2WP0C

Crystal structure of a hoba-dnaa (domain i-ii) complex from helicobacter pylori.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
86
structure length
85
Chain Sequence
NIEKEILALVKQNPKVSLIEYENYFSQLKYNPNASKSDIAFFYAPNQVLCTTITAKYGALLKEILSQNKGMHLAHSVDVRIEVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HOBA
publication title The Structure of a Dnaa/Hoba Complex from Helicobacter Pylori Provides Insight Into Regulation of DNA Replication in Bacteria.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 23
structure length 85
sequence length 86
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2wp0C00
2E0GA 2WP0C 4TPSB
chains in the Genus database with same CATH superfamily
1J5EC 4DR1C 5E7QA 3VNRA 5BURA 1RY2A 4NOZA 5GTDA 5K8FA 1EGAA 2Y27A 2EGTA 4KTVA 3J81D 1N2FA 3A9UA 5AE1A 3L95X 2NCLA 4RM2A 3A4IA 2P2JA 5LMUC 2CXCA 1T5DX 3DHVA 4DV3C 4BBYA 3T1HC 4BCAA 5AE2A 2YCBA 3LAXA 3AF5A 4GS5A 3L8CA 3VNQA 3C5EA 4L7IA 4FTFA 1WH9A 2D1SA 1MXBA 3UOWA 4NXNC 3UEBA 4DG9A 4PUIA 3LGXA 3ETOA 4JI0C 2WD9A 3NI2A 3RG2A 1USPB 4K0KC 1O92A 3DAYA 2ZM6C 4DR7C 2P20A 4DUYC 4PUHA 5BSUA 3S82A 4IZ6A 3TUFA 1P4EC 5A1IA 3H2TA 1O9TA 1PA4A 4D4GA 1V26A 4GXQA 2QVZX 3CW8X 1XMOC 3IEUA 4JI7C 4IR7A 2HHHC 4DV4C 2D27A 5BUSA 3CQ2A 4B3TC 1O90A 1XRCA 4FUTA 1GPMA 1ZB9A 1MDFA 2VQEC 4G37A 1LCIA 3TR3A 1FLOA 2E8EA 4LFBC 1ZB8A 2YWBA 1QWIA 2E0GA 2JMPA 3FCCA 1HH2P 4LFCC 5KEIA 4DV7C 4NDNA 3R9WA 2YX1A 3GPCA 4XX2A 4X66C 3E7WA 4RVOA 4YY3C 5KYVA 1KKGA 3PROC 2KZFA 4EATA 4LF9C 3ETCA 3G7SA 2OPLB 4DCUA 2M5OA 5CZVA 5T8SA 3CQ1A 4X62C 2KZ0A 4LE5A 2UUAC 4LF7C 1JOSA 3A26A 1N32C 3GR1A 2PN2A 4GXRA 5BSVA 4JI6C 5BSTA 1MDBA 4JI3C 3R9XA 3NYRA 2CY1A 2D1TA 4MTNA 4PUGA 4WV3A 1USPA 2AYAA 4AQYC 2DPLA 1RG9A 2UXBC 3TDEA 1HNXC 1TH5A 2UUCC 3E7XA 1P7LA 2E7GA 3GKUA 2D1QA 4LFAC 1I94C 3FCEA 4RLFA 2UXDC 4NXMC 4BC9A 1XS3A 2P2BA 2ONFA 4DV0C 2Y4NA 2BH1X 4D57A 1XMQC 5LMNC 4ODJA 3NPDA 1MXCA 2P2MA 2D1RA 2ASBA 3VNSA 3GR0A 1PG4A 5K85A 2P2QA 3R44A 1LQLA 2QVXX 4L4QA 2P02A 2OBVA 1NYEA 4X64C 2CU6A 4MH4A 1BA3A 4RM3A 4JI8C 1UWDA 5BUQA 4ZJZA 2MMAB 3CW9A 3LNOA 4LF4C 3A9VA 5DV9A 1T5HX 2QL8A 1PU1A 4DR2C 4PHTA 2OPLA 5A19A 3IPLA 4LF6C 5T8TA 2VZEA 4RLQA 5IT9D 2UXCC 2PROA 1IBKC 1PG3A 5BSWA 1V25A 1L2FA 2E5LC 3CQ3A 2MCQA 5CZXA 1K0RA 3O2EA 4I9GA 4L2ZA 4R0MA 4PROC 4DCTA 4ISBA 4OYCA 4YHHC 4ZLPA 4DG8A 2QVYX 2XR1A 4JV5C 3OTOC 4RMNA 1UKKA 3IMLA 3LUSA 3N54B 4B3MC 1M6XA 4OXIA 5H9UA 2BJOA 5JRHA 1MKYA 3KXWA 4DV2C 2UUBC 4DR4C 1NY8A 3T1YC 1O93A 2WP0C 3UX3A 5A1GA 1XRAA 3AY0A 3TQIA 4HPVA 5IWAC 4RVNA 3NYQA 1ULTA 4JI5C 4JM1A 3K6RA 3PESA 4R1MA 2UU9C 4JI1C 4K0BA 3CJEA 3UZ0A 1XNRC 2DHMA 2M5HA 2V7BA 4GKKC 3SO4A 1AMUA 1IB8A 4U5YD 4KTTA 2YWCA 4FUQA 4WS9A 4OX9C 5IFIA 3J80D 4DCVA 1HR0C 5KYTA 4DV5C 3AF6A 1V60A 1MXAA 4BSZA 4JI2C 5AE3A 3RV2A 5BSMA 4B3RC 5FLXD 4D56A 3I07A 5ADZA 2Z51A 4DCSA 5BSRA 2F4VC 1HNWC 4X65C 2HJGA 2P2FA 2JNVA 2ZZMA 1FUGA 3N2QA 4JYAC 1M6XC 2DYJA 2D7VA 4DR5C 1N36C 4G1IA 1XRBA 4G36A 3DLPX 2VQFC 1WCJA 2Y4OA 1MD9A 2MM9A 5A2QD 4DUZC 3LNVA 1N33C 2ATWA 2QW0X 2VSQA 1XHJA 4KHPC 1VLAA 1XNQC 1IBMC 4DV1C 2ZZNA 2KDNA 1QM4A 1YJ7A 3JAMD 2E8CA 3B7WA 1FJGC 1ML8A 4B3SC 5LCIA 2PT7G 3IEVA 1HNZC 4PZPA 4LF5C 2D28C 4DR6C 5BR8C 1IBLC 1WF3A 1P4EA 4BC7A 1VEHA 4DV6C 3EQ6A 4LF8C 3A25A 3I08A 3PBKA 4TPSB 4R1LA 1N34C 4GKJC 2OO4A 3EERA 2E8FA 4D4IA 3UX2A 4I9FA 4DR3C 4JI4C
chains in the Genus database with same CATH topology
1J5EC 4DR1C 5E7QA 3VNRA 5BURA 1RY2A 4NOZA 5GTDA 5K8FA 1EGAA 2Y27A 2EGTA 4KTVA 3J81D 1N2FA 3A9UA 5AE1A 3L95X 4RM2A 3A4IA 2P2JA 5LMUC 2CXCA 1T5DX 3DHVA 4DV3C 4BBYA 3T1HC 4BCAA 5AE2A 2YCBA 3LAXA 3AF5A 4GS5A 3L8CA 3VNQA 3C5EA 4L7IA 4FTFA 1WH9A 2D1SA 1MXBA 3UOWA 4NXNC 4DG9A 3LGXA 3ETOA 4JI0C 2WD9A 3NI2A 3RG2A 1USPB 4K0KC 1O92A 3DAYA 2ZM6C 4DR7C 2P20A 4DUYC 5BSUA 3S82A 4IZ6A 3TUFA 5A1IA 3H2TA 1O9TA 1PA4A 4D4GA 1V26A 4GXQA 1XMOC 2QVZX 3CW8X 3IEUA 4JI7C 4IR7A 2HHHC 4DV4C 2D27A 5BUSA 4B3TC 1O90A 1XRCA 4FUTA 1GPMA 1ZB9A 1MDFA 2VQEC 4G37A 1LCIA 2E8EA 4LFBC 1ZB8A 2YWBA 1QWIA 2E0GA 2JMPA 3FCCA 1HH2P 4LFCC 5KEIA 4DV7C 4NDNA 3R9WA 3GPCA 4XX2A 4X66C 3E7WA 4RVOA 4YY3C 5KYVA 1KKGA 3PROC 2KZFA 4EATA 4LF9C 3ETCA 3G7SA 2OPLB 4DCUA 5CZVA 5T8SA 4X62C 4LE5A 2UUAC 4LF7C 1JOSA 1N32C 3GR1A 2PN2A 4GXRA 5BSVA 4JI6C 5BSTA 1MDBA 4JI3C 3R9XA 3NYRA 2CY1A 2D1TA 4MTNA 4WV3A 1USPA 2AYAA 4AQYC 2DPLA 1RG9A 2UXBC 3TDEA 1HNXC 2UUCC 3E7XA 1P7LA 2E7GA 3GKUA 2D1QA 4LFAC 1I94C 3FCEA 4RLFA 2UXDC 4NXMC 4BC9A 2P2BA 2ONFA 4DV0C 2Y4NA 2BH1X 4D57A 1XMQC 5LMNC 4ODJA 3NPDA 1MXCA 2P2MA 2D1RA 2ASBA 3VNSA 3GR0A 1PG4A 5K85A 2P2QA 3R44A 1LQLA 2QVXX 4L4QA 2P02A 2OBVA 1NYEA 4X64C 4MH4A 1BA3A 4RM3A 4JI8C 5BUQA 4ZJZA 3CW9A 4LF4C 3A9VA 5DV9A 1T5HX 2QL8A 4DR2C 4PHTA 2OPLA 5A19A 3IPLA 4LF6C 5T8TA 2VZEA 4RLQA 5IT9D 2UXCC 2PROA 1IBKC 1PG3A 5BSWA 1V25A 1L2FA 2E5LC 5CZXA 1K0RA 4I9GA 4L2ZA 4R0MA 4PROC 4DCTA 4ISBA 4OYCA 4YHHC 4ZLPA 4DG8A 2QVYX 2XR1A 4JV5C 3OTOC 4RMNA 1UKKA 3IMLA 3LUSA 3N54B 4B3MC 4OXIA 5H9UA 2BJOA 5JRHA 1MKYA 3KXWA 4DV2C 2UUBC 4DR4C 3T1YC 1O93A 2WP0C 5A1GA 1XRAA 3TQIA 4HPVA 5IWAC 4RVNA 3NYQA 1ULTA 4JI5C 4JM1A 3PESA 4R1MA 2UU9C 4JI1C 4K0BA 3CJEA 3UZ0A 1XNRC 2V7BA 4GKKC 3SO4A 1AMUA 4U5YD 4KTTA 2YWCA 4FUQA 4WS9A 4OX9C 5IFIA 3J80D 4DCVA 1HR0C 5KYTA 4DV5C 3AF6A 1MXAA 4BSZA 4JI2C 5AE3A 3RV2A 5BSMA 4B3RC 5FLXD 4D56A 3I07A 5ADZA 4DCSA 5BSRA 2F4VC 1HNWC 4X65C 2HJGA 2P2FA 1FUGA 3N2QA 4JYAC 2DYJA 2D7VA 4DR5C 1N36C 4G1IA 1XRBA 4G36A 3DLPX 2VQFC 2Y4OA 1MD9A 5A2QD 4DUZC 3LNVA 1N33C 2ATWA 2QW0X 2VSQA 4KHPC 1VLAA 1XNQC 1IBMC 4DV1C 1QM4A 1YJ7A 3JAMD 2E8CA 3B7WA 1FJGC 1ML8A 4B3SC 2PT7G 3IEVA 1HNZC 4PZPA 4LF5C 2D28C 4DR6C 5BR8C 1IBLC 1WF3A 4BC7A 4DV6C 3EQ6A 4LF8C 3I08A 3PBKA 4TPSB 4R1LA 1N34C 4GKJC 2OO4A 3EERA 2E8FA 4D4IA 4I9FA 4DR3C 4JI4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0G A;  2WP0 C;  4TPS B; 
#chains in the Genus database with same CATH topology
 1J5E C;  4DR1 C;  5E7Q A;  3VNR A;  5BUR A;  1RY2 A;  4NOZ A;  5GTD A;  5K8F A;  1EGA A;  2Y27 A;  2EGT A;  4KTV A;  3J81 D;  1N2F A;  3A9U A;  5AE1 A;  3L95 X;  2NCL A;  4RM2 A;  3A4I A;  2P2J A;  5LMU C;  2CXC A;  1T5D X;  3DHV A;  4DV3 C;  4BBY A;  3T1H C;  4BCA A;  5AE2 A;  2YCB A;  3LAX A;  3AF5 A;  4GS5 A;  3L8C A;  3VNQ A;  3C5E A;  4L7I A;  4FTF A;  1WH9 A;  2D1S A;  1MXB A;  3UOW A;  4NXN C;  3UEB A;  4DG9 A;  4PUI A;  3LGX A;  3ETO A;  4JI0 C;  2WD9 A;  3NI2 A;  3RG2 A;  1USP B;  4K0K C;  1O92 A;  3DAY A;  2ZM6 C;  4DR7 C;  2P20 A;  4DUY C;  4PUH A;  5BSU A;  3S82 A;  4IZ6 A;  3TUF A;  1P4E C;  5A1I A;  3H2T A;  1O9T A;  1PA4 A;  4D4G A;  1V26 A;  4GXQ A;  2QVZ X;  3CW8 X;  1XMO C;  3IEU A;  4JI7 C;  4IR7 A;  2HHH C;  4DV4 C;  2D27 A;  5BUS A;  3CQ2 A;  4B3T C;  1O90 A;  1XRC A;  4FUT A;  1GPM A;  1ZB9 A;  1MDF A;  2VQE C;  4G37 A;  1LCI A;  3TR3 A;  1FLO A;  2E8E A;  4LFB C;  1ZB8 A;  2YWB A;  1QWI A;  2E0G A;  2JMP A;  3FCC A;  1HH2 P;  4LFC C;  5KEI A;  4DV7 C;  4NDN A;  3R9W A;  2YX1 A;  3GPC A;  4XX2 A;  4X66 C;  3E7W A;  4RVO A;  4YY3 C;  5KYV A;  1KKG A;  3PRO C;  2KZF A;  4EAT A;  4LF9 C;  3ETC A;  3G7S A;  2OPL B;  4DCU A;  2M5O A;  5CZV A;  5T8S A;  3CQ1 A;  4X62 C;  2KZ0 A;  4LE5 A;  2UUA C;  4LF7 C;  1JOS A;  3A26 A;  1N32 C;  3GR1 A;  2PN2 A;  4GXR A;  5BSV A;  4JI6 C;  5BST A;  1MDB A;  4JI3 C;  3R9X A;  3NYR A;  2CY1 A;  2D1T A;  4MTN A;  4PUG A;  4WV3 A;  1USP A;  2AYA A;  4AQY C;  2DPL A;  1RG9 A;  2UXB C;  3TDE A;  1HNX C;  1TH5 A;  2UUC C;  3E7X A;  1P7L A;  2E7G A;  3GKU A;  2D1Q A;  4LFA C;  1I94 C;  3FCE A;  4RLF A;  2UXD C;  4NXM C;  4BC9 A;  1XS3 A;  2P2B A;  2ONF A;  4DV0 C;  2Y4N A;  2BH1 X;  4D57 A;  1XMQ C;  5LMN C;  4ODJ A;  3NPD A;  1MXC A;  2P2M A;  2D1R A;  2ASB A;  3VNS A;  3GR0 A;  1PG4 A;  5K85 A;  2P2Q A;  3R44 A;  1LQL A;  2QVX X;  4L4Q A;  2P02 A;  2OBV A;  1NYE A;  4X64 C;  2CU6 A;  4MH4 A;  1BA3 A;  4RM3 A;  4JI8 C;  1UWD A;  5BUQ A;  4ZJZ A;  2MMA B;  3CW9 A;  3LNO A;  4LF4 C;  3A9V A;  5DV9 A;  1T5H X;  2QL8 A;  1PU1 A;  4DR2 C;  4PHT A;  2OPL A;  5A19 A;  3IPL A;  4LF6 C;  5T8T A;  2VZE A;  4RLQ A;  5IT9 D;  2UXC C;  2PRO A;  1IBK C;  1PG3 A;  5BSW A;  1V25 A;  1L2F A;  2E5L C;  3CQ3 A;  2MCQ A;  5CZX A;  1K0R A;  3O2E A;  4I9G A;  4L2Z A;  4R0M A;  4PRO C;  4DCT A;  4ISB A;  4OYC A;  4YHH C;  4ZLP A;  4DG8 A;  2QVY X;  2XR1 A;  4JV5 C;  3OTO C;  4RMN A;  1UKK A;  3IML A;  3LUS A;  3N54 B;  4B3M C;  1M6X A;  4OXI A;  5H9U A;  2BJO A;  5JRH A;  1MKY A;  3KXW A;  4DV2 C;  2UUB C;  4DR4 C;  1NY8 A;  3T1Y C;  1O93 A;  2WP0 C;  3UX3 A;  5A1G A;  1XRA A;  3AY0 A;  3TQI A;  4HPV A;  5IWA C;  4RVN A;  3NYQ A;  1ULT A;  4JI5 C;  4JM1 A;  3K6R A;  3PES A;  4R1M A;  2UU9 C;  4JI1 C;  4K0B A;  3CJE A;  3UZ0 A;  1XNR C;  2DHM A;  2M5H A;  2V7B A;  4GKK C;  3SO4 A;  1AMU A;  1IB8 A;  4U5Y D;  4KTT A;  2YWC A;  4FUQ A;  4WS9 A;  4OX9 C;  5IFI A;  3J80 D;  4DCV A;  1HR0 C;  5KYT A;  4DV5 C;  3AF6 A;  1V60 A;  1MXA A;  4BSZ A;  4JI2 C;  5AE3 A;  3RV2 A;  5BSM A;  4B3R C;  5FLX D;  4D56 A;  3I07 A;  5ADZ A;  2Z51 A;  4DCS A;  5BSR A;  2F4V C;  1HNW C;  4X65 C;  2HJG A;  2P2F A;  2JNV A;  2ZZM A;  1FUG A;  3N2Q A;  4JYA C;  1M6X C;  2DYJ A;  2D7V A;  4DR5 C;  1N36 C;  4G1I A;  1XRB A;  4G36 A;  3DLP X;  2VQF C;  1WCJ A;  2Y4O A;  1MD9 A;  2MM9 A;  5A2Q D;  4DUZ C;  3LNV A;  1N33 C;  2ATW A;  2QW0 X;  2VSQ A;  1XHJ A;  4KHP C;  1VLA A;  1XNQ C;  1IBM C;  4DV1 C;  2ZZN A;  2KDN A;  1QM4 A;  1YJ7 A;  3JAM D;  2E8C A;  3B7W A;  1FJG C;  1ML8 A;  4B3S C;  5LCI A;  2PT7 G;  3IEV A;  1HNZ C;  4PZP A;  4LF5 C;  2D28 C;  4DR6 C;  5BR8 C;  1IBL C;  1WF3 A;  1P4E A;  4BC7 A;  1VEH A;  4DV6 C;  3EQ6 A;  4LF8 C;  3A25 A;  3I08 A;  3PBK A;  4TPS B;  4R1L A;  1N34 C;  4GKJ C;  2OO4 A;  3EER A;  2E8F A;  4D4I A;  3UX2 A;  4I9F A;  4DR3 C;  4JI4 C; 
#chains in the Genus database with same CATH homology
 1J5E C;  4DR1 C;  5E7Q A;  3VNR A;  5BUR A;  1RY2 A;  4NOZ A;  5GTD A;  5K8F A;  1EGA A;  2Y27 A;  2EGT A;  4KTV A;  3J81 D;  1N2F A;  3A9U A;  5AE1 A;  3L95 X;  4RM2 A;  3A4I A;  2P2J A;  5LMU C;  2CXC A;  1T5D X;  3DHV A;  4DV3 C;  4BBY A;  3T1H C;  4BCA A;  5AE2 A;  2YCB A;  3LAX A;  3AF5 A;  4GS5 A;  3L8C A;  3VNQ A;  3C5E A;  4L7I A;  4FTF A;  1WH9 A;  2D1S A;  1MXB A;  3UOW A;  4NXN C;  4DG9 A;  3LGX A;  3ETO A;  4JI0 C;  2WD9 A;  3NI2 A;  3RG2 A;  1USP B;  4K0K C;  1O92 A;  3DAY A;  2ZM6 C;  4DR7 C;  2P20 A;  4DUY C;  5BSU A;  3S82 A;  4IZ6 A;  3TUF A;  5A1I A;  3H2T A;  1O9T A;  1PA4 A;  4D4G A;  1V26 A;  4GXQ A;  1XMO C;  2QVZ X;  3CW8 X;  3IEU A;  4JI7 C;  4IR7 A;  2HHH C;  4DV4 C;  2D27 A;  5BUS A;  4B3T C;  1O90 A;  1XRC A;  4FUT A;  1GPM A;  1ZB9 A;  1MDF A;  2VQE C;  4G37 A;  1LCI A;  2E8E A;  4LFB C;  1ZB8 A;  2YWB A;  1QWI A;  2E0G A;  2JMP A;  3FCC A;  1HH2 P;  4LFC C;  5KEI A;  4DV7 C;  4NDN A;  3R9W A;  3GPC A;  4XX2 A;  4X66 C;  3E7W A;  4RVO A;  4YY3 C;  5KYV A;  1KKG A;  3PRO C;  2KZF A;  4EAT A;  4LF9 C;  3ETC A;  3G7S A;  2OPL B;  4DCU A;  5CZV A;  5T8S A;  4X62 C;  4LE5 A;  2UUA C;  4LF7 C;  1JOS A;  1N32 C;  3GR1 A;  2PN2 A;  4GXR A;  5BSV A;  4JI6 C;  5BST A;  1MDB A;  4JI3 C;  3R9X A;  3NYR A;  2CY1 A;  2D1T A;  4MTN A;  4WV3 A;  1USP A;  2AYA A;  4AQY C;  2DPL A;  1RG9 A;  2UXB C;  3TDE A;  1HNX C;  2UUC C;  3E7X A;  1P7L A;  2E7G A;  3GKU A;  2D1Q A;  4LFA C;  1I94 C;  3FCE A;  4RLF A;  2UXD C;  4NXM C;  4BC9 A;  2P2B A;  2ONF A;  4DV0 C;  2Y4N A;  2BH1 X;  4D57 A;  1XMQ C;  5LMN C;  4ODJ A;  3NPD A;  1MXC A;  2P2M A;  2D1R A;  2ASB A;  3VNS A;  3GR0 A;  1PG4 A;  5K85 A;  2P2Q A;  3R44 A;  1LQL A;  2QVX X;  4L4Q A;  2P02 A;  2OBV A;  1NYE A;  4X64 C;  4MH4 A;  1BA3 A;  4RM3 A;  4JI8 C;  5BUQ A;  4ZJZ A;  3CW9 A;  4LF4 C;  3A9V A;  5DV9 A;  1T5H X;  2QL8 A;  4DR2 C;  4PHT A;  2OPL A;  5A19 A;  3IPL A;  4LF6 C;  5T8T A;  2VZE A;  4RLQ A;  5IT9 D;  2UXC C;  2PRO A;  1IBK C;  1PG3 A;  5BSW A;  1V25 A;  1L2F A;  2E5L C;  5CZX A;  1K0R A;  4I9G A;  4L2Z A;  4R0M A;  4PRO C;  4DCT A;  4ISB A;  4OYC A;  4YHH C;  4ZLP A;  4DG8 A;  2QVY X;  2XR1 A;  4JV5 C;  3OTO C;  4RMN A;  1UKK A;  3IML A;  3LUS A;  3N54 B;  4B3M C;  4OXI A;  5H9U A;  2BJO A;  5JRH A;  1MKY A;  3KXW A;  4DV2 C;  2UUB C;  4DR4 C;  3T1Y C;  1O93 A;  2WP0 C;  5A1G A;  1XRA A;  3TQI A;  4HPV A;  5IWA C;  4RVN A;  3NYQ A;  1ULT A;  4JI5 C;  4JM1 A;  3PES A;  4R1M A;  2UU9 C;  4JI1 C;  4K0B A;  3CJE A;  3UZ0 A;  1XNR C;  2V7B A;  4GKK C;  3SO4 A;  1AMU A;  4U5Y D;  4KTT A;  2YWC A;  4FUQ A;  4WS9 A;  4OX9 C;  5IFI A;  3J80 D;  4DCV A;  1HR0 C;  5KYT A;  4DV5 C;  3AF6 A;  1MXA A;  4BSZ A;  4JI2 C;  5AE3 A;  3RV2 A;  5BSM A;  4B3R C;  5FLX D;  4D56 A;  3I07 A;  5ADZ A;  4DCS A;  5BSR A;  2F4V C;  1HNW C;  4X65 C;  2HJG A;  2P2F A;  1FUG A;  3N2Q A;  4JYA C;  2DYJ A;  2D7V A;  4DR5 C;  1N36 C;  4G1I A;  1XRB A;  4G36 A;  3DLP X;  2VQF C;  2Y4O A;  1MD9 A;  5A2Q D;  4DUZ C;  3LNV A;  1N33 C;  2ATW A;  2QW0 X;  2VSQ A;  4KHP C;  1VLA A;  1XNQ C;  1IBM C;  4DV1 C;  1QM4 A;  1YJ7 A;  3JAM D;  2E8C A;  3B7W A;  1FJG C;  1ML8 A;  4B3S C;  2PT7 G;  3IEV A;  1HNZ C;  4PZP A;  4LF5 C;  2D28 C;  4DR6 C;  5BR8 C;  1IBL C;  1WF3 A;  4BC7 A;  4DV6 C;  3EQ6 A;  4LF8 C;  3I08 A;  3PBK A;  4TPS B;  4R1L A;  1N34 C;  4GKJ C;  2OO4 A;  3EER A;  2E8F A;  4D4I A;  4I9F A;  4DR3 C;  4JI4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...