1XRCA

Crystal structure of s-adenosylmethionine synthetase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Methyltransferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
total genus 122
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrcA01
1GPMA 2YWBA 1O9TA 4WS9A 1O90A 1XRBA 3RV2A 4L7IA 5T8SA 4HPVA 3S82A 1XRAA 1MXCA 5A1GA 3IMLA 4ODJA 5T8TA 3TQIA 5A1IA 1MXBA 4L4QA 2YWCA 1O93A 1QM4A 4K0BA 1O92A 4NDNA 4KTVA 4L2ZA 1FUGA 1XRCA 4LE5A 4KTTA 1RG9A 2DPLA 3TDEA 1MXAA 2OBVA 1P7LA 2P02A 3SO4A 5H9UA 5A19A 3A4IA 3UOWA
chains in the Genus database with same CATH superfamily
1BA3A 3DHVA 4B3TC 4ISBA 1JOSA 2VSQA 5BURA 1J5EC 4GS5A 2D1QA 4ZLPA 3FCEA 2P2FA 4NOZA 1I94C 5A1GA 2WP0C 2DYJA 2KDNA 2YCBA 4DCSA 3OTOC 3PESA 4DV4C 4FUQA 3LGXA 4KTTA 1RG9A 3CW9A 1AMUA 1P7LA 1VLAA 2E8CA 2ASBA 2MMAB 4G37A 1PG4A 4LF8C 5A1IA 2Y4NA 1XMOC 3TR3A 4JI2C 2YWCA 4RVNA 1N34C 1IBLC 4DR3C 2PN2A 2D28C 4DR2C 5FLXD 2VZEA 2QW0X 4IR7A 5AE3A 3A4IA 4K0KC 1V25A 3VNSA 2YWBA 3IEUA 2KZFA 3T1YC 3RV2A 3A26A 5KYTA 3UZ0A 5BUSA 3UX3A 1WH9A 2KZ0A 2OO4A 3A9VA 3LUSA 4WV3A 3IEVA 2UUAC 3R44A 2XR1A 1M6XA 4L2ZA 2UUCC 1RY2A 2WD9A 4D57A 1NYEA 2Y4OA 4ZJZA 4DR7C 1XHJA 5IWAC 3AF6A 2HHHC 4AQYC 2OPLA 3IPLA 4DV1C 2BH1X 4JI3C 4RMNA 4DG9A 2ONFA 2ZZMA 3S82A 4DR4C 3A25A 4FTFA 5E7QA 3NYQA 4ODJA 3TQIA 5CZXA 4L4QA 4BC7A 1PG3A 4MTNA 1XRCA 1P4EC 2MCQA 4LF9C 1IB8A 3G7SA 4U5YD 2VQEC 5GTDA 1UWDA 1USPA 4WS9A 1O90A 5BSRA 4LFAC 4LFBC 2CU6A 3DLPX 4G1IA 4D4GA 1XNRC 3E7XA 1N33C 3DAYA 3NYRA 5K8FA 3IMLA 4B3MC 2Z51A 2MM9A 2UXBC 3R9XA 4LF5C 3C5EA 1UKKA 2ZZNA 4PUIA 1USPB 2UXCC 1N32C 1O9TA 1T5HX 4YY3C 4XX2A 4DV5C 3JAMD 2CY1A 2PT7G 5T8SA 4GKJC 3FCCA 1WCJA 4DG8A 5T8TA 4DV0C 4JI0C 2D1RA 1FLOA 1V60A 4DCVA 1IBMC 4DUZC 5K85A 4BC9A 3J81D 2E7GA 2BJOA 4YHHC 4IZ6A 3GR0A 1GPMA 2NCLA 4PUHA 4JI5C 4B3SC 3AF5A 1KKGA 3I07A 4NXNC 5BUQA 3O2EA 5IT9D 3PBKA 1O93A 4DV3C 3LNOA 4JI1C 2P2MA 2E8EA 3SO4A 4FUTA 4EATA 4JV5C 4JYAC 2ATWA 4R1LA 5AE2A 4DV7C 1LCIA 4RM3A 3L8CA 2HJGA 1ULTA 1XRAA 3TUFA 1PU1A 2YX1A 5BSTA 1MDFA 1EGAA 4X64C 4K0BA 1ML8A 3RG2A 1NY8A 3K6RA 4GXRA 5DV9A 4GKKC 3TDEA 2OBVA 4LFCC 4DCUA 4OX9C 4MH4A 3LNVA 2CXCA 1XRBA 1XMQC 4X66C 4HPVA 5BSWA 4PROC 2JNVA 5BSVA 3LAXA 1K0RA 5LMNC 2UXDC 2AYAA 4X62C 1O92A 2QL8A 2QVZX 3CQ3A 1FUGA 1V26A 2Y27A 4RLQA 3GPCA 2DPLA 4RVOA 2D27A 1MDBA 3A9UA 3ETOA 3L95X 1XS3A 4KTVA 2E5LC 4LF7C 4I9FA 1MKYA 4JI6C 3UX2A 3UOWA 3ETCA 3KXWA 3CJEA 4G36A 3CW8X 4DR5C 1QWIA 2P2JA 5IFIA 1HNXC 5ADZA 2ZM6C 2M5OA 3UEBA 2M5HA 3E7WA 5LMUC 1M6XC 1N36C 3VNQA 1MXAA 2UU9C 2P02A 1MD9A 4DUYC 4GXQA 4JI8C 1WF3A 4OYCA 4L7IA 4B3RC 3GR1A 4OXIA 1HR0C 1P4EA 4LF4C 3AY0A 4DV6C 3R9WA 4LF6C 3H2TA 5A19A 5KYVA 3EERA 4KHPC 3GKUA 2P2BA 1YJ7A 1TH5A 1T5DX 4BSZA 3VNRA 1IBKC 2P20A 4R1MA 2VQFC 4PHTA 4D56A 4JI7C 5KEIA 2F4VC 4I9GA 3T1HC 4D4IA 1HNWC 4JI4C 1FJGC 4DR1C 3CQ2A 3NI2A 5A2QD 2D1SA 2EGTA 3N54B 1HH2P 3J80D 4TPSB 3CQ1A 4JM1A 1N2FA 2E8FA 4DV2C 2UUBC 1MXCA 2V7BA 1LQLA 4R0MA 4PZPA 2D1TA 2E0GA 2QVXX 3EQ6A 4DCTA 4NDNA 4RM2A 1HNZC 5H9UA 4RLFA 5BR8C 5BSMA 1ZB9A 3NPDA 1PA4A 1VEHA 5BSUA 5LCIA 1MXBA 2PROA 4NXMC 1QM4A 2P2QA 1ZB8A 2OPLB 2D7VA 1L2FA 5AE1A 4BBYA 5JRHA 4X65C 2JMPA 5CZVA 3PROC 3B7WA 4DR6C 4PUGA 2QVYX 3I08A 4BCAA 3N2QA 2DHMA 4LE5A 1XNQC
chains in the Genus database with same CATH topology
1BA3A 3DHVA 4B3TC 4ISBA 1JOSA 2VSQA 5BURA 1J5EC 4GS5A 2D1QA 4ZLPA 3FCEA 2P2FA 4NOZA 1I94C 5A1GA 2WP0C 2DYJA 2YCBA 4DCSA 3OTOC 3PESA 4DV4C 4FUQA 3LGXA 4KTTA 1RG9A 3CW9A 1AMUA 1P7LA 1VLAA 2E8CA 2ASBA 4G37A 1PG4A 4LF8C 5A1IA 2Y4NA 1XMOC 4JI2C 2YWCA 4RVNA 1N34C 1IBLC 4DR3C 2PN2A 2D28C 4DR2C 5FLXD 2VZEA 2QW0X 4IR7A 5AE3A 3A4IA 4K0KC 1V25A 3VNSA 2YWBA 3IEUA 2KZFA 3T1YC 3RV2A 5KYTA 3UZ0A 5BUSA 1WH9A 2OO4A 3A9VA 3LUSA 4WV3A 3IEVA 2UUAC 3R44A 2XR1A 4L2ZA 2UUCC 1RY2A 2WD9A 4D57A 1NYEA 2Y4OA 4ZJZA 4DR7C 5IWAC 3AF6A 2HHHC 4AQYC 2OPLA 3IPLA 4DV1C 2BH1X 4JI3C 4RMNA 4DG9A 2ONFA 3S82A 4DR4C 4FTFA 5E7QA 3NYQA 4ODJA 3TQIA 5CZXA 4L4QA 4BC7A 1PG3A 4MTNA 1XRCA 4LF9C 4U5YD 3G7SA 2VQEC 5GTDA 1USPA 4WS9A 1O90A 5BSRA 4LFAC 4LFBC 3DLPX 4G1IA 4D4GA 1XNRC 3E7XA 1N33C 3DAYA 3NYRA 5K8FA 3IMLA 4B3MC 2UXBC 3R9XA 4LF5C 3C5EA 1UKKA 1USPB 2UXCC 1N32C 1O9TA 1T5HX 4YY3C 4XX2A 4DV5C 3JAMD 2CY1A 2PT7G 5T8SA 4GKJC 3FCCA 4DG8A 5T8TA 4DV0C 4JI0C 2D1RA 4DCVA 1IBMC 4DUZC 5K85A 4BC9A 3J81D 2E7GA 2BJOA 4YHHC 4IZ6A 3GR0A 1GPMA 4JI5C 4B3SC 3AF5A 1KKGA 3I07A 4NXNC 5BUQA 5IT9D 3PBKA 1O93A 4DV3C 4JI1C 2P2MA 2E8EA 3SO4A 4FUTA 4EATA 4JV5C 4JYAC 2ATWA 4R1LA 5AE2A 4DV7C 1LCIA 4RM3A 3L8CA 2HJGA 1ULTA 1XRAA 3TUFA 5BSTA 1MDFA 1EGAA 4X64C 4K0BA 1ML8A 3RG2A 4GKKC 4GXRA 5DV9A 3TDEA 2OBVA 4LFCC 4DCUA 4OX9C 4MH4A 3LNVA 2CXCA 1XRBA 1XMQC 4X66C 4HPVA 5BSWA 4PROC 5BSVA 3LAXA 1K0RA 5LMNC 2UXDC 2AYAA 4X62C 1O92A 2QL8A 2QVZX 1FUGA 1V26A 2Y27A 4RLQA 3GPCA 2DPLA 4RVOA 2D27A 1MDBA 3A9UA 3ETOA 3L95X 4KTVA 2E5LC 4LF7C 4I9FA 1MKYA 4JI6C 3UOWA 3ETCA 3KXWA 3CJEA 4G36A 3CW8X 4DR5C 1QWIA 2P2JA 5IFIA 1HNXC 5ADZA 2ZM6C 3E7WA 5LMUC 1N36C 3VNQA 1MXAA 2UU9C 2P02A 1MD9A 4DUYC 4GXQA 4JI8C 1WF3A 4OYCA 4L7IA 4B3RC 3GR1A 4OXIA 1HR0C 4LF4C 4DV6C 3R9WA 4LF6C 3H2TA 5A19A 5KYVA 3EERA 4KHPC 3GKUA 2P2BA 1YJ7A 1T5DX 4BSZA 3VNRA 1IBKC 2P20A 4R1MA 2VQFC 4PHTA 4D56A 4JI7C 5KEIA 2F4VC 4I9GA 3T1HC 4D4IA 1HNWC 4JI4C 1FJGC 4DR1C 3NI2A 5A2QD 2D1SA 2EGTA 3N54B 1HH2P 3J80D 4TPSB 4JM1A 1N2FA 2E8FA 4DV2C 2UUBC 1MXCA 2V7BA 1LQLA 4R0MA 4PZPA 2D1TA 2E0GA 2QVXX 3EQ6A 4DCTA 4NDNA 4RM2A 1HNZC 5H9UA 4RLFA 5BR8C 5BSMA 1ZB9A 3NPDA 1PA4A 5BSUA 1MXBA 2PROA 4NXMC 1QM4A 2P2QA 1ZB8A 2OPLB 2D7VA 1L2FA 5AE1A 4BBYA 5JRHA 4X65C 2JMPA 5CZVA 3PROC 3B7WA 4DR6C 2QVYX 3I08A 4BCAA 3N2QA 4LE5A 1XNQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPM A;  2YWB A;  1O9T A;  4WS9 A;  1O90 A;  1XRB A;  3RV2 A;  4L7I A;  5T8S A;  4HPV A;  3S82 A;  1XRA A;  1MXC A;  5A1G A;  3IML A;  4ODJ A;  5T8T A;  3TQI A;  5A1I A;  1MXB A;  4L4Q A;  2YWC A;  1O93 A;  1QM4 A;  4K0B A;  1O92 A;  4NDN A;  4KTV A;  4L2Z A;  1FUG A;  1XRC A;  4LE5 A;  4KTT A;  1RG9 A;  2DPL A;  3TDE A;  1MXA A;  2OBV A;  1P7L A;  2P02 A;  3SO4 A;  5H9U A;  5A19 A;  3A4I A;  3UOW A; 
#chains in the Genus database with same CATH topology
 1BA3 A;  3DHV A;  4B3T C;  4ISB A;  1JOS A;  2VSQ A;  5BUR A;  1J5E C;  4GS5 A;  2D1Q A;  4ZLP A;  3FCE A;  2P2F A;  4NOZ A;  1I94 C;  5A1G A;  2WP0 C;  2DYJ A;  2KDN A;  2YCB A;  4DCS A;  3OTO C;  3PES A;  4DV4 C;  4FUQ A;  3LGX A;  4KTT A;  1RG9 A;  3CW9 A;  1AMU A;  1P7L A;  1VLA A;  2E8C A;  2ASB A;  2MMA B;  4G37 A;  1PG4 A;  4LF8 C;  5A1I A;  2Y4N A;  1XMO C;  3TR3 A;  4JI2 C;  2YWC A;  4RVN A;  1N34 C;  1IBL C;  4DR3 C;  2PN2 A;  2D28 C;  4DR2 C;  5FLX D;  2VZE A;  2QW0 X;  4IR7 A;  5AE3 A;  3A4I A;  4K0K C;  1V25 A;  3VNS A;  2YWB A;  3IEU A;  2KZF A;  3T1Y C;  3RV2 A;  3A26 A;  5KYT A;  3UZ0 A;  5BUS A;  3UX3 A;  1WH9 A;  2KZ0 A;  2OO4 A;  3A9V A;  3LUS A;  4WV3 A;  3IEV A;  2UUA C;  3R44 A;  2XR1 A;  1M6X A;  4L2Z A;  2UUC C;  1RY2 A;  2WD9 A;  4D57 A;  1NYE A;  2Y4O A;  4ZJZ A;  4DR7 C;  1XHJ A;  5IWA C;  3AF6 A;  2HHH C;  4AQY C;  2OPL A;  3IPL A;  4DV1 C;  2BH1 X;  4JI3 C;  4RMN A;  4DG9 A;  2ONF A;  2ZZM A;  3S82 A;  4DR4 C;  3A25 A;  4FTF A;  5E7Q A;  3NYQ A;  4ODJ A;  3TQI A;  5CZX A;  4L4Q A;  4BC7 A;  1PG3 A;  4MTN A;  1XRC A;  1P4E C;  2MCQ A;  4LF9 C;  1IB8 A;  3G7S A;  4U5Y D;  2VQE C;  5GTD A;  1UWD A;  1USP A;  4WS9 A;  1O90 A;  5BSR A;  4LFA C;  4LFB C;  2CU6 A;  3DLP X;  4G1I A;  4D4G A;  1XNR C;  3E7X A;  1N33 C;  3DAY A;  3NYR A;  5K8F A;  3IML A;  4B3M C;  2Z51 A;  2MM9 A;  2UXB C;  3R9X A;  4LF5 C;  3C5E A;  1UKK A;  2ZZN A;  4PUI A;  1USP B;  2UXC C;  1N32 C;  1O9T A;  1T5H X;  4YY3 C;  4XX2 A;  4DV5 C;  3JAM D;  2CY1 A;  2PT7 G;  5T8S A;  4GKJ C;  3FCC A;  1WCJ A;  4DG8 A;  5T8T A;  4DV0 C;  4JI0 C;  2D1R A;  1FLO A;  1V60 A;  4DCV A;  1IBM C;  4DUZ C;  5K85 A;  4BC9 A;  3J81 D;  2E7G A;  2BJO A;  4YHH C;  4IZ6 A;  3GR0 A;  1GPM A;  2NCL A;  4PUH A;  4JI5 C;  4B3S C;  3AF5 A;  1KKG A;  3I07 A;  4NXN C;  5BUQ A;  3O2E A;  5IT9 D;  3PBK A;  1O93 A;  4DV3 C;  3LNO A;  4JI1 C;  2P2M A;  2E8E A;  3SO4 A;  4FUT A;  4EAT A;  4JV5 C;  4JYA C;  2ATW A;  4R1L A;  5AE2 A;  4DV7 C;  1LCI A;  4RM3 A;  3L8C A;  2HJG A;  1ULT A;  1XRA A;  3TUF A;  1PU1 A;  2YX1 A;  5BST A;  1MDF A;  1EGA A;  4X64 C;  4K0B A;  1ML8 A;  3RG2 A;  1NY8 A;  3K6R A;  4GXR A;  5DV9 A;  4GKK C;  3TDE A;  2OBV A;  4LFC C;  4DCU A;  4OX9 C;  4MH4 A;  3LNV A;  2CXC A;  1XRB A;  1XMQ C;  4X66 C;  4HPV A;  5BSW A;  4PRO C;  2JNV A;  5BSV A;  3LAX A;  1K0R A;  5LMN C;  2UXD C;  2AYA A;  4X62 C;  1O92 A;  2QL8 A;  2QVZ X;  3CQ3 A;  1FUG A;  1V26 A;  2Y27 A;  4RLQ A;  3GPC A;  2DPL A;  4RVO A;  2D27 A;  1MDB A;  3A9U A;  3ETO A;  3L95 X;  1XS3 A;  4KTV A;  2E5L C;  4LF7 C;  4I9F A;  1MKY A;  4JI6 C;  3UX2 A;  3UOW A;  3ETC A;  3KXW A;  3CJE A;  4G36 A;  3CW8 X;  4DR5 C;  1QWI A;  2P2J A;  5IFI A;  1HNX C;  5ADZ A;  2ZM6 C;  2M5O A;  3UEB A;  2M5H A;  3E7W A;  5LMU C;  1M6X C;  1N36 C;  3VNQ A;  1MXA A;  2UU9 C;  2P02 A;  1MD9 A;  4DUY C;  4GXQ A;  4JI8 C;  1WF3 A;  4OYC A;  4L7I A;  4B3R C;  3GR1 A;  4OXI A;  1HR0 C;  1P4E A;  4LF4 C;  3AY0 A;  4DV6 C;  3R9W A;  4LF6 C;  3H2T A;  5A19 A;  5KYV A;  3EER A;  4KHP C;  3GKU A;  2P2B A;  1YJ7 A;  1TH5 A;  1T5D X;  4BSZ A;  3VNR A;  1IBK C;  2P20 A;  4R1M A;  2VQF C;  4PHT A;  4D56 A;  4JI7 C;  5KEI A;  2F4V C;  4I9G A;  3T1H C;  4D4I A;  1HNW C;  4JI4 C;  1FJG C;  4DR1 C;  3CQ2 A;  3NI2 A;  5A2Q D;  2D1S A;  2EGT A;  3N54 B;  1HH2 P;  3J80 D;  4TPS B;  3CQ1 A;  4JM1 A;  1N2F A;  2E8F A;  4DV2 C;  2UUB C;  1MXC A;  2V7B A;  1LQL A;  4R0M A;  4PZP A;  2D1T A;  2E0G A;  2QVX X;  3EQ6 A;  4DCT A;  4NDN A;  4RM2 A;  1HNZ C;  5H9U A;  4RLF A;  5BR8 C;  5BSM A;  1ZB9 A;  3NPD A;  1PA4 A;  1VEH A;  5BSU A;  5LCI A;  1MXB A;  2PRO A;  4NXM C;  1QM4 A;  2P2Q A;  1ZB8 A;  2OPL B;  2D7V A;  1L2F A;  5AE1 A;  4BBY A;  5JRH A;  4X65 C;  2JMP A;  5CZV A;  3PRO C;  3B7W A;  4DR6 C;  4PUG A;  2QVY X;  3I08 A;  4BCA A;  3N2Q A;  2DHM A;  4LE5 A;  1XNQ C; 
#chains in the Genus database with same CATH homology
 1BA3 A;  3DHV A;  4B3T C;  4ISB A;  1JOS A;  2VSQ A;  5BUR A;  1J5E C;  4GS5 A;  2D1Q A;  4ZLP A;  3FCE A;  2P2F A;  4NOZ A;  1I94 C;  5A1G A;  2WP0 C;  2DYJ A;  2YCB A;  4DCS A;  3OTO C;  3PES A;  4DV4 C;  4FUQ A;  3LGX A;  4KTT A;  1RG9 A;  3CW9 A;  1AMU A;  1P7L A;  1VLA A;  2E8C A;  2ASB A;  4G37 A;  1PG4 A;  4LF8 C;  5A1I A;  2Y4N A;  1XMO C;  4JI2 C;  2YWC A;  4RVN A;  1N34 C;  1IBL C;  4DR3 C;  2PN2 A;  2D28 C;  4DR2 C;  5FLX D;  2VZE A;  2QW0 X;  4IR7 A;  5AE3 A;  3A4I A;  4K0K C;  1V25 A;  3VNS A;  2YWB A;  3IEU A;  2KZF A;  3T1Y C;  3RV2 A;  5KYT A;  3UZ0 A;  5BUS A;  1WH9 A;  2OO4 A;  3A9V A;  3LUS A;  4WV3 A;  3IEV A;  2UUA C;  3R44 A;  2XR1 A;  4L2Z A;  2UUC C;  1RY2 A;  2WD9 A;  4D57 A;  1NYE A;  2Y4O A;  4ZJZ A;  4DR7 C;  5IWA C;  3AF6 A;  2HHH C;  4AQY C;  2OPL A;  3IPL A;  4DV1 C;  2BH1 X;  4JI3 C;  4RMN A;  4DG9 A;  2ONF A;  3S82 A;  4DR4 C;  4FTF A;  5E7Q A;  3NYQ A;  4ODJ A;  3TQI A;  5CZX A;  4L4Q A;  4BC7 A;  1PG3 A;  4MTN A;  1XRC A;  4LF9 C;  4U5Y D;  3G7S A;  2VQE C;  5GTD A;  1USP A;  4WS9 A;  1O90 A;  5BSR A;  4LFA C;  4LFB C;  3DLP X;  4G1I A;  4D4G A;  1XNR C;  3E7X A;  1N33 C;  3DAY A;  3NYR A;  5K8F A;  3IML A;  4B3M C;  2UXB C;  3R9X A;  4LF5 C;  3C5E A;  1UKK A;  1USP B;  2UXC C;  1N32 C;  1O9T A;  1T5H X;  4YY3 C;  4XX2 A;  4DV5 C;  3JAM D;  2CY1 A;  2PT7 G;  5T8S A;  4GKJ C;  3FCC A;  4DG8 A;  5T8T A;  4DV0 C;  4JI0 C;  2D1R A;  4DCV A;  1IBM C;  4DUZ C;  5K85 A;  4BC9 A;  3J81 D;  2E7G A;  2BJO A;  4YHH C;  4IZ6 A;  3GR0 A;  1GPM A;  4JI5 C;  4B3S C;  3AF5 A;  1KKG A;  3I07 A;  4NXN C;  5BUQ A;  5IT9 D;  3PBK A;  1O93 A;  4DV3 C;  4JI1 C;  2P2M A;  2E8E A;  3SO4 A;  4FUT A;  4EAT A;  4JV5 C;  4JYA C;  2ATW A;  4R1L A;  5AE2 A;  4DV7 C;  1LCI A;  4RM3 A;  3L8C A;  2HJG A;  1ULT A;  1XRA A;  3TUF A;  5BST A;  1MDF A;  1EGA A;  4X64 C;  4K0B A;  1ML8 A;  3RG2 A;  4GKK C;  4GXR A;  5DV9 A;  3TDE A;  2OBV A;  4LFC C;  4DCU A;  4OX9 C;  4MH4 A;  3LNV A;  2CXC A;  1XRB A;  1XMQ C;  4X66 C;  4HPV A;  5BSW A;  4PRO C;  5BSV A;  3LAX A;  1K0R A;  5LMN C;  2UXD C;  2AYA A;  4X62 C;  1O92 A;  2QL8 A;  2QVZ X;  1FUG A;  1V26 A;  2Y27 A;  4RLQ A;  3GPC A;  2DPL A;  4RVO A;  2D27 A;  1MDB A;  3A9U A;  3ETO A;  3L95 X;  4KTV A;  2E5L C;  4LF7 C;  4I9F A;  1MKY A;  4JI6 C;  3UOW A;  3ETC A;  3KXW A;  3CJE A;  4G36 A;  3CW8 X;  4DR5 C;  1QWI A;  2P2J A;  5IFI A;  1HNX C;  5ADZ A;  2ZM6 C;  3E7W A;  5LMU C;  1N36 C;  3VNQ A;  1MXA A;  2UU9 C;  2P02 A;  1MD9 A;  4DUY C;  4GXQ A;  4JI8 C;  1WF3 A;  4OYC A;  4L7I A;  4B3R C;  3GR1 A;  4OXI A;  1HR0 C;  4LF4 C;  4DV6 C;  3R9W A;  4LF6 C;  3H2T A;  5A19 A;  5KYV A;  3EER A;  4KHP C;  3GKU A;  2P2B A;  1YJ7 A;  1T5D X;  4BSZ A;  3VNR A;  1IBK C;  2P20 A;  4R1M A;  2VQF C;  4PHT A;  4D56 A;  4JI7 C;  5KEI A;  2F4V C;  4I9G A;  3T1H C;  4D4I A;  1HNW C;  4JI4 C;  1FJG C;  4DR1 C;  3NI2 A;  5A2Q D;  2D1S A;  2EGT A;  3N54 B;  1HH2 P;  3J80 D;  4TPS B;  4JM1 A;  1N2F A;  2E8F A;  4DV2 C;  2UUB C;  1MXC A;  2V7B A;  1LQL A;  4R0M A;  4PZP A;  2D1T A;  2E0G A;  2QVX X;  3EQ6 A;  4DCT A;  4NDN A;  4RM2 A;  1HNZ C;  5H9U A;  4RLF A;  5BR8 C;  5BSM A;  1ZB9 A;  3NPD A;  1PA4 A;  5BSU A;  1MXB A;  2PRO A;  4NXM C;  1QM4 A;  2P2Q A;  1ZB8 A;  2OPL B;  2D7V A;  1L2F A;  5AE1 A;  4BBY A;  5JRH A;  4X65 C;  2JMP A;  5CZV A;  3PRO C;  3B7W A;  4DR6 C;  2QVY X;  3I08 A;  4BCA A;  3N2Q A;  4LE5 A;  1XNQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...