WD9A 4ZLPA 3GKUA 3C5EA 4G1IA 4B3MC 2OO4A 4WS9A 5AE1A 2QVXX 2BJOA 2P2BA 5A2QD 1XRBA 2KZFA 1IBMC 4K0BA 1T5DX 4JV5C 2UUAC 4MH4A 3NPDA 1XNQC 1XMOC 1RY2A 5BUQA 3LGXA 4RMNA 1FJGC 2UXDC 1KKGA 1N36C 1ZB9A 2JMPA 4NDNA 4JM1A 2UXCC 4JI1C 2QVYX 3ETOA 4OXIA 3NYRA 3T1HC 3B7WA 4L7IA 5KEIA 1PG3A 3L95X 1L2FA 2YCBA 4JI3C 4MTNA 1LCIA 5BSUA 3J81D 3CW9A 4D56A 3AF6A 2D1SA 5BSWA 1O9TA 3LAXA 2VQEC 4JI0C 4DCSA 2P2QA 1AMUA 2UU9C 2E7GA 2VQFC 2E8FA 4DUYC 4DV4C 5CZVA 4YY3C 5BSVA 1NYEA 1ML8A 1XRAA 3T1YC 3R9WA 3JAMD 4DV2C 4DV1C 2UUBC 1LQLA 4WV3A 3RV2A 2EGTA 3DAYA 2QVZX 3IPLA 4JYAC 1N33C 4GXQA 4R0MA 3E7XA 4B3TC 2VSQA 1XRCA 2HJGA 4ISBA 1HH2P 3S82A 4DV0C 4B3SC 1VLAA 4KTTA 4DR4C 4ZJZA 1HNWC 1MXAA 3TUFA 4KHPC 2BH1X 5AE3A 4B3RC 1MD9A 2UUCC 5BSMA 4DR1C 3I07A 3PROC 2ZM6C 2CY1A 4DG8A 4LF6C 5IT9D 2D7VA 4XX2A 1O93A 4JI7C 5BR8C 3GR1A 5IWAC 3UOWA 1K0RA 3N54B 2E5LC 2P2JA 1IBKC 3IEVA 2YWCA 4X65C 3R9XA 2PROA 5T8TA 4R1LA 1N32C 4DR6C 5K8FA 1J5EC 3I08A 1N34C 2ONFA 3DHVA 4PHTA 1T5HX 3PESA 1USPB 4DV6C 4JI5C 3VNSA 1PA4A 2PT7G 2P2MA 5AE2A 2ASBA 3L8CA 2WP0C 4DR5C 1QM4A 4LFBC 3A9VA 2Y4NA 4L2ZA 4LFAC 4NXNC 4G37A 1UKKA 4PROC 1MXCA 1HR0C 3PBKA 4BSZA 1USPA 3A4IA 2OBVA 4U5YD 4DV7C 1WH9A 2ATWA 4IR7A 4LF5C 3SO4A 4RVOA 4LF9C 1FUGA 4NXMC 3AF5A 4IZ6A 1ULTA 3H2TA 4GKJC 4OYCA 4KTVA 1O92A 4RM3A 1MXBA 2CXCA 5FLXD 5BURA 4DCUA 1HNXC 2E8EA 4R1MA 2D27A 4D4GA 3E7WA 4BC9A 3TQIA 3DLPX 1MKYA 1MDBA 4YHHC 5H9UA 5CZXA 3LNVA 3N2QA 1V26A 4DCVA 1I94C 2DYJA 4DUZC 2UXBC 4X62C 5BUSA 3UZ0A 5BSTA 4DV3C 5KYTA 5ADZA 3TDEA 1N2FA 5E7QA 3OTOC 4DG9A 2E0GA 4OX9C 2QL8A 4DR3C 3CW8X 3IMLA 4FUQA 4ODJA 2D1TA 4BBYA 2D28C 4FTFA 1QWIA 3IEUA 4X66C 1HNZC 3FCEA 4FUTA 4BC7A 3RG2A 5A1GA 2P02A 4GXRA 2Y4OA 5BSRA 2XR1A 2D1QA 4DR7C 1MDFA 3A9UA 2PN2A 4X64C 2OPLA 1XNRC 4DV5C 3CJEA 4GS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXB A;  1XRB A;  4KTT A;  1O90 A;  4NDN A;  2YWC A;  5A19 A;  3A4I A;  2OBV A;  3TDE A;  1O9T A;  4K0B A;  5A1G A;  2P02 A;  5T8T A;  3RV2 A;  1MXA A;  3TQI A;  1P7L A;  5T8S A;  3SO4 A;  5A1I A;  4HPV A;  1QM4 A;  3IML A;  1GPM A;  4L4Q A;  4L7I A;  4ODJ A;  4L2Z A;  1FUG A;  1O93 A;  4LE5 A;  5H9U A;  1MXC A;  2DPL A;  1XRC A;  1XRA A;  4WS9 A;  2YWB A;  3UOW A;  4KTV A;  3S82 A;  1O92 A;  1RG9 A; 
#chains in the Genus database with same CATH topology
 3UX3 A;  3NYQ A;  4K0K C;  2E8C A;  1IBL C;  3VNQ A;  4JI4 C;  4JI2 C;  1JOS A;  2P2F A;  1V25 A;  1PG4 A;  5LMN C;  1WF3 A;  2HHH C;  1GPM A;  5GTD A;  5KYV A;  4LE5 A;  4PZP A;  4I9F A;  2V7B A;  5K85 A;  2QW0 X;  4AQY C;  4PUH A;  1ZB8 A;  1O90 A;  1FLO A;  4RM2 A;  2D1R A;  2NCL A;  4LF4 C;  4TPS B;  3R44 A;  3LUS A;  4GS5 A;  3GPC A;  3G7S A;  5T8S A;  5A1I A;  2JNV A;  5JRH A;  4HPV A;  4D57 A;  4D4I A;  4L4Q A;  4JI6 C;  4G36 A;  3K6R A;  2YWB A;  2Y27 A;  3ETC A;  4RVN A;  4DCT A;  4RLF A;  4BCA A;  3GR0 A;  1XHJ A;  4LF7 C;  4EAT A;  1BA3 A;  5A19 A;  1YJ7 A;  2P20 A;  1UWD A;  1XMQ C;  5IFI A;  2F4V C;  1P7L A;  2AYA A;  3KXW A;  4JI8 C;  3NI2 A;  4DR2 C;  1EGA A;  2DPL A;  1PU1 A;  3J80 D;  4GKK C;  1RG9 A;  4LFC C;  3EQ6 A;  5DV9 A;  2VZE A;  4NOZ A;  1VEH A;  5LMU C;  3LNO A;  3VNR A;  3EER A;  4I9G A;  4RLQ A;  4LF8 C;  2OPL B;  2MM9 A;  3FCC A;  2WD9 A;  4ZLP A;  3GKU A;  3C5E A;  4G1I A;  4B3M C;  2OO4 A;  4WS9 A;  3CQ2 A;  2QVX X;  2BJO A;  2P2B A;  5A2Q D;  1XRB A;  2KZF A;  1IBM C;  4K0B A;  1T5D X;  4JV5 C;  4PUG A;  2UUA C;  4MH4 A;  3NPD A;  1XNQ C;  1XMO C;  2M5H A;  1RY2 A;  1M6X C;  1P4E C;  5BUQ A;  3LGX A;  4RMN A;  1FJG C;  2UXD C;  1KKG A;  1N36 C;  1ZB9 A;  2JMP A;  4NDN A;  4JM1 A;  2UXC C;  4JI1 C;  2QVY X;  3ETO A;  4OXI A;  3NYR A;  3T1H C;  3B7W A;  4L7I A;  5KEI A;  1PG3 A;  3L95 X;  1L2F A;  2YCB A;  4JI3 C;  4MTN A;  1LCI A;  5BSU A;  3UEB A;  3CW9 A;  3J81 D;  4D56 A;  3AF6 A;  2D1S A;  5BSW A;  1O9T A;  2YX1 A;  3LAX A;  2VQE C;  4JI0 C;  4DCS A;  2P2Q A;  1AMU A;  2UU9 C;  2E7G A;  2VQF C;  2E8F A;  4DUY C;  3A26 A;  4DV4 C;  5CZV A;  4YY3 C;  5BSV A;  1NYE A;  1ML8 A;  2CU6 A;  1XRA A;  3T1Y C;  3R9W A;  1V60 A;  3JAM D;  4DV2 C;  4PUI A;  4DV1 C;  2UUB C;  4WV3 A;  3RV2 A;  2EGT A;  3DAY A;  2QVZ X;  3IPL A;  4JYA C;  1N33 C;  4GXQ A;  4R0M A;  3E7X A;  4B3T C;  2VSQ A;  1XRC A;  2HJG A;  4ISB A;  1HH2 P;  3S82 A;  4DV0 C;  4B3S C;  1VLA A;  4KTT A;  3CQ3 A;  4DR4 C;  4ZJZ A;  1HNW C;  1MXA A;  3TUF A;  4KHP C;  2BH1 X;  5AE3 A;  4B3R C;  1MD9 A;  2MCQ A;  2UUC C;  5BSM A;  1IB8 A;  4DR1 C;  3I07 A;  3PRO C;  2ZM6 C;  2CY1 A;  4DG8 A;  4LF6 C;  5IT9 D;  2D7V A;  2Z51 A;  4XX2 A;  1O93 A;  4JI7 C;  5BR8 C;  3GR1 A;  5IWA C;  3UOW A;  1K0R A;  3N54 B;  2E5L C;  2P2J A;  1IBK C;  2M5O A;  3IEV A;  2YWC A;  4X65 C;  3R9X A;  2PRO A;  5T8T A;  3O2E A;  4R1L A;  1N32 C;  4DR6 C;  5K8F A;  1J5E C;  3I08 A;  1N34 C;  2ONF A;  3DHV A;  4PHT A;  1T5H X;  3PES A;  1USP B;  4DV6 C;  4JI5 C;  3VNS A;  1PA4 A;  2PT7 G;  2P2M A;  5AE2 A;  2ASB A;  3L8C A;  2WP0 C;  4DR5 C;  1QM4 A;  4LFB C;  2ZZN A;  3A9V A;  2Y4N A;  4L2Z A;  4DV5 C;  4LFA C;  4NXN C;  4G37 A;  1UKK A;  3UX2 A;  5LCI A;  4PRO C;  1MXC A;  1HR0 C;  3PBK A;  4BSZ A;  1USP A;  2DHM A;  3A4I A;  2OBV A;  4U5Y D;  1XS3 A;  3CQ1 A;  4DV7 C;  1WH9 A;  2ATW A;  4IR7 A;  4LF5 C;  3SO4 A;  4RVO A;  4LF9 C;  1FUG A;  3TR3 A;  4NXM C;  3AF5 A;  4IZ6 A;  1ULT A;  3H2T A;  4GKJ C;  4OYC A;  4KTV A;  1O92 A;  4RM3 A;  1MXB A;  2CXC A;  5FLX D;  5BUR A;  4DCU A;  1HNX C;  2E8E A;  2ZZM A;  4R1M A;  2D27 A;  2KZ0 A;  4D4G A;  3E7W A;  4BC9 A;  3TQI A;  1NY8 A;  1M6X A;  1P4E A;  3DLP X;  1MKY A;  1MDB A;  4YHH C;  5H9U A;  5CZX A;  3LNV A;  3N2Q A;  1V26 A;  4DCV A;  1I94 C;  2DYJ A;  4DUZ C;  2UXB C;  4X62 C;  5BUS A;  3AY0 A;  3UZ0 A;  5BST A;  4DV3 C;  5KYT A;  1TH5 A;  5ADZ A;  3TDE A;  1N2F A;  5E7Q A;  3OTO C;  4DG9 A;  2E0G A;  4OX9 C;  2QL8 A;  4DR3 C;  3CW8 X;  3A25 A;  3IML A;  4FUQ A;  4ODJ A;  2D1T A;  4BBY A;  2D28 C;  4FTF A;  1QWI A;  3IEU A;  4X66 C;  1HNZ C;  3FCE A;  4FUT A;  4BC7 A;  3RG2 A;  5A1G A;  2P02 A;  4GXR A;  2KDN A;  2Y4O A;  5BSR A;  2XR1 A;  1WCJ A;  2D1Q A;  4DR7 C;  1MDF A;  3A9U A;  2PN2 A;  4X64 C;  2OPL A;  1XNR C;  2MMA B;  1LQL A;  3CJE A;  5AE1 A; 
#chains in the Genus database with same CATH homology
 3NYQ A;  4K0K C;  2E8C A;  1IBL C;  3VNQ A;  4JI4 C;  4JI2 C;  1JOS A;  2P2F A;  1V25 A;  1PG4 A;  5LMN C;  1WF3 A;  2HHH C;  1GPM A;  5GTD A;  5KYV A;  4LE5 A;  4PZP A;  4I9F A;  2V7B A;  5K85 A;  2QW0 X;  4AQY C;  1ZB8 A;  1O90 A;  4RM2 A;  2D1R A;  4LF4 C;  4TPS B;  3R44 A;  3LUS A;  3GPC A;  3G7S A;  5T8S A;  5A1I A;  5JRH A;  4HPV A;  4D57 A;  4D4I A;  4L4Q A;  4JI6 C;  4G36 A;  2YWB A;  2Y27 A;  3ETC A;  4RVN A;  4DCT A;  4RLF A;  4BCA A;  3GR0 A;  4LF7 C;  4EAT A;  1BA3 A;  5A19 A;  1YJ7 A;  2P20 A;  1XMQ C;  5IFI A;  2F4V C;  1P7L A;  2AYA A;  3KXW A;  4JI8 C;  3NI2 A;  4DR2 C;  1EGA A;  2DPL A;  3J80 D;  4GKK C;  1RG9 A;  4LFC C;  3EQ6 A;  5DV9 A;  2VZE A;  4NOZ A;  5LMU C;  3VNR A;  3EER A;  4I9G A;  4RLQ A;  4LF8 C;  2OPL B;  3FCC A;  2WD9 A;  4ZLP A;  3GKU A;  3C5E A;  4G1I A;  4B3M C;  2OO4 A;  4WS9 A;  5AE1 A;  2QVX X;  2BJO A;  2P2B A;  5A2Q D;  1XRB A;  2KZF A;  1IBM C;  4K0B A;  1T5D X;  4JV5 C;  2UUA C;  4MH4 A;  3NPD A;  1XNQ C;  1XMO C;  1RY2 A;  5BUQ A;  3LGX A;  4RMN A;  1FJG C;  2UXD C;  1KKG A;  1N36 C;  1ZB9 A;  2JMP A;  4NDN A;  4JM1 A;  2UXC C;  4JI1 C;  2QVY X;  3ETO A;  4OXI A;  3NYR A;  3T1H C;  3B7W A;  4L7I A;  5KEI A;  1PG3 A;  3L95 X;  1L2F A;  2YCB A;  4JI3 C;  4MTN A;  1LCI A;  5BSU A;  3J81 D;  3CW9 A;  4D56 A;  3AF6 A;  2D1S A;  5BSW A;  1O9T A;  3LAX A;  2VQE C;  4JI0 C;  4DCS A;  2P2Q A;  1AMU A;  2UU9 C;  2E7G A;  2VQF C;  2E8F A;  4DUY C;  4DV4 C;  5CZV A;  4YY3 C;  5BSV A;  1NYE A;  1ML8 A;  1XRA A;  3T1Y C;  3R9W A;  3JAM D;  4DV2 C;  4DV1 C;  2UUB C;  1LQL A;  4WV3 A;  3RV2 A;  2EGT A;  3DAY A;  2QVZ X;  3IPL A;  4JYA C;  1N33 C;  4GXQ A;  4R0M A;  3E7X A;  4B3T C;  2VSQ A;  1XRC A;  2HJG A;  4ISB A;  1HH2 P;  3S82 A;  4DV0 C;  4B3S C;  1VLA A;  4KTT A;  4DR4 C;  4ZJZ A;  1HNW C;  1MXA A;  3TUF A;  4KHP C;  2BH1 X;  5AE3 A;  4B3R C;  1MD9 A;  2UUC C;  5BSM A;  4DR1 C;  3I07 A;  3PRO C;  2ZM6 C;  2CY1 A;  4DG8 A;  4LF6 C;  5IT9 D;  2D7V A;  4XX2 A;  1O93 A;  4JI7 C;  5BR8 C;  3GR1 A;  5IWA C;  3UOW A;  1K0R A;  3N54 B;  2E5L C;  2P2J A;  1IBK C;  3IEV A;  2YWC A;  4X65 C;  3R9X A;  2PRO A;  5T8T A;  4R1L A;  1N32 C;  4DR6 C;  5K8F A;  1J5E C;  3I08 A;  1N34 C;  2ONF A;  3DHV A;  4PHT A;  1T5H X;  3PES A;  1USP B;  4DV6 C;  4JI5 C;  3VNS A;  1PA4 A;  2PT7 G;  2P2M A;  5AE2 A;  2ASB A;  3L8C A;  2WP0 C;  4DR5 C;  1QM4 A;  4LFB C;  3A9V A;  2Y4N A;  4L2Z A;  4LFA C;  4NXN C;  4G37 A;  1UKK A;  4PRO C;  1MXC A;  1HR0 C;  3PBK A;  4BSZ A;  1USP A;  3A4I A;  2OBV A;  4U5Y D;  4DV7 C;  1WH9 A;  2ATW A;  4IR7 A;  4LF5 C;  3SO4 A;  4RVO A;  4LF9 C;  1FUG A;  4NXM C;  3AF5 A;  4IZ6 A;  1ULT A;  3H2T A;  4GKJ C;  4OYC A;  4KTV A;  1O92 A;  4RM3 A;  1MXB A;  2CXC A;  5FLX D;  5BUR A;  4DCU A;  1HNX C;  2E8E A;  4R1M A;  2D27 A;  4D4G A;  3E7W A;  4BC9 A;  3TQI A;  3DLP X;  1MKY A;  1MDB A;  4YHH C;  5H9U A;  5CZX A;  3LNV A;  3N2Q A;  1V26 A;  4DCV A;  1I94 C;  2DYJ A;  4DUZ C;  2UXB C;  4X62 C;  5BUS A;  3UZ0 A;  5BST A;  4DV3 C;  5KYT A;  5ADZ A;  3TDE A;  1N2F A;  5E7Q A;  3OTO C;  4DG9 A;  2E0G A;  4OX9 C;  2QL8 A;  4DR3 C;  3CW8 X;  3IML A;  4FUQ A;  4ODJ A;  2D1T A;  4BBY A;  2D28 C;  4FTF A;  1QWI A;  3IEU A;  4X66 C;  1HNZ C;  3FCE A;  4FUT A;  4BC7 A;  3RG2 A;  5A1G A;  2P02 A;  4GXR A;  2Y4O A;  5BSR A;  2XR1 A;  2D1Q A;  4DR7 C;  1MDF A;  3A9U A;  2PN2 A;  4X64 C;  2OPL A;  1XNR C;  4DV5 C;  3CJE A;  4GS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...