2WP0C

Crystal structure of a hoba-dnaa (domain i-ii) complex from helicobacter pylori.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
86
structure length
85
Chain Sequence
NIEKEILALVKQNPKVSLIEYENYFSQLKYNPNASKSDIAFFYAPNQVLCTTITAKYGALLKEILSQNKGMHLAHSVDVRIEVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOBA
publication title The Structure of a Dnaa/Hoba Complex from Helicobacter Pylori Provides Insight Into Regulation of DNA Replication in Bacteria.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Dna binding protein
total genus 23
structure length 85
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2wp0C00
4TPSB 2E0GA 2WP0C
chains in the Genus database with same CATH superfamily
3UZ0A 4ZLPA 2ASBA 4D57A 1WF3A 4D4IA 2Y4OA 4RVNA 3LGXA 3B7WA 5LMNC 1K0RA 1RY2A 4DV1C 1XS3A 3RG2A 1KKGA 4FUTA 2QVYX 1I94C 2CY1A 4DR6C 3UX3A 2PT7G 4JI6C 2QL8A 1EGAA 2EGTA 2DHMA 2OPLB 5KYTA 1ML8A 2VZEA 3CJEA 1XRBA 1NY8A 2D7VA 3LNOA 5A1IA 3TDEA 3K6RA 4DV4C 4JI5C 4DV5C 3UOWA 2Y27A 2P2FA 5A1GA 4OX9C 5KYVA 1VLAA 4YY3C 1UKKA 1QWIA 3UEBA 2M5OA 3R9WA 3N54B 4DR5C 3A4IA 4IZ6A 4RM2A 4DCVA 2UUBC 2DYJA 1TH5A 2E8FA 2UUCC 5CZXA 3NYQA 2Z51A 4NXMC 1FLOA 2KDNA 4DCTA 4LF7C 1N36C 2ZZMA 1IB8A 1IBLC 3IPLA 4FTFA 3FCEA 3FCCA 3KXWA 4GXRA 4D4GA 3DAYA 4LF8C 2MM9A 4R1LA 2V7BA 2D1TA 2P2JA 4G37A 2YWCA 4DV3C 4B3SC 3LAXA 5A19A 1MDFA 3AF6A 2UU9C 1ULTA 2PROA 1M6XA 1AMUA 4R0MA 4DCSA 3AY0A 1MXAA 3ETCA 3A9UA 3NYRA 3L8CA 5AE2A 4JI8C 4DR7C 3I08A 4DR3C 4NDNA 4L2ZA 5T8TA 5T8SA 2ZZNA 3LUSA 1QM4A 4MH4A 2UUAC 1UWDA 3GR0A 1P7LA 2KZFA 1N33C 1BA3A 4LF9C 1XMQC 2AYAA 3NI2A 2PN2A 1V25A 3IMLA 4JM1A 2HJGA 1T5DX 2OBVA 5IWAC 4AQYC 2P2QA 4L4QA 3UX2A 3IEVA 3H2TA 4YHHC 5A2QD 2JMPA 1PG4A 4KTTA 2YCBA 4JI3C 4DV2C 1P4EC 4LE5A 4BCAA 3N2QA 3TQIA 2ZM6C 3TUFA 4DG8A 3A25A 2BJOA 2YWBA 3E7XA 2E8EA 2WD9A 4PUHA 1XNRC 5BUQA 1N2FA 4JI7C 4JYAC 4NXNC 3SO4A 4EATA 4X65C 1GPMA 5BSUA 1MKYA 4LFBC 5K85A 3VNSA 1FUGA 4DR2C 3J81D 5JRHA 1O92A 1V26A 2P2BA 3PBKA 4JI0C 4DCUA 5LMUC 5E7QA 5H9UA 3E7WA 2M5HA 5IFIA 4PHTA 4BC9A 4DUYC 2UXBC 4DV0C 3VNRA 4G36A 2QVXX 2MCQA 4BC7A 2VSQA 1L2FA 1O90A 3O2EA 4FUQA 3R9XA 1MXCA 5CZVA 1HH2P 1PG3A 4WV3A 1YJ7A 3AF5A 4B3TC 5BSTA 1O93A 3GPCA 1V60A 4U5YD 3PROC 2E7GA 1USPA 4K0BA 1WCJA 4RMNA 4XX2A 5BUSA 1M6XC 4JI2C 3J80D 4JV5C 4BBYA 1HNWC 4PUIA 2D28C 1PA4A 1N34C 3NPDA 4ODJA 4LF6C 4WS9A 2P2MA 4D56A 4LFAC 4X66C 2D1RA 3CW9A 4G1IA 4R1MA 4KHPC 2D1SA 1MXBA 4GS5A 4ZJZA 2OO4A 4HPVA 2CU6A 2OPLA 4DV7C 2QVZX 1XNQC 3EQ6A 3TR3A 4I9FA 1O9TA 3A9VA 2JNVA 4B3RC 5BSMA 3L95X 5GTDA 4JI1C 4RLQA 2QW0X 4DR4C 4B3MC 5DV9A 2VQFC 1LCIA 3G7SA 2KZ0A 1PU1A 5FLXD 1WH9A 3VNQA 1IBMC 3JAMD 1P4EA 4RLFA 3DLPX 3I07A 5ADZA 5K8FA 5BSWA 1FJGC 3CQ2A 4LF5C 4LFCC 2D27A 3GR1A 4RVOA 1MDBA 1HNXC 2VQEC 2E8CA 3T1HC 4MTNA 2BH1X 4X62C 3LNVA 4K0KC 1NYEA 4GKJC 5AE1A 4BSZA 3A26A 5BSVA 4DG9A 4LF4C 1VEHA 4X64C 5LCIA 4OYCA 1XHJA 2YX1A 3OTOC 1IBKC 1HNZC 4DV6C 2D1QA 4PZPA 5KEIA 3R44A 1RG9A 4PROC 2E0GA 2WP0C 2CXCA 1JOSA 4OXIA 5BR8C 2XR1A 2Y4NA 1MD9A 1ZB9A 2UXDC 5IT9D 4IR7A 1XMOC 2F4VC 5AE3A 2P02A 4TPSB 2ONFA 3EERA 4I9GA 1LQLA 4DR1C 1J5EC 2MMAB 4DUZC 1XRCA 1HR0C 2P20A 4L7IA 4RM3A 3CW8X 4GKKC 5BURA 3C5EA 2ATWA 2DPLA 4PUGA 4ISBA 3ETOA 3T1YC 3RV2A 2UXCC 2HHHC 1ZB8A 3IEUA 5BSRA 4KTVA 1N32C 4NOZA 1XRAA 3DHVA 1T5HX 3CQ1A 3PESA 3S82A 1USPB 2NCLA 4JI4C 3CQ3A 3GKUA 2E5LC 4GXQA
chains in the Genus database with same CATH topology
3UZ0A 4ZLPA 2ASBA 4D57A 1WF3A 4D4IA 2Y4OA 4RVNA 3LGXA 3B7WA 5LMNC 1K0RA 1RY2A 4DV1C 3RG2A 1KKGA 4FUTA 2QVYX 1I94C 2CY1A 4DR6C 2PT7G 4JI6C 2QL8A 1EGAA 2EGTA 2OPLB 5KYTA 1ML8A 2VZEA 3CJEA 1XRBA 2D7VA 5A1IA 3TDEA 4DV4C 4JI5C 4DV5C 3UOWA 2Y27A 2P2FA 5A1GA 4OX9C 5KYVA 1VLAA 4YY3C 1UKKA 1QWIA 3R9WA 3N54B 4DR5C 3A4IA 4IZ6A 4RM2A 4DCVA 2UUBC 2DYJA 2E8FA 2UUCC 5CZXA 3NYQA 4NXMC 4DCTA 4LF7C 1N36C 1IBLC 3IPLA 4FTFA 3FCEA 3FCCA 3KXWA 4GXRA 4D4GA 3DAYA 4LF8C 4R1LA 2V7BA 2D1TA 2P2JA 4G37A 2YWCA 4DV3C 4B3SC 3LAXA 5A19A 1MDFA 3AF6A 2UU9C 1ULTA 2PROA 1AMUA 4R0MA 4DCSA 1MXAA 3ETCA 3A9UA 3NYRA 3L8CA 5AE2A 4JI8C 4DR7C 3I08A 4DR3C 4NDNA 4L2ZA 5T8TA 5T8SA 3LUSA 1QM4A 4MH4A 2UUAC 3GR0A 1P7LA 2KZFA 1N33C 1BA3A 4LF9C 1XMQC 2AYAA 3NI2A 2PN2A 1V25A 3IMLA 4JM1A 2HJGA 1T5DX 2OBVA 5IWAC 4AQYC 2P2QA 4L4QA 3IEVA 3H2TA 4YHHC 5A2QD 2JMPA 1PG4A 4KTTA 2YCBA 4JI3C 4DV2C 4LE5A 4BCAA 3N2QA 3TQIA 2ZM6C 3TUFA 4DG8A 2BJOA 2YWBA 3E7XA 2E8EA 2WD9A 1XNRC 5BUQA 1N2FA 4JI7C 4JYAC 4NXNC 3SO4A 4EATA 4X65C 1GPMA 5BSUA 1MKYA 4LFBC 5K85A 3VNSA 1FUGA 4DR2C 3J81D 5JRHA 1O92A 1V26A 2P2BA 3PBKA 4JI0C 4DCUA 5LMUC 5E7QA 5H9UA 3E7WA 5IFIA 4PHTA 4BC9A 4DUYC 2UXBC 4DV0C 3VNRA 4G36A 2QVXX 4BC7A 2VSQA 1L2FA 1O90A 4FUQA 3R9XA 1MXCA 5CZVA 1HH2P 1PG3A 4WV3A 1YJ7A 3AF5A 4B3TC 5BSTA 1O93A 3GPCA 4U5YD 3PROC 2E7GA 1USPA 4K0BA 4RMNA 4XX2A 5BUSA 4JI2C 3J80D 4JV5C 4BBYA 1HNWC 2D28C 1PA4A 1N34C 3NPDA 4ODJA 4LF6C 4WS9A 2P2MA 4D56A 4LFAC 4X66C 2D1RA 3CW9A 4G1IA 4R1MA 4KHPC 2D1SA 1MXBA 4GS5A 4ZJZA 2OO4A 4HPVA 2OPLA 4DV7C 2QVZX 1XNQC 3EQ6A 4I9FA 1O9TA 3A9VA 4B3RC 5BSMA 3L95X 5GTDA 4JI1C 4RLQA 2QW0X 4DR4C 4B3MC 5DV9A 2VQFC 1LCIA 3G7SA 5FLXD 1WH9A 3VNQA 1IBMC 3JAMD 4RLFA 3DLPX 3I07A 5ADZA 5K8FA 5BSWA 1FJGC 4LF5C 4LFCC 2D27A 3GR1A 4RVOA 1MDBA 1HNXC 2VQEC 2E8CA 3T1HC 4MTNA 2BH1X 4X62C 3LNVA 4K0KC 1NYEA 4GKJC 5AE1A 4BSZA 5BSVA 4DG9A 4LF4C 4X64C 4OYCA 3OTOC 1IBKC 1HNZC 4DV6C 2D1QA 4PZPA 5KEIA 3R44A 1RG9A 4PROC 2E0GA 2WP0C 2CXCA 1JOSA 4OXIA 5BR8C 2XR1A 2Y4NA 1MD9A 1ZB9A 2UXDC 5IT9D 4IR7A 1XMOC 2F4VC 5AE3A 2P02A 4TPSB 2ONFA 3EERA 4I9GA 1LQLA 4DR1C 1J5EC 4DUZC 1XRCA 1HR0C 2P20A 4L7IA 4RM3A 3CW8X 4GKKC 5BURA 3C5EA 2ATWA 2DPLA 4ISBA 3ETOA 3T1YC 3RV2A 2UXCC 2HHHC 1ZB8A 3IEUA 5BSRA 4KTVA 1N32C 4NOZA 1XRAA 3DHVA 1T5HX 3PESA 3S82A 1USPB 4JI4C 3GKUA 2E5LC 4GXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TPS B;  2E0G A;  2WP0 C; 
#chains in the Genus database with same CATH topology
 3UZ0 A;  4ZLP A;  2ASB A;  4D57 A;  1WF3 A;  4D4I A;  2Y4O A;  4RVN A;  3LGX A;  3B7W A;  5LMN C;  1K0R A;  1RY2 A;  4DV1 C;  1XS3 A;  3RG2 A;  1KKG A;  4FUT A;  2QVY X;  1I94 C;  2CY1 A;  4DR6 C;  3UX3 A;  2PT7 G;  4JI6 C;  2QL8 A;  1EGA A;  2EGT A;  2DHM A;  2OPL B;  5KYT A;  1ML8 A;  2VZE A;  3CJE A;  1XRB A;  1NY8 A;  2D7V A;  3LNO A;  5A1I A;  3TDE A;  3K6R A;  4DV4 C;  4JI5 C;  4DV5 C;  3UOW A;  2Y27 A;  2P2F A;  5A1G A;  4OX9 C;  5KYV A;  1VLA A;  4YY3 C;  1UKK A;  1QWI A;  3UEB A;  2M5O A;  3R9W A;  3N54 B;  4DR5 C;  3A4I A;  4IZ6 A;  4RM2 A;  4DCV A;  2UUB C;  2DYJ A;  1TH5 A;  2E8F A;  2UUC C;  5CZX A;  3NYQ A;  2Z51 A;  4NXM C;  1FLO A;  2KDN A;  4DCT A;  4LF7 C;  1N36 C;  2ZZM A;  1IB8 A;  1IBL C;  3IPL A;  4FTF A;  3FCE A;  3FCC A;  3KXW A;  4GXR A;  4D4G A;  3DAY A;  4LF8 C;  2MM9 A;  4R1L A;  2V7B A;  2D1T A;  2P2J A;  4G37 A;  2YWC A;  4DV3 C;  4B3S C;  3LAX A;  5A19 A;  1MDF A;  3AF6 A;  2UU9 C;  1ULT A;  2PRO A;  1M6X A;  1AMU A;  4R0M A;  4DCS A;  3AY0 A;  1MXA A;  3ETC A;  3A9U A;  3NYR A;  3L8C A;  5AE2 A;  4JI8 C;  4DR7 C;  3I08 A;  4DR3 C;  4NDN A;  4L2Z A;  5T8T A;  5T8S A;  2ZZN A;  3LUS A;  1QM4 A;  4MH4 A;  2UUA C;  1UWD A;  3GR0 A;  1P7L A;  2KZF A;  1N33 C;  1BA3 A;  4LF9 C;  1XMQ C;  2AYA A;  3NI2 A;  2PN2 A;  1V25 A;  3IML A;  4JM1 A;  2HJG A;  1T5D X;  2OBV A;  5IWA C;  4AQY C;  2P2Q A;  4L4Q A;  3UX2 A;  3IEV A;  3H2T A;  4YHH C;  5A2Q D;  2JMP A;  1PG4 A;  4KTT A;  2YCB A;  4JI3 C;  4DV2 C;  1P4E C;  4LE5 A;  4BCA A;  3N2Q A;  3TQI A;  2ZM6 C;  3TUF A;  4DG8 A;  3A25 A;  2BJO A;  2YWB A;  3E7X A;  2E8E A;  2WD9 A;  4PUH A;  1XNR C;  5BUQ A;  1N2F A;  4JI7 C;  4JYA C;  4NXN C;  3SO4 A;  4EAT A;  4X65 C;  1GPM A;  5BSU A;  1MKY A;  4LFB C;  5K85 A;  3VNS A;  1FUG A;  4DR2 C;  3J81 D;  5JRH A;  1O92 A;  1V26 A;  2P2B A;  3PBK A;  4JI0 C;  4DCU A;  5LMU C;  5E7Q A;  5H9U A;  3E7W A;  2M5H A;  5IFI A;  4PHT A;  4BC9 A;  4DUY C;  2UXB C;  4DV0 C;  3VNR A;  4G36 A;  2QVX X;  2MCQ A;  4BC7 A;  2VSQ A;  1L2F A;  1O90 A;  3O2E A;  4FUQ A;  3R9X A;  1MXC A;  5CZV A;  1HH2 P;  1PG3 A;  4WV3 A;  1YJ7 A;  3AF5 A;  4B3T C;  5BST A;  1O93 A;  3GPC A;  1V60 A;  4U5Y D;  3PRO C;  2E7G A;  1USP A;  4K0B A;  1WCJ A;  4RMN A;  4XX2 A;  5BUS A;  1M6X C;  4JI2 C;  3J80 D;  4JV5 C;  4BBY A;  1HNW C;  4PUI A;  2D28 C;  1PA4 A;  1N34 C;  3NPD A;  4ODJ A;  4LF6 C;  4WS9 A;  2P2M A;  4D56 A;  4LFA C;  4X66 C;  2D1R A;  3CW9 A;  4G1I A;  4R1M A;  4KHP C;  2D1S A;  1MXB A;  4GS5 A;  4ZJZ A;  2OO4 A;  4HPV A;  2CU6 A;  2OPL A;  4DV7 C;  2QVZ X;  1XNQ C;  3EQ6 A;  3TR3 A;  4I9F A;  1O9T A;  3A9V A;  2JNV A;  4B3R C;  5BSM A;  3L95 X;  5GTD A;  4JI1 C;  4RLQ A;  2QW0 X;  4DR4 C;  4B3M C;  5DV9 A;  2VQF C;  1LCI A;  3G7S A;  2KZ0 A;  1PU1 A;  5FLX D;  1WH9 A;  3VNQ A;  1IBM C;  3JAM D;  1P4E A;  4RLF A;  3DLP X;  3I07 A;  5ADZ A;  5K8F A;  5BSW A;  1FJG C;  3CQ2 A;  4LF5 C;  4LFC C;  2D27 A;  3GR1 A;  4RVO A;  1MDB A;  1HNX C;  2VQE C;  2E8C A;  3T1H C;  4MTN A;  2BH1 X;  4X62 C;  3LNV A;  4K0K C;  1NYE A;  4GKJ C;  5AE1 A;  4BSZ A;  3A26 A;  5BSV A;  4DG9 A;  4LF4 C;  1VEH A;  4X64 C;  5LCI A;  4OYC A;  1XHJ A;  2YX1 A;  3OTO C;  1IBK C;  1HNZ C;  4DV6 C;  2D1Q A;  4PZP A;  5KEI A;  3R44 A;  1RG9 A;  4PRO C;  2E0G A;  2WP0 C;  2CXC A;  1JOS A;  4OXI A;  5BR8 C;  2XR1 A;  2Y4N A;  1MD9 A;  1ZB9 A;  2UXD C;  5IT9 D;  4IR7 A;  1XMO C;  2F4V C;  5AE3 A;  2P02 A;  4TPS B;  2ONF A;  3EER A;  4I9G A;  1LQL A;  4DR1 C;  1J5E C;  2MMA B;  4DUZ C;  1XRC A;  1HR0 C;  2P20 A;  4L7I A;  4RM3 A;  3CW8 X;  4GKK C;  5BUR A;  3C5E A;  2ATW A;  2DPL A;  4PUG A;  4ISB A;  3ETO A;  3T1Y C;  3RV2 A;  2UXC C;  2HHH C;  1ZB8 A;  3IEU A;  5BSR A;  4KTV A;  1N32 C;  4NOZ A;  1XRA A;  3DHV A;  1T5H X;  3CQ1 A;  3PES A;  3S82 A;  1USP B;  2NCL A;  4JI4 C;  3CQ3 A;  3GKU A;  2E5L C;  4GXQ A; 
#chains in the Genus database with same CATH homology
 3UZ0 A;  4ZLP A;  2ASB A;  4D57 A;  1WF3 A;  4D4I A;  2Y4O A;  4RVN A;  3LGX A;  3B7W A;  5LMN C;  1K0R A;  1RY2 A;  4DV1 C;  3RG2 A;  1KKG A;  4FUT A;  2QVY X;  1I94 C;  2CY1 A;  4DR6 C;  2PT7 G;  4JI6 C;  2QL8 A;  1EGA A;  2EGT A;  2OPL B;  5KYT A;  1ML8 A;  2VZE A;  3CJE A;  1XRB A;  2D7V A;  5A1I A;  3TDE A;  4DV4 C;  4JI5 C;  4DV5 C;  3UOW A;  2Y27 A;  2P2F A;  5A1G A;  4OX9 C;  5KYV A;  1VLA A;  4YY3 C;  1UKK A;  1QWI A;  3R9W A;  3N54 B;  4DR5 C;  3A4I A;  4IZ6 A;  4RM2 A;  4DCV A;  2UUB C;  2DYJ A;  2E8F A;  2UUC C;  5CZX A;  3NYQ A;  4NXM C;  4DCT A;  4LF7 C;  1N36 C;  1IBL C;  3IPL A;  4FTF A;  3FCE A;  3FCC A;  3KXW A;  4GXR A;  4D4G A;  3DAY A;  4LF8 C;  4R1L A;  2V7B A;  2D1T A;  2P2J A;  4G37 A;  2YWC A;  4DV3 C;  4B3S C;  3LAX A;  5A19 A;  1MDF A;  3AF6 A;  2UU9 C;  1ULT A;  2PRO A;  1AMU A;  4R0M A;  4DCS A;  1MXA A;  3ETC A;  3A9U A;  3NYR A;  3L8C A;  5AE2 A;  4JI8 C;  4DR7 C;  3I08 A;  4DR3 C;  4NDN A;  4L2Z A;  5T8T A;  5T8S A;  3LUS A;  1QM4 A;  4MH4 A;  2UUA C;  3GR0 A;  1P7L A;  2KZF A;  1N33 C;  1BA3 A;  4LF9 C;  1XMQ C;  2AYA A;  3NI2 A;  2PN2 A;  1V25 A;  3IML A;  4JM1 A;  2HJG A;  1T5D X;  2OBV A;  5IWA C;  4AQY C;  2P2Q A;  4L4Q A;  3IEV A;  3H2T A;  4YHH C;  5A2Q D;  2JMP A;  1PG4 A;  4KTT A;  2YCB A;  4JI3 C;  4DV2 C;  4LE5 A;  4BCA A;  3N2Q A;  3TQI A;  2ZM6 C;  3TUF A;  4DG8 A;  2BJO A;  2YWB A;  3E7X A;  2E8E A;  2WD9 A;  1XNR C;  5BUQ A;  1N2F A;  4JI7 C;  4JYA C;  4NXN C;  3SO4 A;  4EAT A;  4X65 C;  1GPM A;  5BSU A;  1MKY A;  4LFB C;  5K85 A;  3VNS A;  1FUG A;  4DR2 C;  3J81 D;  5JRH A;  1O92 A;  1V26 A;  2P2B A;  3PBK A;  4JI0 C;  4DCU A;  5LMU C;  5E7Q A;  5H9U A;  3E7W A;  5IFI A;  4PHT A;  4BC9 A;  4DUY C;  2UXB C;  4DV0 C;  3VNR A;  4G36 A;  2QVX X;  4BC7 A;  2VSQ A;  1L2F A;  1O90 A;  4FUQ A;  3R9X A;  1MXC A;  5CZV A;  1HH2 P;  1PG3 A;  4WV3 A;  1YJ7 A;  3AF5 A;  4B3T C;  5BST A;  1O93 A;  3GPC A;  4U5Y D;  3PRO C;  2E7G A;  1USP A;  4K0B A;  4RMN A;  4XX2 A;  5BUS A;  4JI2 C;  3J80 D;  4JV5 C;  4BBY A;  1HNW C;  2D28 C;  1PA4 A;  1N34 C;  3NPD A;  4ODJ A;  4LF6 C;  4WS9 A;  2P2M A;  4D56 A;  4LFA C;  4X66 C;  2D1R A;  3CW9 A;  4G1I A;  4R1M A;  4KHP C;  2D1S A;  1MXB A;  4GS5 A;  4ZJZ A;  2OO4 A;  4HPV A;  2OPL A;  4DV7 C;  2QVZ X;  1XNQ C;  3EQ6 A;  4I9F A;  1O9T A;  3A9V A;  4B3R C;  5BSM A;  3L95 X;  5GTD A;  4JI1 C;  4RLQ A;  2QW0 X;  4DR4 C;  4B3M C;  5DV9 A;  2VQF C;  1LCI A;  3G7S A;  5FLX D;  1WH9 A;  3VNQ A;  1IBM C;  3JAM D;  4RLF A;  3DLP X;  3I07 A;  5ADZ A;  5K8F A;  5BSW A;  1FJG C;  4LF5 C;  4LFC C;  2D27 A;  3GR1 A;  4RVO A;  1MDB A;  1HNX C;  2VQE C;  2E8C A;  3T1H C;  4MTN A;  2BH1 X;  4X62 C;  3LNV A;  4K0K C;  1NYE A;  4GKJ C;  5AE1 A;  4BSZ A;  5BSV A;  4DG9 A;  4LF4 C;  4X64 C;  4OYC A;  3OTO C;  1IBK C;  1HNZ C;  4DV6 C;  2D1Q A;  4PZP A;  5KEI A;  3R44 A;  1RG9 A;  4PRO C;  2E0G A;  2WP0 C;  2CXC A;  1JOS A;  4OXI A;  5BR8 C;  2XR1 A;  2Y4N A;  1MD9 A;  1ZB9 A;  2UXD C;  5IT9 D;  4IR7 A;  1XMO C;  2F4V C;  5AE3 A;  2P02 A;  4TPS B;  2ONF A;  3EER A;  4I9G A;  1LQL A;  4DR1 C;  1J5E C;  4DUZ C;  1XRC A;  1HR0 C;  2P20 A;  4L7I A;  4RM3 A;  3CW8 X;  4GKK C;  5BUR A;  3C5E A;  2ATW A;  2DPL A;  4ISB A;  3ETO A;  3T1Y C;  3RV2 A;  2UXC C;  2HHH C;  1ZB8 A;  3IEU A;  5BSR A;  4KTV A;  1N32 C;  4NOZ A;  1XRA A;  3DHV A;  1T5H X;  3PES A;  3S82 A;  1USP B;  4JI4 C;  3GKU A;  2E5L C;  4GXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...