3ETOA

2 angstrom xray structure of the notch1 negative regulatory region (nrr)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
232
Chain Sequence
ACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Neurogenic locus notch homolog protein 1
publication title Structure of the Notch1-negative regulatory region: implications for normal activation and pathogenic signaling in T-ALL.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3etoA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3etoA01
5CZXA 2OO4A 5CZVA 3ETOA 4ZLPA 3L95X
chains in the Genus database with same CATH superfamily
3DLGA 4G36A 4ANEA 2RVJA 3N54B 1FD8A 1CVJA 2DO4A 3TX8A 3GR0A 2FIUA 3QWPA 2VH7A 1CS4A 1P1TA 2CQGA 5GADI 4ZVTB 1RCXB 3FBCA 2QYCA 4IR9A 2RJZA 5HN0A 4CH7A 1ELOA 1JLCA 5U47A 4CWBA 1SUQA 4PG8A 1U25A 2HWTA 2WK4A 3JXOA 3POTA 2W4PA 4KKOB 4B9LA 4OZJA 1ZH5A 1DY3A 4MKAA 4RW4A 3KFWX 3BKTA 2R8JA 1M5SA 1RHMB 4KO0B 4X66C 1S1TA 3EXYA 1PYOB 1UVLA 1EGAA 3H2VE 2HBRB 2HGNA 3NCQA 2QL5B 4DDFA 2JX2A 1KKHA 1KQSR 1M5VC 2H5JB 4CZCA 2BOAA 1AYEA 5I3UA 1MXAA 2I0XA 4QPXA 1TELA 3AODA 4DR6C 4UZBA 2MLZA 4EO6A 4ECYA 1R0AB 2FVPA 3LUSA 2KVQE 1H72C 4IUFA 5BSVA 2CQ4A 4V19X 2IVFB 4GO7X 3RAXA 4P10A 4DV2J 4LF1A 4PABA 2CQ0A 3MR6A 3LP1B 4IOCQ 3R44A 4ZLPA 2ATLA 1W26A 2X1BA 3EZOA 4ZCMA 4XPCA 4H4OA 4DV6C 5KFWA 2GHWA 2B56A 3W9JA 2D1QA 1CJVA 5KFEA 4HHUA 1NRKA 4P2XA 1QSYA 2VC0A 3DRSB 4J9QA 4PXBA 1RAGB 1O93A 3UFCX 4V19J 3W2WA 2H65B 5E0OA 2UUAJ 2C2OB 2FC9A 1VRUB 5DDRC 4A8FA 2F8EX 1WNEA 1AB8A 4F7VA 1M90T 3G71S 3AA9A 4QWDA 3QZ8A 2UXCC 4KAIA 1F5BA 2BKPA 3CJ8A 3CDEA 3Q8PB 2N4CA 2XI3A 3NAHA 2XZDB 4MT1A 5CYJA 4FN5A 3GV8B 2IM3A 3KHGA 3G8SA 1NSKL 2AD9A 1OMSA 1MDFA 3PJXA 3VQTA 1R3NA 3T5KA 1XRAA 2GHPA 5KG0A 4QU6A 1PJ7A 4JI8C 1HR0J 1IBMF 1RLDA 3AH6A 4LRBA 4JI3F 2HVZA 2OBVA 3OTEA 2FVRA 3HM9A 2VQFJ 3VAGA 5DLFA 2CJKA 1VLOA 4K4ZA 2BRLA 4TY8A 1XMQF 1FNOA 2D69A 2ZBRA 5EUHA 1Z2ZA 1YG0A 4TYBA 4NA3A 3UVJA 4FDFA 5J2QA 2BANA 4N76A 4LSZB 1PA4A 4JI6C 1N56A 4RJVA 4I2PA 4ECSA 1J5OB 3VVUA 1JLEB 1LW2B 3GQCA 4QJVA 4K4UA 4EATA 2XCPA 2OH2A 1IBKC 2VBXA 2YKOA 4LR7A 3W2VA 3ZXWA 1RTJB 4NI2B 4LIRA 2VONA 5J2MA 2YBVA 1AZSA 4Y34A 3LQVA 4KE5A 1BMQB 4OYMA 2IMOA 3WBZA 4ZPBA 4PPDA 5LMUF 4DPWA 1IBLC 3C5EA 2A10A 3MM8A 3GKUA 3Q8SB 1YI2S 3AF5A 1Q4RA 2DYJA 4IO9Q 2UXDF 2VPWB 2FHJD 4K4WA 4DL3A 2NR0A 4RWWA 2CPZA 1FJGF 1NU4A 2WB1D 2M7SA 3IG1B 4ICLA 9ATCB 3PR5B 3RW6A 2E8CA 2N7CA 2MLXA 3BR9A 2XZTB 2EFNA 1VQYA 2HFNA 4QWCA 1U1PA 3D6MB 4A46A 1TL5A 3DGPB 1FJCA 1GH8A 4DU8A 3NGKA 1Y5NB 1ZA2B 1H3DA 3D9BA 3NWRA 4A8OA 3I32A 3I56S 4ZVSB 3VNRA 4X84A 5DG8A 1Q82T 1B0PA 3ZZ0A 4RU2A 2ATWA 4ZP7A 5DS7A 4IZ6A 4XPEA 4Y0FA 3R5BA 4XDCA 1S1WA 3FK4A 3CJKA 2M9KA 4R1LA 2DGTA 5D77A 3J7Z5 3C14A 1NB7A 2DNGA 3K5PA 3KLVA 5GVQA 3HVTB 2QLBB 3OQ2A 2AMCB 4FPIA 2HGLA 4WE1B 4YB1P 3GV7B 2FHJA 1HYSB 2XNRA 4H54A 2L3MA 2ZJPQ 2OKQA 3RBEA 2IPOB 2QA2A 2NZCA 5AXLA 1FKOB 3QBCA 4ZS6A 1FDAA 2KFZA 2KJWA 1TKTA 5KT3A 3CJSA 3I5CA 3CDBA 2XBPA 2QO3A 2XS2A 3DMJB 1N0VC 1S1VA 3F0NA 2KH9A 2BJ9A 1H6KX 1H2UX 1MWQA 4M5NA 3D3BJ 4RMNA 2M0GB 4F0KA 4F4XA 2XNQA 3R6GB 2V68A 4DR2J 2HYIB 4C8LA 2GX8A 3GTYX 1DLOB 1RABB 4BHQA 3O3LA 3QGHA 1V5VA 5D3GA 2Y27A 3T1AA 3SCLE 5KFPA 1S1UA 3R9WA 4PEOA 2DHSA 4RW7B 2DNLA 4C4WA 4KV8A 4UZCA 3RJMB 3GYGA 1FEHA 3DLKA 3VCDA 1HBUA 1HNXF 1XC9A 5M2PA 1PBUA 1T7PA 1VC6A 3G82B 2C28A 3DCAA 2KO1A 4ZKAA 2CQPA 1FWPA 2OPRB 2UU9F 1A0OB 2VFRA 5LM7E 4DJBA 4F02A 3UO0A 1HI1A 1PYTA 4KTVA 3LP0A 2HVEA 4NLUA 1PC5A 4K4VA 3D28A 3TW0A 1B0VA 5IQ6A 2CNNB 4OHXA 2ADCA 3J80U 3ADAC 4I56A 4L7IA 1NLKL 3MZIA 3MMBB 1DBDA 3EYZA 3FJ2A 3H25A 1HLWA 4JV0A 1N32C 4DR2C 1BLUA 4G1QB 3OLBA 4PWDA 5KFNA 3OL7A 3QAEA 2OD6A 3FBEA 1U0HB 2CYYA 3OHAA 1RTZA 1GMWD 1RT4B 3DLLQ 1FX4A 2EBEA 3CJ5A 4A4JA 2RF2A 3MD3A 1FESA 4QWEA 3QFWA 1JJ4A 4L73A 5DGBA 3WX8A 5HSPA 2E5LF 2ZH9A 5D6GA 4U96A 2DR7A 5HLFA 4CRJA 2Q1LA 3HI9A 2XGQA 1RHQB 4YDDB 5E3CA 5F41A 1RG9A 4FXWA 4R8UB 4NPOA 3A4TA 2JLEA 3R9XA 1SCJB 1KNZA 2YKMA 4P75A 3GSDA 2HKEA 3NS7B 2GJ2A 1YJTA 1RLCL 4P2SA 2B7CB 2DNZA 4WK3A 4ALZA 5IT0A 4WFZA 1UMJA 4HTJA 2MQLA 2YH1A 2B5JA 1ZAXA 1S99A 4R0JA 3UCGA 3QWUA 5JUMA 2YXLA 4IDKB 5DZ7A 3ISND 2F4VC 4ZVPB 1GMWA 4DFJA 4P6QA 5A0YB 1DTTA 3SV4A 4YB6A 2BE9B 2G4BA 2AYMA 1SIZA 1CBKA 4ZJZA 3PACA 4JM1A 1NHKL 2C2NA 1RWVB 1FUGA 1TFWA 1MDBA 2RUSA 1SL2A 3CSKA 5KG7A 2RDIA 3TANA 4X62J 4N47A 1D9DA 5EX0A 1WHVA 4A8XA 2AWZA 3V4MA 2Z4PA 2C3MA 5AXNA 4LFCC 3N5BA 1ACMB 4W98A 2DGSA 3JQJA 3K5LA 1HHTP 3NG8A 2DD8S 1TZ0A 3LF0A 2WONB 3RGIA 2XMAA 2LXFA 1NJWA 1VHIA 1Y5LB 4NXNC 4DX8H 2H4YB 1RT5B 1WHWA 3DDKA 1Y10A 1HNWC 5DDQC 1TV6A 3MUTP 1VISA 1U1NA 1S6OA 5ETOA 4Z2XA 5GAHI 4NLVA 3KLFA 1PSDA 4DL7A 4IR1A 2BQUA 4QIFA 1WTFA 4URGA 4C8OA 1TL7B 5CH7B 5JRHA 3R97A 1TVRB 2OHDA 4C0OC 3N6LA 2FLOA 2G9OA 2ZDOA 4QCLA 2POKA 2GS8A 1C1BB 4DV7J 4TNOA 3VGTA 3CC4S 3HHLD 3KK3B 3F56A 4K8RA 2GJIA 2K7JA 2DYAA 2ZZNA 3JYTB 5HI7A 4J9UE 1HWUA 3V4IA 2HGMA 3MEKA 3KJVA 4NXMJ 3FSYA 4KB7A 4Y6IA 1UJ4A 3TR5A 2VJUA 4C11B 3O5TB 2XMVA 4KH0B 2JJ4D 4B3OA 1P1LA 4B9MA 1PGZA 2RSQA 1RYSA 1FLOA 5L1JA 3A13A 5GMDA 4JI2J 3NXZA 1LXNA 1RAHB 3DLHA 3L7OA 3SMZA 3QIDA 4YUDA 2FY1A 2ZZMA 4XO0A 3ETOA 3H20A 3J7ZT 3EICA 3BGRA 3I6PA 8AT1B 4CP5A 1UAWA 3VZHA 2OEKA 1PILA 2CQBA 1T05A 1U1RA 4N8NA 4IFVB 3BDEA 2N82B 5KG6A 1REVB 1KQGB 2N3OA 1C0UB 2KT3A 3M2UB 3HHLA 2E9RX 4B3TF 2YQ0A 1PKUA 4DHVA 4GVBA 3EJMA 4LF5J 2FGCA 5GTDA 4FUTA 3EGZA 2HHPA 2ZH4A 3BSOA 1TQLA 4DV7C 2CWKA 2FJDB 5IWAF 1NUEA 1WACA 3E01B 2ERRA 2NCKL 3FFIA 4KY3A 3QIPB 1NYEA 2B4PA 2W25A 1XR6A 2DJWA 3QT7A 3W66A 3N01A 2CNLB 1Q16B 1T3OA 1JWWA 4ID5A 1SKUB 4ILRA 4BC9A 4WZQA 1RT6A 3CJ4A 4ZDNA 5E41A 2D3OR 2HNYB 4DR7C 3EDQB 3KKFA 1FFWB 1PJ6A 1SJQA 3SI8A 1IBCB 2V67A 1NY8A 4LF6C 4DMZA 2XQCA 1U49A 2QX0A 1UEVA 2QW0X 3OR2A 4YY3F 4DV5F 3TRGA 5E3QA 3IAS9 5GAEU 2UXBC 2R8GA 5IXUA 2DY1A 2FJEB 3TQEA 1UWAA 3IBWA 3T41A 2QE5A 3UN2A 4MK9A 4X65C 4B9TA 3D4JA 1FK9A 3ZFVA 4AT1B 1NKCA 2VV5A 4RZRA 2VB6A 3SBMA 2HQGA 1HPZB 1WC1A 2VF3A 4GKKJ 5DLGA 2KRBA 4X4SA 2GCFA 1LQLA 2ACMA 1HNVA 1RWMB 4Q45A 3M9MB 2LFVA 1DQ8A 4NYZA 3N2QA 1A7GE 3DLBA 2LEAA 2RU9A 3EZUA 1WTBA 2K2PA 1XQIA 3L3CA 4ID8A 2R2RA 1GQEA 3H42A 3WQPA 3IXQA 4TYAA 3MAAA 2Q66A 3HKZD 4PG7A 2FY8A 2P02A 3D3CJ 4NLPA 1KTVA 5B0GA 4ZCKA 2CAJA 4WS9A 3CCTA 2KZZA 4C8NA 1SVDA 3FSXA 4PROC 2HIYA 1Q86T 1N48A 3MAQA 3NGSA 3MEGB 5GAGU 1Y5IB 2IHR1 6FD1A 5L9XA 2FZCB 1NKBA 1IKVA 3NS5A 3AQOA 5T7LB 4ZCIA 3J81D 3QJLA 1NXIA 4ZJOA 2EFOA 3IGNA 4KC5A 2HMIA 3TVZA 2GZOA 3M8RA 1VC0A 5IOLA 1N34F 4PR6A 3IWLA 3AA8A 2QV6A 3JAMY 3GILA 1ZZFA 3EM1A 2QVZX 2D27A 4ZVGA 1KEKA 4UF4A 4B3MF 3I9V9 4F3OA 3R6LB 5EX3A 4TXSA 1JQGA 2MKIA 3N4WA 2WVCA 1UEKA 2AJ2A 2WSCC 1YBTA 3PYGA 4I1TA 1RB0A 5A2QU 2WVBA 3A26A 3S82A 1MMNA 1YJVA 3I4HX 3RUBL 3DOLA 5KFMA 5EHHA 4HH1A 3ZZRA 4CO4A 4A8WA 1LFPA 2Z51A 4RLEA 1WF2A 5IFMA 3J81j 1J5EJ 2ZEJA 4O4GA 4OYAA 2CPXA 3TR3A 5DGAA 4ILMA 4A48A 2YKNA 2ROEA 4AE5A 2BYCA 4EI2A 3KMSA 3PFOA 3SYZA 2F40A 1D9AA 3MCSA 1RXOB 2HURA 4YHHF 5IM0A 4YR0A 4DV3F 3C15A 4NRUA 4PCQA 1M5OC 4B08A 1U2RA 1FDNA 1HBMA 1RWNB 3TWZA 4JI5J 5LL6d 2ILZA 2O1PA 2HFSA 4DBQA 4U9RA 2M5HA 1IWAA 4DLEA 3I87A 4CLFA 1RTDA 4UQGA 3F73A 1XIQA 3FUYA 4EZ6A 2HWHA 4L75A 1MN7A 1QTNB 3MM5B 1UJ6A 1IN0A 4NRTA 2E1CA 4R25A 4RNNA 1CS4B 3DLPX 4LF8J 1A6LA 4LT6A 1SC3B 2KXNB 1UA1A 1JLCB 3KLIA 1SUQB 3CEDA 2JSXA 4HACA 4IRCA 3POTB 1N33C 4CO2A 4DCJB 5DETA 1S5ZA 3L7PA 2XLKA 1RGVA 3RYLA 4B3RC 1PG5B 4DZDA 2J9EA 4PWWA 2CZ9A 1RT3A 2YNHA 3IR5B 4DSFA 2CWXA 2HNDA 3TJ9A 3GIRA 3BJYA 2FJVA 1N5QA 1LFWA 2A18A 1RZMA 3H59A 1T03B 1LW0A 4LF4J 3RB3A 2FDNA 1N52B 1ZAVA 4ED0A 1Q1KA 1WCJA 3TAMB 4CO1A 3CMAS 1M5PC 4WFAQ 2W9BA 3PRBA 2C1EB 2YNGA 5I3UB 3NYQA 4PHTA 4DG1A 4N41A 2HK3A 5A8KA 2DXEA 1S76D 1TKZA 2AJ1A 4NA2A 4FYDA 2NXEA 2RDJA 5B09A 3HJVA 3IWNC 2UUCC 1P4EA 3HFZB 2BR0A 4RNFA 2J7KA 4J90A 1C1CA 4LF9C 4RBUA 4IOBA 8ATCB 2OEJA 1EB0A 2CQ1A 2DNMA 1BQNA 1RA6A 4UQTA 4XAKA 3KHHA 3G2XA 5D4NA 3UR0A 2VKZG 2GV1A 1AT1B 2COLA 2J0WA 3TUJC 2L9DA 3CE8A 3RR8A 4LRAA 4ERDA 4EBCA 3D68A 2IJNA 4H4OB 1SC1B 1HHQA 1FXLA 3A4IA 3Q86A 4X4NA 1V25A 4IFYA 2WW4A 2GVDB 1IKXB 2V6AA 2GGPA 2X1GA 2NYIA 3KLEA 2DPJA 3W2WB 1HARA 1U2CA 2OPQB 3K5OA 1VQKS 5K8MA 3K5NA 4OHWA 1WC3A 4KGZB 2VG6A 2LXIA 2YKAA 2AU0A 2VFTA 5K85A 4KYZA 4A47A 4PWUA 3EGNA 2K1RB 5C2GA 2EPIA 3W3SA 1P8GA 2PFFB 1RBOB 3IRWP 2EVZA 3VAHA 5MLCV 4DQRA 2CPJA 2HLUA 3B6BA 3CMES 2X3DA 4ANDA 3M30B 3UWTA 3MMJA 2MHEA 2DVIA 2CRLA 4ZPDA 1NAQA 3KJFB 1FRJA 2IDEA 3MI7X 1MN9A 4IH6A 2ZDPA 2MSSA 1ZTTA 1EKSA 4I0WA 3H4DA 3TAQA 5KFJA 1Y4ZB 4J9KA 1G7CB 1WF0A 3RB6A 2J7WA 2P6SA 3I0RB 5KT5A 1PG3A 4QR2A 4OYBA 2MZQA 2HQCA 4HL9A 5K8NA 1U1MA 1N4LA 1HQEA 2VQEC 2BDPA 3CO0P 1IKYB 5J2QB 5L38A 2K3KA 1S9FA 2DNOA 1RKJA 2M88A 5LOQA 4K4SA 5HVGA 5KFYA 3FEXB 2DB1A 3MEDB 2C2DA 3I4PA 3SEOA 4RNOA 1N5TA 1YDLA 2ZBPA 1YSJA 2FLLA 3QSIA 2A6MA 2CJBA 4DUZJ 1H38A 1RTIA 2B51A 5BURA 2BM1A 3DHVA 2GFFA 3W2VB 4ZCLA 4C2MA 1KC8T 1RACB 1ZA1B 3CCVS 2XHWA 2MY8A 2W2PP 3MM8B 1T95A 1HNZF 3HXMA 4ED3A 3ENVA 2UUBF 2Q6CA 2VG7A 1CLFA 1IWGA 4ICLB 1W7WA 1WDTA 4PAAA 2Z30B 3GJQB 4MAKA 3V6HA 3PX0A 2M52A 4C0HA 5KOWA 1VCTA 4TQRA 3H4BA 4CM2A 4F2SA 1ROFA 1IBMJ 2L48A 1PCAA 2CPEA 4JI3J 2ZJRQ 5K5MA 4K2JA 3RBXA 1DAXA 3L09A 2I6WA 1U1KA 4MKYA 4C3MA 2Y4NA 5D4OA 3PX6A 2VG5A 4IG3A 4NYOA 1SV5A 1RP5A 2GQ2A 2FTRA 4ZJQA 1XMQJ 1WEZA 2CQ2A 2MKCA 3R27A 2NSCA 2B3TB 2FYXA 3BGLA 4NASA 3OL8A 1VBXA 2QFJA 3CJKB 2Y9HA 4I7FA 4ENOA 4IKAA 3BO4A 4WZMA 3DOMA 4DUZC 4JI1F 3ILJA 4B9VA 5IV3A 3PRVA 1PG4A 4K2XA 1FTRA 2JRSA 3TUFA 2DPLA 3PW7A 4OZ1A 3JSMB 2DGQA 3VZIA 2GIFA 2YCBA 2IM0A 3A8IA 4MYUA 5LMUJ 2Z2MA 4F4WA 2YWEA 1SXLA 2EI5A 3PW4A 3PDNA 4JYAF 5KFZA 1DZ5A 1RHUB 1RWKB 3K8WA 1UVKA 4IH7A 2UXDJ 4OV1A 1S1VB 4GVLA 1RHJB 2DH8A 3LNOA 1HBOB 1FJGJ 2HRYA 4F4YA 2B9XA 1JJHA 3DOKB 3IRXA 1RKIA 4G1IA 1HWJA 2P2MA 1U8SA 5KFOA 4DCTA 4JOUA 3HMJG 1EETA 2FJBB 2QL9B 4U7UD 2Z2LA 2DR6A 3PW2A 2ZHAA 4O3RA 4Y2MA 1S1UB 3TEGA 4K59A 1DQ9A 2RQ4A 4NLOA 3Q83A 5DRKA 3DLEA 5KFDA 2IBKA 3MM7B 4EYIB 3THTA 4WWSA 2E8EA 1HBUB 4J9SA 3CDWA 1H73A 3ETMA 1MROA 3I0SA 1T9VA 1S49A 1TL3A 4RBVA 5M2RA 2F3JA 2RH3A 3BR8A 1VJWA 4QPTA 3PW5A 2EK6A 1KR4A 3RB4A 5A1IA 4URQU 3FMBA 2FZGB 2QMXA 4FNHA 5BYQA 2LVWA 3HZEA 1MMDA 3WC2A 1K8AT 4Q2LA 3N5FA 5J1EA 3QSYB 1VMBA 3C46A 4OI1A 3GG1A 3HFVA 1JXEA 2XCAA 1M1KT 1RT1A 4OX9F 4DN0A 3T1HF 1OWXA 2DNQA 3N9UC 4DV4F 4A8QA 2CY1A 2Q6BA 2W4DA 2LCWA 4CM0A 1E6YA 5DJBA 4CYUA 3CUNA 1FWLA 4LF7F 4RW8B 2CQCA 1IM4A 1Q5VA 2JZ5A 1VQ5S 1WC0A 2JMPA 4D3HA 4AL7A 2D3UA 1ZM4A 3AXKA 4LSLB 2V63A 5DG9A 3U1LA 3HF5A 1KFDA 1G6BA 1NK6A 3CJ3A 3RG6A 2RRBA 1HNXJ 4OI2A 4WF9Q 1N8RT 3WX4A 2J8AA 5A6WA 4F8RA 5AE1A 3ULHA 2P5VA 2HHSA 3M1VB 1H7XA 3BSAA 2YWCA 3MUMP 4ES1A 4V1Ak 4FS2A 5KTQA 3QGGA 3MMCB 1WEXA 2UU9J 4DR1J 2OI2A 2YKMB 2CVIA 2OTLS 4KGVB 5CABA 4O3SA 3V81A 1D0EA 3QGPA 3R7NB 4FKYA 2Y1JA 1VK8A 1D8YA 2LQ5A 3TA2A 2YWBA 2B9YA 2IRXA 2JC1A 1EIYB 4DR5F 3DU5A 3ENQA 2JH3A 1NJYA 4O0IA 2NS1B 5ETQA 4QZVB 5AXMA 5BSWA 4CNZA 3K17A 2LQJA 2DCLA 1L3KA 3TDEA 2Z58B 3H2TA 1H7WA 5KFUA 3UR3C 3K5MA 4KHPF 3JSYA 4WBFA 2DO0A 3PEJA 3GIJA 4W90B 4DV0C 1YLXA 2KRRA 2XG8A 1U7LA 2MKJA 3ZZUA 4CDIA 1JLGB 1HW8A 1RISA 2XHCA 4Y2AA 2E5LJ 1X4BA 1NH8A 2YX7A 1GK8A 3D54A 1NK7A 3P6YC 2XM3A 1NJXA 5AXKA 4U6PA 5E7OB 5I4MA 3GR1A 1JLFB 3LWMA 4ED7A 5CA5A 2RU3A 5BR8F 2UU9C 4DR1C 2YQ1A 3CQ3A 3MOJB 1S48A 3A3NB 4F3MA 3OSNA 3PV8A 3CVKA 2QT7A 4QWBA 1MU2A 2HAIA 1VR6A 2XO6A 1OY9A 2J7UA 2PN2A 3X3UA 3NBPB 1I94F 2L9NA 2UP1A 3UE2A 1UW9A 1HWKA 1C4CA 3QRRA 1EARA 1WDDA 4O3QA 1JLAA 4X4TA 3IGVA 2BKNA 4USUA 1XS3A 2WBRA 1I51B 2B8PA 1FRIA 2CQHA 4LRFA 3KK2B 2EXUA 1P9QC 3KJVB 3A3PB 2LECA 5KG5A 5KG4A 2NZ4A 2FHMA 3M2VB 4B3OB 3EXCX 4ETZA 3BQ1A 1RAAB 1XR7A 3QLHA 3LNVA 4YOEA 4LFAF 2E5LC 1KQKA 4ITSA 4XK8C 2Y0BB 4AQYF 1RBAA 1S6PB 2CKWA 4GXQA 1MW7A 4KT0C 1XTZA 2J6UA 4WU3A 1T05B 2W01A 2AJ4A 3CJ2A 3NYRA 4OIXA 1FCAA 3KXDA 2C3YA 3OTOC 4J9RA 1F3FA 4NLYA 3JTOA 2FLNA 3HHLB 3C3LA 3SQGA 5J1NA 2HRTA 4ED4A 3QT6A 4G3IA 1BQXA 3PKYA 2XTJP 3LP2A 4C48A 2EKNA 2VDHA 1RT2A 3LTOA 2FUG9 3PX4A 5ETMA 3B4DA 3C6UA 1LOUA 4ZPCA 1OQ6A 2DXDA 1YJ9S 4NZ7A 3TA1A 2GJFA 2KN4A 5FD1A 4EO8A 5JMNA 4CCHA 1PAEX 1WI6A 3HLUA 1VQ4S 5E2QA 2Z0GA 3AD9C 1CJUA 2QLXA 3G9CA 2RS2A 3PRDA 1S9GA 1FFSB 2V4JB 3C6TB 4OLOA 1ZAWA 2BE2A 2M3DA 3C16A 2V69A 3Q8YA 4ZVQB 3CMQA 2O66A 1EHWA 4FF2A 4CTAB 2VC1A 2DH9A 3D1QA 2AGQA 1E6VB 4Q0BA 2NPIA 4EEYA 1NDLA 2B9WA 4ED1A 1S4FA 3HSZA 2XWYA 3CT9A 4DX5A 2EC2A 2ZD1A 1FDDA 1FKPB 1V26A 2W4CA 3K58A 3NPDA 2RRAA 5HO4A 2WCXA 3HFKA 3OL9A 4C6AA 2P6TA 4D57A 3FNNA 3BS9A 2D9OA 3A8EA 5D78A 2U1AA 2JNVA 5CCMA 4WXWA 4B3TJ 2LDYA 3ITHA 3QT8A 3ILOA 1C0TA 1JK9B 1T11A 2NPFA 5I3QA 4I64A 3F44A 5CCLA 2CJ9A 4Q5VA 3BV8A 5F8IA 3BH6B 5H1SV 4B3SC 1WG4A 2CQ3A 2NUHA 3GIKA 4DLGA 1LV5A 5IWAJ 4CT8A 1NK8A 4UOCA 1SB6A 4LR9A 3EMTA 3D1OA 3LAMA 2C3UA 2P2JA 4DCPB 1MLAA 4CLUA 1WKKA 2E5GA 1JXVA 2E7VA 4DF8A 2KB2A 4RLFA 2BUNA 3MAAB 2E29A 4RW9A 3ZNUA 4M5LA 2VDIA 5KFBA 3MCOA 1QVFR 1ZM3A 3CC7S 2E5IA 5HBMA 2B4UA 2NCLA 4X66F 2FZKB 3H90A 1BWEA 1KP6A 5KAKA 5LJ5Y 1O5JA 1AROP 2HQFA 2AEMA 4YY3J 4XIUA 4DV5J 3NP5A 4O44A 5T8SA 4K0KC 1M5HA 2H54B 2ZVSA 2CUYA 1YGYA 2BJEA 3WZ0A 2BV3A 3AHPA 3EZ5A 3OVAA 1UVMA 4DR4C 3HZGA 2VZ9A 3G6ES 4DSIA 2B6AA 4DR6F 2YVSA 4CLKA 4B02A 1X5SA 3W1YC 3OHBA 1U09A 1ITPA 3LAKA 3H8YA 2IYGA 4USHA 2MLYA 5ETPA 4EU0A 1GXLA 1WOPA 1Y3KA 5GMEA 3W63A 3NRBA 2YKQA 2DRDA 4FF3A 1F9HA 3Q24A 1HD1A 5IWAC 1V3ZA 4I9FA 5CD4H 4DUYF 4JI0C 5LSLA 4HHJA 4MK8A 5G0RA 5IC6B 3GG0A 5SZTA 1C4AA 3MTKA 1BQMA 1YX2A 2LQ9A 1LNQA 1KTQA 1SL0A 2WSEC 4LFBC 3OJSA 4DV6F 4YB7A 2ZHBA 1SKSA 1ZETA 1GXTA 1K1QA 4QYZJ 2IJFA 4DV1J 2OGUA 2VPXB 2RS8A 2XMMA 3HK2A 5A1GA 1YK9A 4N7TA 4X4UA 4LREA 4YY3C 1D1UA 4Q44A 1JNRB 3OBIA 2MQPA 2UXCF 1JXLA 5KFCA 3DNCA 2A2CA 1VS3A 2C42A 3C15B 3B82A 2ZE2A 2ASLA 4PZVA 1B7YB 2BX6A 4YQWA 2VHGA 2MZRA 3OXLA 1U2FA 1HBMB 3MUVP 4M5DA 4B9SA 4UT4A 3CULA 1VQ9S 1XRCA 4I67A 4X4RA 1N36C 4UY85 4F2RA 1N34J 3VGVA 4ES2A 5KFXA 2GQCA 2U2FA 3H40A 3SXLA 3CD6S 4JI8F 1X4EA 5B0EA 1L3SA 2IA6A 3R7BB 3MCMA 1F9EB 2MMAB 2NXJA 2HHHC 3J81U 3KLGB 1RDRA 2ZOMA 1WORA 1QWIA 4B3MJ 1D8ZA 1S7HA 1S7IA 2QLWA 4C8ZA 2D74B 4Z7YA 3OFHA 3T5LA 3SDEB 4FS1A 2HIQA 2D9PA 2BBEA 4UUWA 2OAUA 4R5PA 1R0BG 3KLIB 1KN6A 4KKOA 3GU0A 1NPPA 1UKKA 4HACB 2JHEA 4DV1C 4OYZA 3NLCA 4JI6F 3HO1A 4KO0A 3U7JA 5H9FJ 2VSQA 1IBKF 4BLGA 3V6DB 3PR4A 2YNHB 2J8SA 1YJWS 2BJ8A 4QBUA 3OR1B 4YHHJ 2AGPA 4DV3J 3C8YA 1DTQB 4WXOA 4WTYA 1IBLF 4WKRA 4ZOSA 3E8OA 2A3JA 3BPSP 1R0AA 5J1PA 5A8KB 2RB7A 4OZNA 1N34C 1RAEB 4EBDA 4NEZA 3KXWA 1PU1A 2HBQB 4ZVEA 4B3MC 4WTOB 3HHNB 2D1TA 4CLLA 3PYEA 2MB0B 4PYDA 1DRZA 1JLBA 3EERA 4N56A 4P9SA 4LQ9A 1VQ7S 2R7QA 4LSNB 3LALA 2MQQA 1TL4A 3J7YU 2B0GA 3L4BC 3JAMD 4JV1A 2HQIA 3FCVA 5L1KA 3CD5A 4USWA 2GHVC 2OFHX 3FBBA 1RHRB 4LVOP 1CJTB 5D15A 4DL5A 1PIEA 4MKBA 4PQUB 3B54A 4WP9A 4DU7A 2R7XA 2HRUA 4YHHC 4LMZA 1QM4A 5KFFA 2XLJA 1HBNB 3CCLS 4ZP6A 4I69A 4ED6A 2PD1A 2PSZA 3GCWP 1YRTA 2HBZB 5IC4B 5F0WA 2PIIA 2NXNA 2I8EA 4K7QA 2J0SD 3R5CA 1JX4A 1HH2P 2KDOA 4L74A 1HI0P 2G2OA 1N5VA 2HK2A 1Q78A 1M6XC 3PNIA 3DRYA 3HVRA 3AT1B 1FRKA 2ROPA 1P4EC 2CU6A 2D1SA 3CJTA 2WP0C 3CCSS 3MEEA 3HVAA 4L3NA 3BN4A 5SUHA 3KLHB 2ZJQQ 4C8KA 4JI4C 4DCUA 4YEAA 3CCMS 4A8KA 1RE1B 5CXTA 4HR2A 2MKYA 3K0JA 1WG1A 4OI6A 1BWVA 1N5YA 2J6TA 2FQQB 4WFBQ 1Q7YT 4G65A 1XNRC 1FERA 2W8LA 2ZNYA 1C2PA 3CCJS 4I2QB 1W2BR 4USVA 4I6WA 2R7OA 5C25B 4NI2A 5AE3A 2YH0A 1U0SA 2HQDA 1RTIB 2QSWA 1LEOA 4CLWA 3Q2TC 3QZ7A 4KHRA 2WSFC 4EZ9A 3RZAA 2HW3A 1CULB 2OPPB 3BGFA 3S01A 3R8YA 4K5SA 3KDOA 3CCWA 2OFGX 3JQKA 3IG1A 4CH1A 2HZAA 3NWGA 3WHIA 1GNKA 3PW0A 1N32F 3FSIA 4OFZA 2PT7G 4IG0A 3VQSA 5BXIA 2IY5B 5C42B 1H2TZ 3RBDA 3DGPA 3K59A 1ZS6A 2MQNA 3M9NB 3QT5A 2BH1X 1RWWB 3UQSA 4ECQA 5HQ8A 3PCOB 2BEFA 3ZTQA 3LW5C 1QDUB 2GVZB 5E7QA 4NLSA 4ZN3A 5HMXA 2GIRA 4JP8A 1S6QB 3QJJA 4L2ZA 3Q8VA 2OPSA 3CQ2A 2OO4A 4O0NA 2VOOA 2ZKTA 1EKRA 2WB4A 4Y65A 2PDAA 1R8HA 3I08A 2MXYA 4I7FB 3NGUA 4NEYA 1F5AA 4BSZA 4H4MB 1KDNA 3JS9A 2HHWA 5KEIA 2CG8A 2O3DA 3IBCB 4JB8B 4DV2C 1KLMA 5HAOA 3I5BA 3SFGA 1JOSA 3A25A 1UW4A 4TY9A 1HNIB 1O51A 3V6JA 2JC0A 4HKQA 2AYAA 5DG7A 1HNZJ 1VIOA 2F4VF 4FTFA 4UY8T 3I96A 4IO1A 2UUBJ 2DGOA 2DCUB 3DC2A 1FNMA 2QA4G 2OPLB 1DLOA 3NGDA 3FCWA 4YR3A 2R8KA 2UUAC 5EWEA 3DM2B 2XY5A 1NZ8A 1OO0B 3UNGC 1AUSL 4P73A 4LFCF 1FVSA 2DXFA 1O0PA 3SFUA 4OI0A 5JJBA 2LU1A 4HI1A 2IVMA 2VFVA 3EE3A 3MPUB 3CJRA 4MJKA 3OVSA 3GJRB 3QAUA 4NXNF 1SBRA 2OPRA 1FKAF 3I0SB 4C0BA 3M4XA 2QMUB 4AXIA 4NCGB 3M6VA 1TL3B 5C7PA 1HNWF 2G13A 5M2UA 4JI1J 1O90A 4C8MA 2EGTA 3EPGA 1HR0C 1S0OA 4DN9A 2V0NA 2VQFC 2RUGA 2J9DA 3ICLA 3IR6B 4CI0B 3C2PA 4AUKA 4JYAJ 3MMBA 1TKDA 1T3NA 1VYAA 2ZITA 1UWBB 4DX6A 1NK5A 3R9LA 4CLPA 3SSSA 4PXEA 1S57A 2F1FA 4NYPA 1UZHA 3SSQA 4IRKA 1QUVA 3ZC4A 5KG1A 2E5JA 3T3FA 3IC1A 3DRRB 2FVSA 4USKA 2QVYX 4U95A 3O44A 1UPPA 1X4CA 1HD0A 2OEMA 2XSJB 4RL1A 3NY0A 1TKXB 3K7RA 2E44A 2HHQA 4TLQA 5DDOC 1NHUA 5KFAA 5A8WB 3CDUA 1Q53A 2VKRA 2YWFA 2QFIA 1KLNA 3TEHB 2XY7A 2MGZA 2EWHA 3JQMA 4R8UA 1NDCA 1NO8A 3AOCA 4DL4A 2A6OA 2QC3A 2D1CA 1K1SA 2XYPB 1NHVA 2OLWA 3P45B 4JI1C 4Q2MA 5B7WA 4JI7F 4FYYB 2ZHOA 1Z2LA 1S72S 3O2EA 4RBTA 3GFZA 4KFBB 3OFFA 1XERA 2ZH3A 1FHTA 1YWXA 4J7CA 3TOQA 1K47A 3D0HE 3FMWA 1R31A 2XS7A 4IDKA 1SPBP 1CC7A 3L8CA 2HLTA 2YX1A 4HDGA 2V4QA 3FCEA 1RK8A 1ZZNA 3HT3A 3LANA 2FHKA 5HMYA 4OX9J 4QQBA 1RWOB 4EK2A 4QIGA 4C9DA 5F8JA 3HSGA 5LCIA 3ELHA 5EGYA 1NKEA 2LP4A 3T1HJ 1QVGR 1U26A 3C19A 1X4HA 3T1YF 2UUTA 4DV4J 3M8QB 5ADZA 3D6TB 2KFYA 2DNHA 2ADBA 3HHKA 1HQ2A 4LF7J 4DR7F 4OZ5A 2J0XA 2XMUA 4NLDA 3DXSX 4NA1A 5DDPC 4LF6F 1HKAA 3PJWA 2GW8A 3G4SS 3LUYA 1WC5A 1KOHA 2DTJA 3GJTB 2YNIB 1W25A 2WONA 3ZZYA 2UXBF 2R7TA 1D3WA 2VPZB 2ZH7A 3UN3A 4YP3A 2YPZA 1VQNS 1RT5A 3R5AA 3OT9A 4W4MA 5LMNF 2WOMB 3SCKE 3UDEA 4X65F 3Q8RB 2R8HA 3CD0A 2HS3A 1HQUB 3CO9A 2O5DA 1HL6A 2RKIB 2ZKUA 5BJRA 3O8WA 4F0HA 2V2QA 1LCIA 1KVIA 4O3OA 1SKRA 1TL7A 2F65A 4D4IA 3NMRA 1TVRA 4J9MA 2MJNA 2I1RA 5THWA 1C1BA 5BSRA 2V8DA 3A8JA 3KK3A 2C3PA 1TH5A 4WIIA 5D0EA 1S12A 2DNRA 4DR5J 2ZC4A 3JYTA 3FCCA 1USPB 4PRFA 1RU2A 1SI9A 5DQGA 4FZVA 4C11A 5ITHA 1T0TV 2PEHA 2HNZB 3ZZOA 2V4RA 4L72B 3GYNA 4LF7C 1JJ2R 4KTTA 3A9VA 4LQ3A 3TVYA 3B7WA 1N5SA 5B0FA 4KHPJ 5J2NB 3FRZA 2R9LA 4DSKA 2JVRA 1O8BA 1URRA 3MWBA 1UVJA 2ZC3A 3UCZP 2BM0A 3NCRA 2KHDA 3M9OB 4M63A 1VQ8S 1VBKA 3AJDA 4FF1A 3N0VA 1X5PA 1MNEA 4IQMA 3AAWB 3TYTA 3G8TA 4LF2A 4IFVA 4M5MA 3Q8QB 2AGOA 4OJGA 1C0UA 3M2UA 3T9ZA 5BR8J 3JSBA 1LWFB 7AT1B 3W65A 2PI4A 3WC0A 3QRQA 1WD6A 3SQGB 1I94J 2P9CA 1SJRA 1QLNA 4ILLA 3Q0AA 3E01A 3MFIA 3ZZPA 3KDNA 2DY9A 4DCSA 1SH3A 2IAJA 1H0HB 4F04B 1GX6A 3PYFA 1RT7B 3CDAA 3IM9A 4OJ3A 5KT7A 4L6V3 3OV7A 5F8NA 3M32B 3TNVA 2YX4A 2C2ZB 4DXLA 3EVMA 2RT3A 2V9KA 4J9NA 3BDPA 1MXBA 1NNDA 4PZPA 5FLXY 1EZZB 5HMWA 5KYVA 1CJUB 2DR8A 2WRMA 3RAQA 5A8RA 1JKHA 5GAGI 2A1BA 2RMLA 4PKDB 5L8RC 3DDIA 4ZN1A 4FBUA 4LFAJ 3EDRB 3B8HA 3M7VA 1U47A 4Q0BB 1XR5A 4GKJF 4RVOA 4AQYJ 4TKTA 3UDLA 3MCNA 2Y1IA 2ZUAA 5K14B 1S9EA 2IFXA 3BGUA 3BQ2A 2ZD1B 3K57A 1TMJA 8RUCA 2IBOA 5IT9Y 5KFGA 2EEYA 5E3AA 5C5JA 3MR7A 4OHZA 1FJ7A 1HPZA 2OMLA 2BRKA 2WHOA 1Q95G 2K8GA 5KFSA 4ECZA 3JSRA 1T9WA 2G1HA 4X62C 2QA1A 5D8HB 2H3EB 1SH0A 3ILLA 3MAHA 4E8UA 2FJWA 2MTLA 2BMBA 3M2RB 3L7UA 1UTAA 4C97A 1UFLA 1UPMB 2AKWB 1MG7A 4ZLLA 2ZH6A 2KT5A 1NEEA 4P7TA 1RTHA 1X8DA 3BB5A 4KSEB 3QFHA 2P20A 2VICA 1YRXA 2B4OA 3T6JA 1N33F 1WC4A 1G2EA 4B3RF 1M1HA 2BQRA 4ZVFA 2BZ2A 2VUGA 2JOQA 3G96A 4RW9B 1BUXA 4X64F 1PYSB 2RNEA 2GA7A 3IAM9 4LFAC 5HBMB 5KFRA 3OUYB 2YQ3A 3CCES 3KWMA 4IYQA 1U1QA 4AQYC 2KYXA 3OJUA 1T5HX 3T5HA 4O44B 4KQZA 3MEGA 1CSJA 3R1LA 4O3NA 2LDIA 5T7LA 4L3KA 3GIIA 1HIYA 1RADB 4MFBA 4HT5A 2WW8A 3U1MA 2B6AB 4Q7AA 4NXMC 2UUCF 3PY8A 3LGXA 1X0FA 1FO1A 1LWCB 4LF9F 5I42A 2V2ZA 2AV5A 4WU2A 1CJKB 2DR5A 4JI2C 4K4YA 2G2ZA 1Q8KA 1IKWA 2KFNA 4DL0C 3CD7A 2AZ1A 2BQ3A 2R7RA 5HQLA 3R1HA 2IM2A 3D1HA 3HP6A 5HROB 4FYVB 4JUZA 4QW9A 2E9TA 3Q22A 1RBLA 4WYWA 1ZPWX 2EG1A 3HHDA 1GPMA 3CB4A 2X3GA 4X4OA 3D2WA 1HMVB 2H1YA 1LXJA 4RNHA 1R8BA 2ZBQA 5L46A 3E2EA 1P7LA 2ALYB 2ALZA 4X66J 2M5OA 1V6HA 4LF5C 2CFXA 1QSSA 1UVNA 4FVCA 3TQIA 2ZBCA 2W9CA 4ZHRB 2JFDA 2DH7A 2Y4OA 3MM9B 1QE1B 2ZE2B 1VOMA 2GO9A 2BXJA 2LYVA 3PIPQ 2BACA 4M5DB 2OTJS 3US5A 4DR6J 3AFGA 4DQQA 1YRUA 3QO9A 3GJSB 3MM5A 2CPYA 3B78A 2P2FA 1GXUA 1SC6A 3LAXA 2XS5A 2QTWA 4E0DA 1XK8A 2MZ1A 4DUYJ 1ML8A 1S10A 1YITS 1VLYA 2CPIA 3FCHA 2RIJA 3DI6B 1V5IB 1YQHA 1TUVA 1O9TA 1N6QB 5EWGA 3OW2R 1XN9A 1U4BA 4FYXB 4R5PB 3TJAA 4RWXA 4DV6J 5J2PB 1YBUA 1U24A 2JVOA 3M05A 2VQEF 3OLAA 1T8EA 4Y00A 4EMDA 2NLWA 3G6XA 1XBWA 4XTTA 5BUSA 3HJFA 1SKWA 3OD2A 4M94A 2QYGA 1F9FA 1Y11A 3TUIC 4GKKC 1NPKA 1YTYA 3DYAA 1T03A 1DARA 3PYDA 2X1AA 3CJ0A 5HVFA 3AJ1A 3TAMA 4X4QA 4KH1B 2UXCJ 1AFIA 4U8YA 4F26A 2MY7A 2YWWA 1P6TA 4OZ3A 5KOXA 4ECXA 1DHMA 4A8MP 3MR3A 1VRTB 4OL8A 3PJ9A 3VVTA 3CIZA 4UOHA 4F4KA 1LWEB 2V8GA 3AOBA 1PC4A 5EDWA 3IMLA 1URNA 3K89A 3CJQA 3WDOA 4JI8J 4WYLA 3DHWC 3NOCA 5DO2A 3DU6A 4WFNQ 2K3IA 4L76A 4DUYC 3NNAA 4HEA9 1NCLA 5JXSA 3M6UA 4ER8A 1IXKA 2GC8A 2XLIA 2PT0A 1JLBB 1JJCB 2VD3A 3KK1B 2RHSB 1GTHA 3PO5A 3O2IA 3S1TA 5LSOA 2GVDA 1IKXA 1FVQA 2AF6A 4DI6A 2WBMA 5K8PA 4JI6J 2DPIA 1Z4UA 1OQ3A 2OPQA 4M5JA 1IBKJ 3OVBA 1YZ7A 4DUZF 1QY7A 1VJQA 2FB0A 1W2IA 2MQ8A 4DSEA 3DLGB 3KJQB 2KXFA 5KFKA 2ZH1A 2K1RA 3RRGA 1RAIB 4C3KA 3PEHA 1TK5A 2CDRB 1IBLJ 3I07A 2VPYB 4LRCA 3UD5A 1UWDA 2ASJA 2R2UA 2VL1A 4MIWA 1REGX 3AD8C 3M30A 3N79A 2O67A 2M2BA 1G4CA 5BYSA 4ZIVA 3D0IE 1R27B 3KG1A 4DCVA 2R3VA 1JB0C 2Z2ZA 4BC7A 1H2VZ 2P2BA 3G87A 3G8QA 2PA3A 4P2FA 1KS2A 4J37A 4RW4B 1KSPA 1J5EC 3IN5A 2UV8A 5IQQA 3UDCA 3MEEB 5KG3A 4IRDA 4OX8A 5DV9A 1H98A 1IJEB 3I0RA 1S1TB 2EG2A 2HHXA 4R1MA 2R7VA 4DPYA 4UTGA 2W2OP 3KJNB 2QRRA 2ASDA 1U48A 1N0UA 4G37A 2OSQA 3VGUA 1IKYA 4CNYA 3UX2A 2EBGA 1N5YB 3AF6A 4JI5C 2W8KA 3DDNA 1H74A 1S1XA 3MEDA 3GFXA 3R7SB 4U67Q 2HWIA 1J27A 1UFKA 2J5AA 1AMUA 1M6XA 2CJYB 5D4LA 5BUQA 2XZWA 3TUPA 2DGUA 4XDDA 2G0IA 3JAMU 4QWAA 4HTIA 2OSRA 4LUBA 3MURP 5F9NA 4LE5A 4H4KA 4D3GA 4WK1A 1FRLA 2EFGA 4LF8C 3H2LA 4LBIA 6AT1B 2PROA 4DZ6A 3D5MA 2CZVC 2HFUA 2E1RA 4DFKA 4FNIA 3J80Y 3S6EA 4I6AA 5KT4A 2QN6B 1U6FA 3IS9A 1PO6A 1CJVB 5GADU 4IG0B 4NLTA 3EVWA 4ES3A 2ONFA 3SQOP 1TP7A 3BYPA 1KFSA 2VOPA 4Q8FA 3J7A1 3BM7A 4M5IA 3OL6A 1NM2A 1S59A 4G1PA 5KFIA 3D6FB 2IYIA 4LF4C 2AYEA 3A8KA 4QIVA 3D66A 5L1LA 2WTFA 3KHRA 4NOZA 4I4BA 3H5SA 5ETNA 2KHCA 2OPSB 1CC8A 2PE8A 3CNQP 1M5KC 1ZYQA 4CLTA 3AJ2A 1F0XA 1S0VA 3BBFA 2AYGA 3GWCA 3LGMA 4A8SA 3BGOP 2MPUA 3CC2S 2M8DB 5KG2A 2BJ1A 4EFAC 3JSMA 2I5JA 5T8TA 3OFGA 1OYDA 4KIAA 1SC4B 5KT2A 3HCXA 1KLMB 2XR1A 2CNOB 3UEBA 2V8VA 3CWJA 1T9TA 1BHNA 2DT9A 3TX0A 4HI2A 3TAPA 3R5DA 1HBOA 1VI7A 3K6RA 4TY8B 3DOKA 1NK9A 2DHXA 2RE1A 2AJQA 5D4PA 1U02A 5KT6A 2I38A 1N32J 1EJ7L 2QZ8A 3UVJB 4RW6A 4LBPA 4B9UA 2BANB 3CJEA 4UOGA 4I2PB 4RLQA 2R2TA 2AEJA 5FIIA 2P2QA 3M8YA 3MFHA 3MM7A 4DV0F 1VIXA 3R5GA 2KVIA 3L95X 3I82A 4W92B 4M1KA 3RAMA 4EGLA 2MMYA 1YJRA 3VAJA 4M5HA 5J2MB 1AZSB 1WHYA 1F1BB 3P5BP 4TVAB 3EVOA 2UVWA 3LOUA 1EP4A 4YS2A 3W8GA 2MSTA 3UCUP 1XMOF 2DGVA 2GQQA 4N77A 4UW2A 2W24A 2G0JA 5E5NA 4AYBD 1FJEB 4DR1F 2VA2A 3M8SA 4NLQA 1G3OA 3Q8UA 3DXBA 4LRDA 5HMZA 3VR1A 3UD4P 3E3XA 2AHOB 2NXCA 3M8WA 2JWNA 5F8HA 4QIWD 2KJVA 5F8GA 4QW8A 2F8HA 2JEJA 1QM9A 1RYRA 3RW7A 2KDNA 2F4VJ 1KOOA 4K50A 1Y7PA 2CPHA 3MPDA 3TJ8A 2B8QA 4CO0A 4NLXA 3T19A 3GMGA 2RD5C 3HD1A 2KZ0A 2HEKA 2GMLA 2P8IA 2BVZA 2OP5A 4C8YA 1S1WB 3NL0A 3C14B 4RW8A 3IO1A 3BPDA 5B0CA 1L3UA 4MYTA 2J76E 4LSLA 1FTCA 3TQ1A 3CIMA 3UX3A 3FC9A 2PN6A 3EUNA 4DQPA 3TI0A 3PROC 1GAOA 2ASYA 1VFJA 2DHHA 4ZK7M 3X1LB 1TU0B 4LFCJ 1YZ6A 3P49B 2DIUA 1RQ0A 4ZPAA 4X4VA 3CW9A 2HVIA 4OX6A 1R6YA 3TO8A 1CQNA 3TVKA 1TKTB 2CA9A 1RWPB 3H0PA 3M1VA 2VZEA 3OTBA 2MGZB 2JLGA 3U1NA 3MMCA 1XNQF 4NXNJ 1N54B 3FEYB 1HNWJ 5ETLA 1B64A 3W8PA 3OTOF 3VALA 1DURA 3HPOA 2M4MA 2UUWA 3BO3A 1YBAA 1IBMC 2KXHA 2X1FA 3GLJA 2YY3A 4JI3C 3VNQA 2D3ZA 1Q8LA 2GMHA 5L1IA 4ODJA 2GAGC 3HSDA 3O1LA 5D3GB 2Y1LB 4UUXA 4L4QA 2KI2A 2UV8G 4QYZK 1XMQC 3AOAA 4KV8B 4BDPA 4F50A 3DLKB 4CO3A 1WOSA 2Z8QA 4HVZA 4AXJA 2AYBA 2LQBA 3CCUS 1SJ4P 2WD9A 3DRPA 1U1OA 4FYWB 3E51A 5K9FA 4PXCA 2L08A 4QR0A 3P3DA 4LVNP 3PM9A 2E8FA 1MSWD 1JLGA 2CVEA 2G1DA 1JNZB 3HD2A 3LP0B 2ROGA 5LMUC 2RHQB 2ASBA 3CQ1A 4MTPA 2KKHA 4NWBA 3FGVA 4OV6A 4RR5A 4OHVA 3TZZA 1T5DX 4FBTA 1WJ9A 1JLFA 3GFYA 4OYXA 3JTNA 4HYKA 2UXDC 5F3ZA 1I3OB 4NLRA 5ETKA 3V2UC 1NK4A 1FJGC 1GFWB 2QLFB 1RAJA 4OI3A 4PUOA 5A19A 1HI8A 5CYQA 3K8VA 2H9ZA 1CG2A 4DR3F 4JI7J 3DAYA 4YR2A 4PWDB 1IM6A 2D7SA 4Y28C 4PG5A 3NBPA 3G7SA 3VWSA 2ATCB 3LPYA 3ILIA 4URSA 4OHYA 1AXQA 1JMTA 2DHMA 2DRBA 4F36A 2MZSA 4B3SF 2RF2B 2IC3A 5T14A 4NE9C 3KUHA 4DPOA 1UFWA 3KK2A 5H9FK 2UVUA 3QNWB 4NX9A 5HLFB 4UOFA 3I9ZA 4ZPVR 1TL1A 2AIRB 4RO0A 4PUHA 2CXEA 3T1YJ 1S79A 3M2VA 2CIMA 5ETRA 2ZM6F 2JDJA 1AFJA 2VBZA 5CZVA 4DR7J 5ETVA 1HA1A 2FD2A 3MMAA 1BXNA 1FRMA 4JBCA 5CYMA 3WIUA 5FJ4A 5DZ6A 4LF6J 3HKWA 5H9EK 2EKYA 2EW9A 1S6PA 4USJC 3HULA 4K0KF 1VQLS 2B5JB 4AL6A 5EN1A 2UXBJ 2DEJA 1AW0A 5LMNJ 3RTVA 4DR4F 3E7WA 4X65J 3GSIA 1S6UA 2VJVA 4JI7C 1DTTB 3BH7B 1XEZA 2FGOA 2D1RA 2ZWOA 3UW1A 2AX0A 3NEKA 5K8OA 2I2YA 4OMFG 1FT8A 3JTPA 2CJAA 4OXIA 3R2DJ 4WPAA 3QATA 2H51B 3LGNA 1QAJA 2UVVA 5CD4A 2BE7D 5F8MA 1N88A 4ELUA 4CLSA 1ULRA 2N4DA 3AY0A 1Q0NA 2LA4A 2C2RA 4FXVA 4JI0F 2IAJB 2MCQA 3IEVA 2GIQA 3DGVA 1HNXC 4FP9A 4ZVRB 2XY6A 1JLQA 1UCNA 2H4WB 3KUEA 4LFBF 5AT1B 3T1YC 1FF2A 3BBBA 5A2QY 4RPFA 2E9ZA 2DBBA 2V4JA 3C6TA 7FDRA 3C66A 4BBYA 3M6WA 2L9WA 1TV6B 5A8RB 2MKHA 1GTEA 1JKHB 4CTAA 3KLFB 1L5UA 2F9DA 2C3OA 1E6VA 2M8HA 4K0BA 1B70B 1TK0A 2CJXB 1DJ0A 1RHKB 4MIBA 4J9OA 3KYLA 2QJ3A 4EBEA 2KG0A 1QD1A 1WSRA 5D0HA 1X5TA 4EYHB 2R7SA 3LWLA 1FKPA 2W7AA 5F3TA 1HWLA 5C24A 6FDRA 1S9EB 2EFPA 5F9LA 5LMNC 1I1GA 5IZHA 4GC7A 4QIEA 4LIWA 1IQZA 1MD9A 2DKOB 2PI5A 5HANA 2PMZD 3ZTSA 2P2CB 2VBYA 4NOHA 2NYHA 2ZUGA 2RQCA 1N36F 1KWMA 3V4IB 3W5ZA 4D4GA 1OYEA 2CPFA 4NZ0A 3BSCA 4OZLA 4N8OA 2HHHF 1GMVA 2DNKA 3Q2SC 4ZP9A 2MJUA 4LBHA 5LXRA 1N2FA 1QUPA 4P7VA 4NL5A 1RTHB 3CCZA 3ZTPA 1B4SA 1L3VA 1EQ0A 1EQMA 2KM8B 3BGRB 2IRYA 4DV1F 5EWFA 4DPUA 1VQPS 3RV2A 1WSVA 4WFXA 4BCAA 1B3TA 2P9GA 5KYTA 4GRSA 1Q5YA 2WZ1A 2VU5A 4JV5F 5HVHA 1KBRA 4GMKA 2E5HA 4NLWA 5DQHA 2DK2A 4GVBB 4KBIA 1OJ4A 2OD4A 2VASA 4FKXA 2ZBIA 3PIOQ 4GKJJ 2E7GA 3I5AA 1JIHA 4CIOA 3MTJA 3IMQJ 4FVMA 5AJ3F 3G86A 5GAHU 5G4DA 5HJXA 1VQOS 3FFIB 4KRWA 1RUSA 1SIWB 1OY8A 4QR1A 3VHQA 2H48B 3MOZA 4MFBB 1R8CA 1Y00A 4J9PA 4D56A 2HSEB 4ID5B 4P71A 4OYOA 1YJNS 5I42B 1S0NA 1BA3A 2RAQA 4J9LA 1RT6B 3MM6A 1IUJA 1GX5A 4ZP8A 2Q3PA 5HL7Q 2Y8WA 1D09B 1IKWB 3H5XA 1NSPA 1BY9A 2ZZTA 5FDLA 1Y3JA 2FVQA 2MZTA 4ISBA 3OR2B 3QJPA 1NH7A 5LT5A 2CDQA 3FZ2A 3GCXP 2E0GA 4F4AA 2HBYB 3S8SA 2AW0A 1Q8IA 2DHGA 2HVDA 3Q23A 4NZ6A 1N33J 2GNKA 4OLPA 4B3RJ 1FK9B 2JEIA 3VNSA 4X64J 2W2NP 2FJXA 3JB9k 4TU8A 1J2VA 2ILYA 3MD1A 5JVHQ 2PMWA 4GKJC 2W9CB 1VQSA 2QLJB 5FLXD 3H7HB 4TU9A 4DSJA 1HNVB 3KG4A 4GO5X 4PPZA 5E3PA 2RQKA 3SSRA 5K8FA 3P8BB 2EK1A 3RG2A 1EAYC 5B0DA 2YNFA 3T6BA 2Y0SD 4M8LA 3IPLA 4M95A 2E1PA 1OY6A 3BN7A 1WF1A 2C22A 4ZLJA 1FRXA 1ICEB 2UUCJ 4NLGA 4J91A 1UKUA 2QMWA 3HVWA 1KHVA 3QO9B 1B7FA 4LF9J 4OJHA 2R42A 5HATA 1FRHA 1MWYA 3KLGA 4MKVA 3J7YI 3O6QA 2QL7B 2JNJA 2R7UA 2BKOA 5IT9D 1HWIA 4JI4F 3EPIA 1KQFB 1FX2A 3SDEA 3FDSA 4F67A 2HZVA 1UP1A 4QOTA 5T41A 2W7OA 1I6JA 2XWXA 1YVFA 1OS5A 5L39A 3MECA 3HX9A 1XNRF 5DM7Q 1K73T 5H9UA 3M8PA 2O01C 4CO5A 4KGKA 1NJIT 2HFVA 3V6DA 1IKVB 4X64C 4PXDA 4B3TC 3KNAA 3ET6A 4CLYA 4OX7A 3NMAA 5IV4A 4B17A 2HMIB 3DYAB 3OR1A 2DNPA 4CT9A 2AZ3A 1DTQA 4U7UK 2FHOB 2XMJA 2UZAA 4RUHA 1U6ZA 2PGCA 4E98A 4DL2A 4DS5A 3EWGA 1R6VA 1UETA 1IQTA 4OYIA 5AE2A 1WWHA 5DM6Q 3G6YA 1VHFA 1FE0A 3UPFA 2MKSA 2BJDA 3QPIA 3PG9A 2HQ3A 2CJQA 1WUUA 4RVNA 3DOLB 1WKLA 3SO4A 5IFIA 1VQMS 3VAFA 2PMHA 5LSRA 2QG9B 1LKZA 3PO4A 4P74A 2XMTA 1VDHA 1XJWB 3THPA 3GB0A 4DL6A 5HP1A 2A2DA 2XSFA 5KFLA 4O4GB 3W64A 1ZM2A 4DV5C 2YKNB 4LSNA 2W7PA 4PG4A 4N5SA 2NREA 3VAKA 1ZPVA 4Q8EA 5IM0B 3RB0A 1M0SA 3UI3A 2KZMA 1FEEA 2Q79A 2KT2A 1ZM9A 2VQEJ 4MH4A 2ZH5A 3W5XA 4HT7A 3P96A 1CJTA 3RBZA 3A3OB 4PQUA 2MZJA 1TK8A 1RTDB 2YWKA 4Y2KA 1T02A 4DV2F 3ISZA 1AA1B 1HBNA 2BW7A 4CLZA 3S7RA 2NSBA 3OFEA 2F8MA 3BKFA 4ECVA 3H5UA 4AFFA 1KHWA 3M6XA 2BJ3A 2V34A 2SXLA 1ZTWA 1X60A 1SH2A 1NJZA 4QYRA 2YWHA 1CEZA 3NAIA 4GXRA 4C3LA 4ZLNA 2XULA 3V6KA 1YHQS 1RA7A 3EX7B 4HHHA 1IR1A 1RAOA 4G6VB 3SCJE 4ZA1A 4USMA 2J6SA 4I68A 3KLHA 3OTCA 3TUZC 5B0BA 4ZPWR 2UUAF 1V9OA 2DR9A 4M5GA 1RT3B 2N7YA 2HNDB 3CGIA 2FJAB 3DLJA 3MR2A 1LW0B 3Q89A 2UVRA 4YFUA 1HHSA 4FXDA 3T5JA 2ZH2A 4ECRA 4I2QA 3BBCA 3ETCA 1QAIA 2W9BB 1X9MA 4C7QA 2YNGB 4USIA 1S1XB 4CH0S 4EWTA 4DG1B 5C25A 5BSMA 2MHNA 1TKZB 4X4PA 3BYRA 2X7IA 2VIHA 4AL5A 1WF3A 1C1CB 4USTA 1S0MA 4YB5A 1HR0F 3UZ0A 2XYGB 1CULA 2OPPA 4IOAQ 1BQNB 5HQMA 2VQFF 1MWZA 3LP1A 3ZZZA 2Y3YA 3N28A 1IR0A 2ZH8A 2G0CA 1LQ9A 2VFSA 1Z1ZA 4ZVOB 3HT0A 2L41A 5JVGQ 3PBKA 5D0GA 1FFGB 2OIHA 3K2YA 5C42A 3DRSA 3PHEA 1RAFB 2V7BA 2V50A 3IS9B 4TU7A 3GIMA 1PAUB 2H5EA 1U45A 3GPAA 4IFYB 2GGPB 1VRUA 3DRXA 5BSUA 3KHLA 3KLEB 2GVZA 3ONQA 4J9VA 1S6QA 1B99A 1FA0A 4ECUA 4DV3C 2VG6B 1WKJA 3W9IA 2JEGA 1MKYA 3NGRA 2HVHA 2RRNA 2JFKA 2BABA 4OYWA 3DHXA 4WIQA 1R0CB 3TZYA 2Y8YA 3R2CJ 3KNGA 4H4MA 4TLRA 4DEZA 2HHUA 3ZNJ1 3W7BA 2Z2YB 2V2VA 3A9UA 1O92A 4RM2A 2DEIA 2WAQD 2I5JB 1WEYA 3MPYA 1Q8BA 1HNIA 3H5YA 2C2EA 4F3QA 4ELVA 3N6MA 2AX1A 1PBAA 4WV3A 4OQJA 4FF4A 4H4KC 5BSTA 5KFQA 4I9GA 3D67A 4Z7CA 3WIVA 3GFHA 2V5HG 9RUBA 5CZXA 1TAUA 3FQLA 1RWUA 3VGSA 2OPLA 2LA6A 1OPZA 2HFZA 2V8HA 2F9JA 2ZFHA 3GV5B 3VAMA 1BGXT 1HQEB 3W61A 4RW6B 1U8WA 2J0QD 1J5OA 1JLEA 4RX6A 1LW2A 4HLBA 4FUQA 5IT4A 3DM2A 3GONA 4KHMA 5B08A 3B4MA 3U02A 3AQPA 3KUGA 4CQ1A 3DKDA 4ETXA 4ZITA 1RTJA 4DFMA 1XMBA 3D7SB 1R8AA 2R2SA 3FZBA 3E7XA 3PZPA 2HPUA 2HZCA 4U8VA 1WELA 2EFVA 1KVJA 3VV2B 4WKYA 1BD6A 3UNYA 4MTNA 1EP4B 2KYZA 3M8ZA 4NCGA 2R8IA 1QSLA 2MYFA 2K06A 1KONA 3ENAA 1EX8A 2BJOA 1UJ5A 2C2KB 4PUIA 4DR2F 2VG7B 2WVDA 4BWJA 1BE4A 2FC8A 4K4TA 1K0VA 3NNCA 2BOPA 2YKPA 4RUBA 3MPWA 3BEGB 1KD1T 3HDSA 3CTRA 3NGTA 1K0RA 3CW2C 2GAHC 4MK7A 2CADA 1UWBA 1MXCA 5CAAA 4YMEA 3MXHP 2VG5B 1IVZA 4IG3B 1SV5B 2XMKA 2G2YA 5KFVA 4S0MA 4KTQA 2HFOA 3T9NA 5E33A 2AEFA 3DRRA 1DQAA 3THVA 1IJFB 2W2MP 2F7VA 2DISA 3HVTA 4R0EA 4ZIWA 3EGVA 4WE1A 4ZJLA 1TAQA 5CQGA 1AUDA 1HYSA 1ZB9A 2XSJA 4ANCA 1TKXA 3LPEA 3DOMB 4HH0A 2D7VA 3SV3A 5A8WA 1B0TA 4DV0J 3J80D 1SJFA 1FKOA 2VODA 2E1MC 3A1YG 2AT1B 1OSDA 5F0UA 3DMJA 1NDKA 1S4EA 1XMOJ 4LR8A 2XEXA 3J7AN 1XWLA 2CPDA 2GMJA 5I3PA 3MF5A 1TMMA 3IRXB 4KFBA 2RDDA 2K7KA 1EETB 2Y1RI 1FE4A 4DF4A 1GMUA 4J5OA 3QMQA 2MQOA 1NDPA 3OSPA 4RW7A 1WI8A 3UOWA 1WH9A 1R7IA 1X5OA 3CXCR 1RJJA 3TP2A 4M5KA 2WVEA 3W9HA 7FD1A 2ZOFA 4P52A 3DLEB 3I55S 4ZMMA 4YDXA 1U1LA 1F5CA 2R4FA 2ZNZA 4IH5A 2XGPA 3G82A 1L2FA 3MGJA 2F63A 4EUVA 3M8QA 2IDLA 1NZAA 3OXGA 1RCOB 2DGWA 1K9MT 4KPYA 1UVIA 2CQIA 2YPYA 1MROB 1LWXA 3DRPB 3DN9A 1X9WA 4Y2IA 3AD7C 1FD2A 3P5TL 4PG6A 4GC6A 2BJ7A 2MQMA 5LJ3Y 3W5YA 3BZQA 3I31A 4JV2A 1R8PA 2YNIA 1RU1A 1IB8A 4KR0B 4OI4A 1HNZC 1XMOC 2WOMA 5J1EB 4RKUC 2UUBC 1HQUA 3SIPB 2VBWA 4G1QA 2RKIA 1XNQJ 3PVXA 1RT1B 3OTDA 3CF5Q 4PUOB 1LK7A 2F4FA 5CYQB 3OTOJ 1TR0A 3FVYA 4BWMA 2KG1A 1OSCA 5BYRA 4WJBA 1WG5A 1FWKA 3IP0A 1U0HA 1I5OB 1RT4A 4X62F 1VBZA 1E6YB 4CYUB 1KKGA 2XO7A 3R5JB 4DPXA 3AB4B 4DWIA 1XRBA 3L9ZA 4I6YA 4F4ZA 3HHEA 2YTCA 2IC3B 3GZ7A 3MHYA 1USPA 4BS2A 2LXUA 2PO4A 3MDFA 4TQSA 2DHAA 2VA3A 3V5RA 3VAIA 2HNZA 1GEHA 1TL1B 2JLFA 2MM9A 2RILA 3QYYA 4DPTA 4K4XA 1K44A 5J2NA 4DG8A 2VFUA 3FBFA 3PKMA 1P27B 1HFEL 2XYHB 4ECWA 4NCAA 1FXRA 1DFDA 2KL8A 4PQAA 3MMAB 2OELA 5CYMB 4Z37A 1NSAA 4MIAA 4WP3A 5F8LA 3NNHA 4ED8A 3V81B 3QQCD 4OYCA 1X9SA 4ECTA 4MH8A 2YWGA 4JYAC 4OZ0A 2IA0A 4DV7F 3FKBA 4KGMA 1X4AA 3P4UB 5A0YA 1APSA 1XNQC 3UDVA 1VLAA 3GYXB 1LWFA 1HW9A 2D41A 3ZZTA 2BW2A 4DFPA 3ISNC 4HDHA 2OMOA 5HJYA 4DR3J 1LK5A 4NXMF 4KPCA 4ED5A 1ZOTA 1WC6A 3MR5A 3BKUA 1CPZA 1CQMA 4ZVUB 4JI2F 2C2MB 1UEUA 1RT7A 4NMLA 3BO2A 1M1GA 4B3SJ 1T9YA 3G6VA 3M32A 3GPCA 2CQDA 4DOZA 2LLZA 2QGFB 3CPWR 5A6PA 2E1AA 2V2KA 3IA0A 1VQ6S 4K5RA 1JLQB 1L3TA 3A12A 2IMWP 1OIAA 1UZDA 4RNMA 4YN3B 2QA4S 1UL3A 4E2FB 4Y2CA 2ZM6J 1FI4A 1BC6A 2IM1A 1NSQA 4LF5F 3H98A 2B43A 1MU2B 1Y9OA 1A9NB 1XHJA 5K14A 3KG0A 4X2BA 1G1XA 3VTIA 5IS2A 4K0KJ 1NK0A 2LU2A 3DFEA 1QAYA 1U6BA 5C24B 4TPSB 4F0MA 3TZWA 4ZPTR 1S77D 4FPRA 2KM8C 3W62A 1Q7LB 3NCPA 1ZB8A 4OX9C 3RRHA 2PFDA 1X7VA 1JLAB 2FLPA 4DR4J 2RQMA 1T9UA 4Q43A 4DR3C 3T1HC 3F41A 4O4RA 2LEBA 2AP6A 4DV4C 3HHLC 2ZWPA 4NCBA 1YJUA 5LXYA 2J9DE 1MMLA 3ENWA 5GAEI 2MDAA 4P2MA 1Q81T 4NMXA 3RR7A 3M2RA 5GMKa 3QLHB 3LA0A 4ZVHA 3J81Y 4JI0J 4U5YD 1X31C 1K0TA 3FQKA 4DUTA 2QEXS 4QU7A 5C2CA 1V3RA 1X4GA 4RM3A 3D6HB 2QVXX 4LFBJ 5KFHA 1ZBTA 4TN2A 3MPVA 1FDBA 1F6TA 3QGIA 2WVFA 3IFEA 4O3PA 1S97A 1TTHB 2ZM6C 1REVA 4GS5A 3UD3P 3D0GE 1KRPA 1IR2A 2QSFA 3TARA 3OUYA 4GKKF 4P72A 4DS4A 4OYPA 1PJ5A 2W2QP 4C98A 3PFEA 4DG9A 1TUGB 2IIHA 1UA0A 1NB2A 3ZO7A 4Y3CA 3LP2B 2LQ8A 2OJ3A 2OUGA 3NKYA 1RT2B 2Z56B 3QIPA 4DR5C 1X0PA 3C6UB 3RU0A 1OPIA 2A0FB 2KU7A 2HS0A 2J9CA 2V94A 1VBYA 2EC0A 3BREA 2DNYA 5CHCB 1LWCA 3CW8X 2W1BA 1N36J 2HNYA 3PXGa 1CJKA 4KHPC 4RU9A 1S9GB 2QIFA 4DCOB 2BA9A 4DX7A 3QRPA 1RSCA 2AJ0A 3MM6B 2HHHJ 1SL1A 4AD6A 4HPVA 1YKWA 4F25A 2PA8D 2BE2B 3C16B 2Z57B 2DNNA 4WCEQ 2EFQA 3BQ0A 5HROA 3R3TA 4DQIA 4U7CA 1O6XA 2KZFA 5FDLB 3N6NA 1R43A 3TA0A 1F2GA 2W9AA 5L9NA 5K20B 3AXMA 2DRAA 4DSLA 2JL9A 2D28C 4WP8A 5A76A 3TZXA 5BR8C 1WOOA 1HMVA 1FXDA 3GE9A 3OPKA 3H2UB 1TUWA 3LGHA 2LKZA 5MAOA 4JV5J 1I94C 4ZHRA 3ITHB 1YJ7A 1C0TB 3NI2A 3ZTRA 2LEPA 5A2QD 1V3SA 1Y0HA 3MM9A 5ETSA 1QE1A 4A8YA 2NXUA 1KVKA 2DGXA 1T94A 2LMIA 4IR7A 5AJ3J 1V60A 3BF4A 3W60A 5D0RA 5E3RA 2E7WA 2E7XA 1RY2A 4KGXB 2X51A 2YNFB 3RRKA 1SJ3P 2B9EA 3IEUA 2MEWA 2ZOGA 3OXFA 1F2HA 3CCRS 2IJRA 2E66A 4PUGA 3LH2S 4R0MA 1RWXB 3PHTA 3VF0B 1SQEA 1J5EF 4NDNA 1VRQC 2I9SA 1FNXH 3IWXA 4OZ2A 1QAXA 3DI6A 2MKKA 3KOAA 1N6QA 2HG4A 4LJMA 2B7BB 5RUBA 2NQPA 5J2PA 1ULTA 3U27A 1Q79A 3MECB 1QTMA 1NBEB 4JI5F 2CG4A 2FPHX 3IBFB 2ZVIA 2Q43A 4XX2A 3M8PB 4KJIA 1GT8A 4JV5C 3BSNA 5HK4A 1RI7A 4PYAA 3NOGA 3CCQS 3UN5A 1SQFA 3ET6B 2GO8A 2HAFA 3LO3A 1T9XA 1VEHA 2FVCA 2QL8A 3KMQA 2CNKB 3EGWB 1NPRA 3GP9A 4LF8F 2JEFA 3KTQA 2V8PA 2F5GA 3SZ2A 1VRTA 5KFTA 2R7WA 5H9EJ 3NS6A 2APOA 3FRYA 3HSJA 5G0RB 2M70A 1BQMB 2H5IB 4IQXA 5FLXU 2HHTA 1LWEA 5DQIA 4MMOA 2B4VA 2CZ4A 4WFYA 1VC5A 2PEBA 3IR7B 3ZTOA 1P9YA 3FEZA 3SCIE 2XI2A 2AQ4A 1F3VA 2IVYA 2D3O1 2NUUG 4ATNA 2XB2D 2XC9A 2ACYA 1F60B 4O23A 2HS4A 2V9WA 3AB2B 4JI4J 2CXCA 1WHXA 4RUAA 5HP1B 1D9FA 2DITA 3KK1A 1R89A 4ED2A 1SJ1A 1X4FA 4LF4F 2ABYA 4B9NA 2P9EA 1TFYA 1SQGA 1VK3A 3PESA 4ELTA 3PTWA 2HJGA 5ETTA 2PC6A 5IT9U 2AJFE 2M5YA 1XNRJ 2HHVA 5B0AA 2KTQA 3EQ6A 1VGYA 1NMEB 4DQSA 1YIJS 1QJHA 2IRUA 4OJ1A 2DIVA 2XMWA 3IM8A 2N3LA 1X4DA 4RUCA
chains in the Genus database with same CATH topology
3DLGA 5ADZA 4TQRA 2KFYA 3H4BA 4G36A 2DNHA 2ADBA 3HHKA 4JV5F 4F2SA 1ROFA 4DR7F 2L48A 2RVJA 2CPEA 4GMKA 4OZ5A 3N54B 2ZJRQ 2E5HA 2J0XA 4NLWA 1FD8A 1CVJA 5DQHA 2DO4A 3TX8A 2XMUA 5K5MA 4NLDA 3GR0A 2DK2A 2FIUA 1DAXA 3DXSX 3L09A 3QWPA 4KBIA 4NA1A 2VH7A 5DDPC 1U1KA 4MKYA 4C3MA 2OD4A 1P1TA 2CQGA 2Y4NA 4LF6F 5D4OA 3PJWA 2GW8A 2VASA 5GADI 3PX6A 2VG5A 2ZBIA 4IG3A 3PIOQ 4NYOA 1SV5A 3G4SS 3LUYA 2E7GA 1KOHA 2DTJA 3I5AA 1JIHA 4CIOA 2QYCA 4IR9A 1RP5A 2GQ2A 2FTRA 2RJZA 3MTJA 5HN0A 4FVMA 4CH7A 5AJ3F 1WEZA 2CQ2A 2MKCA 3G86A 1ELOA 2YNIB 5GAHU 1JLCA 1W25A 2WONA 5G4DA 5U47A 3ZZYA 1SUQA 2UXBF 4PG8A 3R27A 2NSCA 2R7TA 1D3WA 2VPZB 2ZH7A 1U25A 2B3TB 4YP3A 1VQOS 1VQNS 1RT5A 2HWTA 2WK4A 3POTA 3R5AA 3FFIB 4KRWA 3BGLA 1SIWB 2W4PA 4QR1A 5LMNF 3OL8A 2WOMB 3SCKE 4X65F 3Q8RB 2R8HA 4KKOB 2QFJA 1VBXA 3CJKB 4B9LA 3CD0A 3MOZA 2HS3A 4MFBB 4I7FA 4OZJA 4IKAA 1HQUB 1ZH5A 3BO4A 1R8CA 1Y00A 4MKAA 3CO9A 2O5DA 4RW4A 4WZMA 1HL6A 2RKIB 3KFWX 2ZKUA 4J9PA 5BJRA 4D56A 2R8JA 3O8WA 4ID5B 1M5SA 3DOMA 4DUZC 4JI1F 4B9VA 1YJNS 1LCIA 5I42B 1PG4A 1S0NA 1KVIA 4K2XA 4KO0B 1FTRA 1BA3A 4X66C 2JRSA 1RT6B 1S1TA 4J9LA 3EXYA 3TUFA 4O3OA 1SKRA 3MM6A 1IUJA 3NMRA 4D4IA 1GX5A 1TVRA 4ZP8A 2DPLA 4J9MA 3PW7A 2MJNA 2Q3PA 4OZ1A 3JSMB 1UVLA 2I1RA 5HL7Q 2DGQA 3VZIA 1EGAA 5THWA 2YCBA 3H2VE 2IM0A 1C1BA 2HGNA 5BSRA 4MYUA 1IKWB 3NCQA 2V8DA 2Z2MA 4F4WA 4DDFA 3H5XA 2JX2A 2YWEA 1SXLA 1BY9A 2EI5A 5FDLA 3KK3A 3PW4A 1KQSR 3PDNA 2C3PA 4JYAF 1Y3JA 5KFZA 2FVQA 2MZTA 4WIIA 1M5VC 1DZ5A 4ISBA 3OR2B 4CZCA 2DNRA 3K8WA 3QJPA 5I3UA 2ZC4A 1MXAA 1UVKA 3JYTA 3FCCA 4IH7A 2I0XA 4QPXA 1NH7A 4OV1A 1USPB 5LT5A 1S1VB 4PRFA 2CDQA 3FZ2A 2E0GA 1SI9A 2DH8A 3S8SA 2AW0A 1HBOB 1Q8IA 2DHGA 2HRYA 5DQGA 4F4YA 2B9XA 3Q23A 1JJHA 4FZVA 4NZ6A 4DR6C 4EO6A 3DOKB 3IRXA 2GNKA 4ECYA 4C11A 1RKIA 5ITHA 4OLPA 4G1IA 1HWJA 2P2MA 1R0AB 1U8SA 2FVPA 2PEHA 3LUSA 2HNZB 5KFOA 4DCTA 4IUFA 3ZZOA 2V4RA 4L72B 4JOUA 3HMJG 1EETA 3GYNA 4LF7C 1FK9B 1JJ2R 5BSVA 4KTTA 2FJBB 3A9VA 2CQ4A 4LQ3A 2JEIA 3TVYA 4V19X 2Z2LA 3B7WA 1N5SA 5B0FA 3PW2A 2IVFB 4GO7X 5J2NB 3VNSA 2ZHAA 3RAXA 3FRZA 2R9LA 4O3RA 4DSKA 2JVRA 2FJXA 1O8BA 4Y2MA 3JB9k 1S1UB 4TU8A 1J2VA 2ILYA 3MD1A 2CQ0A 1URRA 5JVHQ 4K59A 3MWBA 1DQ9A 2RQ4A 1UVJA 3MR6A 4NLOA 4GKJC 5DRKA 2W9CB 3DLEA 1VQSA 2ZC3A 5KFDA 3LP1B 3UCZP 5FLXD 2IBKA 4TU9A 4IOCQ 3R44A 3MM7B 4DSJA 2BM0A 3NCRA 4ZLPA 1HNVB 3KG4A 2KHDA 3M9OB 4GO5X 4PPZA 5E3PA 2ATLA 2RQKA 4EYIB 3SSRA 4M63A 5K8FA 1VQ8S 2X1BA 3THTA 4FF1A 2EK1A 3N0VA 3RG2A 1X5PA 1MNEA 2E8EA 1HBUB 4IQMA 3AAWB 4J9SA 5B0DA 3TYTA 4ZCMA 3G8TA 2YNFA 3T6BA 4XPCA 2Y0SD 4M8LA 4H4OA 3CDWA 4IFVA 4DV6C 3IPLA 5KFWA 4M95A 2GHWA 2B56A 2D1QA 3Q8QB 3BN7A 5KFEA 1WF1A 2AGOA 1NRKA 4OJGA 2C22A 1C0UA 3M2UA 3T9ZA 1FRXA 1MROA 1QSYA 3I0SA 2VC0A 3DRSB 1S49A 3JSBA 4PXBA 4J9QA 4NLGA 1O93A 1TL3A 1LWFB 1UKUA 2QMWA 3HVWA 1KHVA 3UFCX 3QO9B 4RBVA 4V19J 5M2RA 1B7FA 4OJHA 3W2WA 2PI4A 5E0OA 2F3JA 2RH3A 3BR8A 1VJWA 1FRHA 1MWYA 4QPTA 3WC0A 3KLGA 1WD6A 3SQGB 2FC9A 3PW5A 2EK6A 1KR4A 3RB4A 1VRUB 3J7YI 5DDRC 2P9CA 3O6QA 5A1IA 4URQU 3FMBA 4A8FA 1SJRA 2R7UA 2F8EX 5IT9D 1HWIA 2QMXA 4FNHA 5BYQA 3EPIA 4JI4F 2LVWA 1M90T 3Q0AA 1WNEA 1QLNA 3G71S 4ILLA 3HZEA 1KQFB 3AA9A 3SDEA 3FDSA 3E01A 3MFIA 4F67A 1MMDA 4QWDA 3ZZPA 3QZ8A 3WC2A 2UXCC 4KAIA 1UP1A 4DCSA 1SH3A 2IAJA 1K8AT 1H0HB 4Q2LA 1GX6A 1F5BA 4QOTA 1RT7B 3CDAA 3N5FA 5J1EA 3CDEA 5T41A 3Q8PB 1VMBA 2W7OA 1I6JA 5KT7A 4OJ3A 3C46A 2XWXA 2N4CA 4OI1A 3GG1A 2XI3A 4L6V3 1YVFA 3OV7A 5F8NA 1OS5A 3M32B 3TNVA 2YX4A 3NAHA 5L39A 3MECA 3HX9A 1JXEA 2XCAA 1M1KT 1RT1A 5CYJA 4FN5A 4OX9F 3GV8B 2IM3A 1XNRF 3KHGA 3G8SA 2AD9A 2RT3A 2V9KA 4J9NA 5DM7Q 3BDPA 1MXBA 1MDFA 1K73T 1NNDA 4PZPA 3PJXA 4DN0A 5FLXY 3T1HF 5H9UA 5HMWA 3M8PA 2O01C 1OWXA 3VQTA 2DNQA 4CO5A 4KGKA 1R3NA 1NJIT 5KYVA 3N9UC 3T5KA 1XRAA 3V6DA 2GHPA 1IKVB 2DR8A 4X64C 4DV4F 4PXDA 4A8QA 2WRMA 5KG0A 2CY1A 4B3TC 3KNAA 2Q6BA 2W4DA 4QU6A 2LCWA 3RAQA 4JI8C 1E6YA 5DJBA 5A8RA 4OX7A 3CUNA 3NMAA 1JKHA 4B17A 4LF7F 2HMIB 3DYAB 1IBMF 2CQCA 4RW8B 1IM4A 2A1BA 2JZ5A 3AH6A 2RMLA 5GAGI 3OR1A 1VQ5S 4PKDB 2DNPA 5L8RC 4JI3F 4CT9A 2HVZA 2OBVA 3OTEA 2FVRA 2JMPA 3HM9A 1DTQA 4U7UK 4FBUA 4D3HA 4AL7A 2D3UA 3VAGA 1ZM4A 5DG9A 4LSLB 5DLFA 3B8HA 3U1LA 2FHOB 2XMJA 1U47A 3HF5A 2CJKA 1KFDA 2UZAA 4RUHA 1U6ZA 4K4ZA 1XR5A 2BRLA 4Q0BB 4GKJF 2PGCA 1G6BA 4E98A 1NK6A 4RVOA 4TKTA 4TY8A 3CJ3A 3UDLA 2RRBA 2Y1IA 5K14B 1XMQF 1S9EA 4OI2A 1FNOA 4DL2A 4WF9Q 1N8RT 2IFXA 3WX4A 4DS5A 5EUHA 1Z2ZA 3BGUA 1YG0A 4TYBA 2ZD1B 3BQ2A 2J8AA 4NA3A 5A6WA 3K57A 5J2QA 1UETA 2IBOA 2BANA 4F8RA 5AE1A 4N76A 5IT9Y 5KFGA 1IQTA 5AE2A 1WWHA 5DM6Q 5E3AA 3ULHA 5C5JA 3G6YA 1VHFA 1FE0A 3UPFA 2P5VA 2HHSA 2MKSA 3M1VB 1H7XA 4OHZA 2BJDA 3BSAA 3QPIA 1FJ7A 1N56A 1PA4A 2YWCA 4JI6C 1HPZA 3MUMP 4ES1A 2OMLA 4I2PA 2HQ3A 4ECSA 2CJQA 4FS2A 2BRKA 1J5OB 5KTQA 2WHOA 3QGGA 4RVNA 3MMCB 3DOLB 1JLEB 3SO4A 1WEXA 1LW2B 3GQCA 2K8GA 4QJVA 1VQMS 4K4UA 2XCPA 2OH2A 4EATA 5IFIA 1IBKC 5KFSA 2YKMB 2VBXA 2YKOA 2CVIA 3VAFA 2OTLS 2PMHA 5LSRA 4ECZA 1LKZA 3PO4A 3JSRA 4O3SA 4X62C 2QA1A 2XMTA 3W2VA 5D8HB 1RTJB 1SH0A 3THPA 4LIRA 3V81A 1D0EA 3GB0A 3QGPA 4DL6A 5HP1A 2A2DA 2Y1JA 2VONA 5J2MA 3MAHA 4Y34A 3LQVA 2XSFA 4KE5A 4E8UA 5KFLA 4O4GB 2IMOA 1VK8A 2FJWA 3WBZA 1D8YA 2LQ5A 1ZM2A 4ZPBA 4PPDA 4DV5C 5LMUF 2YKNB 3TA2A 3M2RB 4LSNA 2W7PA 1IBLC 3C5EA 4C97A 4PG4A 1UFLA 4N5SA 2NREA 2YWBA 2B9YA 2A10A 3VAKA 3MM8A 1ZPVA 3GKUA 3Q8SB 2IRXA 4Q8EA 5IM0B 3RB0A 1YI2S 1M0SA 3AF5A 2ZH6A 1Q4RA 2JC1A 2KT5A 3UI3A 1NEEA 4P7TA 1RTHA 4DR5F 2DYJA 4IO9Q 2KZMA 1FEEA 1X8DA 2KT2A 2Q79A 2UXDF 1ZM9A 2VPWB 2FHJD 3BB5A 3DU5A 4K4WA 4DL3A 4KSEB 3ENQA 2NR0A 2P20A 4MH4A 4RWWA 1YRXA 2B4OA 2CPZA 2JH3A 1NU4A 2ZH5A 3T6JA 1FJGF 2WB1D 4HT7A 1NJYA 2M7SA 3IG1B 4ICLA 1N33F 1G2EA 3P96A 4O0IA 3PR5B 3RW6A 2NS1B 4QZVB 5AXMA 2E8CA 5BSWA 4CNZA 2LQJA 2DCLA 1L3KA 2N7CA 4B3RF 3TDEA 4PQUA 3H2TA 2BQRA 3BR9A 1H7WA 4ZVFA 2BZ2A 2EFNA 2MZJA 1TK8A 1RTDB 2YWKA 1VQYA 2VUGA 2HFNA 2JOQA 4RW9B 5KFUA 3UR3C 4QWCA 3G96A 3K5MA 4KHPF 1U1PA 4X64F 3JSYA 2RNEA 2GA7A 1T02A 3IAM9 4Y2KA 4A46A 1TL5A 2DO0A 3PEJA 5KFRA 5HBMB 3GIJA 3ISZA 4DV2F 4W90B 1FJCA 1HBNA 1GH8A 4DV0C 2KRRA 3NGKA 2XG8A 1U7LA 1Y5NB 3S7RA 3OUYB 2NSBA 2MKJA 2YQ3A 3CCES 3KWMA 1H3DA 2F8MA 3OFEA 3ZZUA 4IYQA 1U1QA 4A8OA 4AQYC 1JLGB 4ECVA