3ETOA

2 angstrom xray structure of the notch1 negative regulatory region (nrr)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
232
structure length
232
Chain Sequence
ACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurogenic locus notch homolog protein 1
publication title Structure of the Notch1-negative regulatory region: implications for normal activation and pathogenic signaling in T-ALL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 74
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
A PF07684 NODP NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3etoA02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3etoA01
2OO4A 3L95X 5CZVA 4ZLPA 5CZXA 3ETOA
chains in the Genus database with same CATH superfamily
4JI7J 3TEHB 1IKYA 1CC8A 3A25A 4DR5J 5ETVA 4BS2A 4NA3A 3UQSA 3L95X 3B6BA 4QZVB 3OVSA 2R2UA 1TELA 2HHQA 2MM9A 2EW9A 3MOJB 1AB8A 3AF5A 4FUTA 3IS9A 2WSEC 4I6YA 4OZ2A 4NRTA 5IWAF 4RNFA 1KTVA 1WORA 1N34J 5GMDA 3D0HE 5CYMB 2OMOA 1T94A 4ZA1A 4WE1B 3O1LA 5DRKA 4V1Ak 4DV7J 3H2TA 4K4ZA 4FZVA 4ZP6A 2RQCA 1NSKL 2QZ8A 1C2PA 5KFKA 5GAGU 4YS2A 5ETMA 2Y0BB 1X4EA 1RABB 3VV2B 3D7SB 1RBLA 1I94C 4XIUA 2YNGB 4RWWA 1HFEL 4J5OA 4F36A 4PEOA 3OTOF 4OYCA 2ZH7A 3BGRA 2LLZA 2CU6A 2VZEA 4K4SA 2VFVA 3TP2A 5KFPA 4IRKA 4KQZA 4LIRA 3JSBA 1BA3A 5F9LA 2E1CA 4KGXB 1X8DA 3W8GA 1MSWD 1BLUA 4H4KA 2V2KA 3GG1A 4UOHA 4DV0C 5KT3A 1MDBA 1IVZA 2N4CA 4KAIA 5LMNJ 1SI9A 3KG1A 3GCWP 3MCNA 4PR6A 4HHJA 4JI4F 5M2RA 1VRTA 3H5YA 3J7AN 1DQ8A 1FDNA 4EMDA 1CS4B 4DPUA 4ECVA 2LP4A 3GKUA 1FJCA 2ZFHA 3BKTA 3UCUP 2CJ9A 5DGBA 3H59A 3OTBA 3IS9B 4UY8T 4RLQA 4G1QA 2DK2A 2MZRA 1RT1A 4LF8J 4HHHA 4P10A 4QWDA 2E9RX 4LRFA 3T6BA 1CEZA 3VNSA 2D74B 1IN0A 2IYIA 3DDKA 3QJPA 4ENOA 1HD1A 4K5SA 4H4MA 4K0KF 3VAKA 4WZQA 4A8SA 2D3O1 4EZ6A 3KJQB 3T1YF 2BJ7A 2ABYA 1XNRC 1B3TA 4CWBA 2GHVC 4BHQA 4QPXA 3FBFA 2O1PA 1GAOA 2VFUA 1WH9A 1GX6A 3OFHA 2VJUA 1H7WA 4DCOB 3LF0A 1PC4A 3VF0B 3J7Z5 3N5FA 1NEEA 2OLWA 3JQKA 4I56A 5H9EJ 2KFZA 4DV5C 4F67A 1WOSA 2LA6A 2GMLA 4QWEA 1R8AA 3M6VA 4N7TA 2KVIA 2Y0SD 4JI6F 3CJQA 4ZVGA 4ECTA 4ICLB 3R97A 2V6AA 1BHNA 4MT1A 4NLPA 4YP3A 3AHPA 1YJWS 2ZNYA 1TFWA 2QSWA 3P3DA 4GKKC 3DRPA 1VQYA 4X65F 1U47A 2P20A 2FIUA 2OP5A 1T05B 5EX0A 4R1MA 1TAUA 1D1UA 5BR8J 5IV4A 3GMGA 4DZDA 3GP9A 4G1QB 3HSJA 2UXBJ 2HFUA 4DF4A 2AEMA 2W9CA 4WIQA 3K5LA 3R27A 1RT1B 2WOMB 3DCAA 4OV6A 3N01A 4FNIA 3CJRA 2V7BA 2MSTA 2VODA 4F8RA 4B3MF 3TQIA 1TQLA 1WG4A 1WDTA 3GFHA 2YPZA 1ZS6A 1HPZA 1QD1A 4H4MB 1IXKA 4EYHB 2MKYA 4FVCA 4DV1J 2R9LA 4JV5J 4RWXA 2HHTA 1HR0C 4F7VA 1ZB9A 3M6UA 2DEIA 4RNMA 2YWBA 2ZKUA 2BQUA 3PYDA 5BJRA 4OHYA 1LXJA 4DFPA 5GADI 2GHPA 1Q78A 4GC7A 1YDLA 2CQBA 2YNIA 2CAJA 2ASBA 4J91A 1XNRF 5K8PA 2AMCB 4HT5A 2XWYA 3L9ZA 3BF4A 5DDOC 4ANEA 4PQAA 4OX9F 4JP8A 2M3DA 2HMIA 2KJWA 2J0SD 3D6HB 1RTHA 4X62J 2V0NA 2AWZA 4M5HA 5DDQC 4QPTA 4GVBA 2OPSA 1LXNA 1RAEB 1P1LA 4C2MA 2XLKA 4AL5A 2QVXX 1RGVA 1LK7A 1YJVA 3FEXB 4QOTA 1VRUA 1RAGB 2HHPA 3OSPA 2MYFA 1SBRA 2WVBA 3DRPB 3US5A 2OELA 2R42A 2J6UA 1FDBA 4Y65A 5DJBA 3GSIA 5GAHI 1PG5B 2KXHA 1BY9A 3BSAA 3DU5A 1RYRA 2YWGA 4PWUA 2PA3A 1TKTA 3QZ8A 2X1BA 3AJ2A 1H38A 3M8RA 1QAYA 1RP5A 3U1NA 4RUHA 2YVSA 5HMYA 1TVRA 4ZPVR 3ZZPA 4DSIA 1JLBA 1KRPA 1M5SA 4DJBA 3C19A 3SCIE 1F3VA 2OSQA 1YBAA 3KOAA 3SO4A 3UVJA 2XNRA 8ATCB 2L9NA 2ILZA 2VF3A 2GA7A 1CSJA 3W8PA 5E7OB 4AQYC 3OBIA 3OHBA 3KDOA 1U26A 5EX3A 2RAQA 1MWQA 2ZITA 1BE4A 1EJ7L 3ENWA 4KT0C 1XTZA 1SC4B 2I0XA 1HR0F 2LU2A 4LQ9A 2EG1A 5CHCB 4YR3A 4B3OA 2RS8A 4D3HA 1MD9A 1AROP 2YNIB 1PBAA 3P5BP 4RLFA 5D3GA 4NXMC 2V4JA 2HLTA 3IWNC 4OZ0A 1SJ3P 2MEWA 2I1RA 3CW2C 2HMIB 1RTHB 4LJMA 3CC4S 3I9ZA 1HKAA 4M5DB 5FLXD 2CNOB 5F9NA 2M4MA 4NLWA 3KUHA 5CH7B 1NZ8A 2VG5A 3R6GB 1VRUB 4NA2A 3I07A 3MM6B 5LSLA 3E2EA 1W25A 2BEFA 2DIVA 1AZSA 1JIHA 1REGX 2RNEA 1YQHA 5CXTA 4CLPA 1F5AA 1WG1A 1Q82T 2VZ9A 2UZAA 2W24A 2ZDPA 5E3QA 3HVRA 1G6BA 1V25A 2MQNA 1TVRB 2AIRB 1M5PC 3ISZA 1EX8A 3TO8A 5KFQA 4QR2A 2FLLA 4LRCA 2V63A 5F8GA 1UMJA 1K73T 3BEGB 1FKAF 2NS1B 3HD2A 3UVJB 2CQ0A 1ZB8A 5I42A 4TY8A 1SKWA 3T6JA 4NYOA 2CQ4A 2D1SA 3EGVA 3THVA 1ACMB 1UKKA 5J1NA 5GVQA 2VICA 2YKMA 3G6YA 1FVSA 1V5IB 1RHMB 2V8DA 4OHXA 1IM6A 1TUVA 1LW0A 2R4FA 2VL1A 1FRIA 5D3GB 3BGFA 2GX8A 5B09A 2V4JB 4YUDA 5HBMA 5KT7A 2HW3A 2WVFA 3OR1A 4MYUA 3Q89A 1LWCA 3TUJC 3KK3A 3HZEA 2CADA 3EGNA 4RR5A 2NZCA 1LV5A 4WU2A 4MK7A 1N0VC 1HBUA 2XO6A 5CYJA 3DLKB 3H5XA 4ZPAA 4QIGA 1W7WA 4O3SA 3E7WA 2Y1LB 4GXRA 4KGKA 1N33F 3KHLA 5BSRA 3AD8C 4NYZA 2C2EA 3IWXA 2F1FA 1FX2A 2GCFA 2P9CA 2P9GA 1AZSB 3DKDA 2PMZD 2J7WA 3MM5A 4YY3C 2MSSA 4F3MA 3SSRA 3CTRA 3PEJA 3FQKA 4CIOA 4CLSA 3QNWB 4DFMA 4ZVEA 2HFVA 4ALZA 1VHFA 3QAEA 5CABA 3NXZA 1D9DA 2A2DA 3W5XA 3QZ7A 4LF5C 1Z4UA 3IXQA 4MAKA 4RW9A 1NPPA 4LBIA 1EKRA 2B5JA 4TY8B 5U47A 2HPUA 1S1TA 3AF6A 4G3IA 1LEOA 2ONFA 5L1LA 3H2LA 4D56A 3MEKA 3H5UA 2V8PA 4DR4J 2YKMB 2EI5A 4LREA 1L3TA 1XRBA 3JYTA 1X4GA 4CI0B 5D0HA 4EO6A 3F73A 4ECRA 2UXCJ 5I4MA 3DLLQ 1RTDB 1RWVB 2Z57B 4Y34A 4P52A 3HX9A 3NS5A 3A13A 1CJKA 4JM1A 1N32F 2E7WA 2WVDA 4K2JA 1FJGF 2DGOA 3OR1B 1YVFA 4M5KA 3I87A 1SH0A 3KK3B 1L3KA 3D0IE 1N5YA 2R7QA 2L41A 2OMLA 4DQIA 3Q22A 2VQEF 4OX6A 2MXYA 1PG3A 4QR1A 3LP0A 4HI2A 5DM7Q 3ZTOA 5HMZA 2RU3A 1HNVA 3OTEA 3K57A 3I0SB 4DEZA 1B0VA 5DQIA 2BV3A 2GO9A 2JNVA 1HIYA 3MM5B 1TKXA 1USPA 1N88A 1RLDA 1RAOA 1J5EJ 2LDYA 4PZVA 2DH8A 1U4BA 3RR7A 3DI6A 5EN1A 2M8DB 4YB1P 2PT0A 5AE1A 1RT3B 5C5JA 4YY3F 1AUSL 4EBEA 2RQMA 1RJJA 4JYAF 3KNGA 4DN9A 4DCPB 4USHA 2WZ1A 4BDPA 3T19A 3QRPA 1D8ZA 2VC0A 2N3OA 3HCXA 2F4VC 4UOGA 1IB8A 2QL9B 3W9IA 5K8NA 3LALA 1LCIA 1S1TB 2Z0GA 4WYWA 3EICA 3I6PA 4UUXA 3MR7A 1JJHA 1Q8LA 4DI6A 1R7IA 3KKFA 2GMJA 3M7VA 2ZDOA 2CXCA 2CZ9A 2XMWA 2HZAA 3JYTB 1TK0A 2FVSA 4KH0B 3KUEA 2H9ZA 3KLHA 2CDRB 2F7VA 1YKWA 3K8VA 1NJXA 3KMQA 1CJKB 2HYIB 1JMTA 2PA8D 3FBEA 2PIIA 2ZVSA 1NPKA 3KLIA 1R27B 1N5YB 3D28A 1FJ7A 4QCLA 3JSRA 1VMBA 3W2WA 2CZVC 4HDHA 2W2MP 3GSDA 5LXYA 2CY1A 1AMUA 1M90T 2ZUGA 5E3AA 1YX2A 5LCIA 3AAWB 3UCZP 1K8AT 3L8CA 2B9WA 4CCHA 3M05A 3LP0B 5H9UA 5KFMA 1IBMJ 3VAIA 4F50A 4RW6A 3PROC 1USPB 1RWWB 1UL3A 1HBOA 1T95A 2FPHX 4KGMA 3BJYA 4KTQA 3L7UA 4I2PA 4USJC 4XK8C 4ZLPA 5BURA 1ROFA 5J2MA 2M70A 2D9OA 5B7WA 2DITA 2UUTA 3HKZD 2ZWOA 5A6WA 2CPXA 1GMWA 4NE9C 4L4QA 3LUYA 2JX2A 1KQFB 3UR3C 5ETKA 1H3DA 5H9FJ 4DV3F 2WW4A 1H2UX 2WD9A 4X64J 2AYBA 4MYTA 1YZ6A 2QO3A 3EMTA 5CYQA 1XNQF 1L3UA 2CPJA 1UEKA 1ZM4A 4UTGA 2E0GA 1IR2A 1FE4A 2ZZMA 5HJXA 2W01A 3RU0A 2VG6B 1BUXA 2ZZTA 1SKUB 2ZBCA 2V8HA 2VPZB 3QIPA 4OIXA 4RBTA 3BBBA 2NCLA 1WC1A 4IG0A 3M30A 3PW5A 2PDAA 1I1GA 4S0MA 1SIWB 1LNQA 2FJDB 2CQIA 3PG9A 3W2WB 2FY1A 3C66A 1MG7A 2EBEA 4CZCA 2YNHA 2EWHA 1QVFR 2E5LF 5G0RA 2IVMA 4DX5A 2EG2A 5K8OA 4K8RA 4IH6A 1QY7A 4RW6B 4KFBB 3HHEA 1UVMA 1HWUA 2R7XA 5F8MA 2Z58B 4DPXA 2V8GA 2PMHA 1QE1A 3IR7B 2B9XA 4P2FA 5KG7A 4USTA 5J2MB 4KSEB 1SJFA 1RTIA 3G8TA 2HVIA 2OD6A 3A3NB 4H4OB 4NLXA 1M5VC 1NK7A 1NHUA 3MAAA 1F6TA 1NJYA 4EWTA 2JH3A 1WF1A 1LFWA 1WI6A 3PW4A 2CKWA 2WBMA 2PEHA 1RCOB 1UAWA 2FHJA 1WKKA 1SQFA 5KAKA 4DR1C 4BC9A 1R3NA 1VQKS 2BANB 3D1OA 1OY9A 2WB4A 3NCRA 5CYQB 1UZDA 2CA9A 4DR7C 2M5HA 4OYAA 2Q6BA 2M8HA 3QIDA 2ZH9A 1U1QA 3NMRA 1FX4A 3Q24A 2C3OA 5EWFA 2ZC4A 3K2YA 4NXNC 5RUBA 4RBUA 4PUOA 2CJXB 1E6YB 1FDDA 2P2MA 3I32A 5KFDA 4DFKA 1KLNA 4DR6J 4JI5C 3QT5A 3CC2S 1NMEB 4Y0FA 2B4OA 2R3VA 1HMVA 1PAEX 1ZYQA 1AW0A 3HT0A 3DLJA 4IG0B 1IBKJ 3M30B 2FTRA 2P6TA 1NSPA 1HNXJ 3VWSA 4FBTA 2ZH4A 4TU8A 3BPDA 1PU1A 3IEVA 3UEBA 2KB2A 3H25A 3C2PA 3F41A 3RAQA 3CQ2A 2D28C 1B0PA 4UQGA 1VRQC 1U45A 1R8CA 5C24A 3IR5B 1FI4A 4DWIA 4AE5A 4O3PA 2XYGB 4B02A 1VHIA 4OLPA 2FVRA 4DS5A 3MAQA 4IQMA 1NYEA 1XMQJ 3K6RA 3L4BC 1S59A 4KHPC 4B9VA 2GQ2A 2NPIA 4X4SA 1LWFB 3OSNA 1JKHA 1S97A 5JVHQ 2VIHA 2QV6A 1RTIB 5KFGA 1NPRA 4NLGA 4LF4C 3I5AA 2MCQA 3DM2A 2B4VA 1JK9B 5ETNA 4AXJA 2YX1A 1CQNA 1N52B 4NCGA 5JXSA 2ZC3A 5J1PA 3L09A 1RA6A 2CPIA 1ZZNA 3QT7A 3GB0A 3JSYA 1T9XA 2ROEA 3M6XA 4TVAB 1C1CA 4DX7A 3TA0A 1M0SA 3QT6A 3AODA 4NRUA 2EFQA 3EM1A 3Q2TC 4N76A 1EHWA 1Y3KA 1KP6A 1X60A 3MAHA 2M2BA 2VKRA 3KG4A 3W9HA 4EGLA 4JI8C 1IM4A 1RHUB 4WP8A 4DG9A 4DOZA 4DR2F 4DV6C 1QDUB 1S9GB 4P71A 5HMWA 1Z2ZA 4ELTA 3MUMP 4IOAQ 1TKDA 4DL6A 1LK5A 4OFZA 2QX0A 2RRNA 4PXEA 3ZZRA 3MR3A 5GADU 3FCWA 3L7OA 1CJUA 2NSCA 5KFHA 5C24B 1CBKA 3DU6A 3KK1B 2YH1A 4ITSA 2BUNA 1KONA 1FESA 4DSKA 4OMFG 2ZOMA 3CCUS 2E29A 1DQ9A 1REVB 2VU5A 4ED0A 3CIZA 4LFBC 4WBFA 2ZKTA 3LNOA 1VQPS 2AV5A 2XS7A 4QWAA 4OI0A 3UO0A 3Q8QB 2UVRA 1LW2B 3A12A 3GIIA 1VIOA 4I2QB 4M5JA 3PTWA 1IBLC 2ZM6C 2DJWA 1OYDA 4HTIA 4U8VA 1MN7A 3UNGC 2RHSB 2DNNA 5FDLA 2W7PA 3TZWA 2UUCJ 4X4TA 2IHR1 2YWHA 4XPEA 4KHRA 3NRBA 5E3PA 5JVGQ 2Z30B 4ZPBA 5GAHU 4W92B 4K4TA 1HARA 2MDAA 3RUBL 3ZC4A 1U0HA 1WD6A 4DR3F 3EVOA 3VAGA 4ZJQA 2VV5A 2OGUA 1RBAA 3CJ2A 1C1CB 1SL2A 4AXIA 2FJVA 3O5TB 3I5CA 3MPVA 4C98A 2HBYB 1N0UA 4DV2J 3R9WA 1WWHA 2DNKA 4ZPWR 1NDCA 3E8OA 5LMUF 2OAUA 3OT9A 3D6MB 5L46A 2GZOA 4JI2J 2VQFF 4KGVB 3NEKA 2VC1A 3KJVA 1GPMA 3BYRA 2GO8A 3RAXA 2YKNB 4LF7C 2VPYB 4X66F 3BO4A 1IKWB 1UKUA 1X4CA 1XMOC 2Y4NA 3TX0A 1Y5NB 1DTQA 1N36J 1DTTA 4OYPA 1O6XA 3NCQA 2IY5B 1CJUB 3RBEA 5B0EA 3AOAA 3CCWA 4XDDA 4WF9Q 3KLFA 5IT0A 4MKAA 3MECA 3GYXB 5A0YA 2NXEA 1FVQA 1IKVA 2D41A 1XJWB 2BJ8A 1XHJA 5G4DA 4DUYJ 3HPOA 5DQGA 4O3QA 1URRA 2K3KA 2XMMA 4NI2A 5A2QD 3W66A 3TZXA 4LFBF 3HHNB 4K7QA 1OPIA 5IT9U 4I69A 1T03A 4U9RA 3CMAS 1RISA 1SQEA 2W25A 3MR6A 3N79A 5D0EA 4YHHC 2FHKA 1VLYA 3TAMA 4RVNA 2LQ8A 2AZ3A 4KJIA 3GCXP 3U02A 1C1BB 1WC4A 2KU7A 3R5AA 2EC2A 2IC3A 6FD1A 3C5EA 4IO9Q 2XI3A 2OFHX 2V67A 3ISND 3OXFA 4DN0A 3DOLA 3V4MA 3RRGA 1K0TA 3FCEA 3QQCD 4L73A 3CULA 3SXLA 3GFZA 4C97A 3GR0A 3GILA 3BO2A 2BXJA 3UDLA 1RHRB 3P49B 4UY85 2E66A 3DFEA 5ETOA 1NK9A 3FBBA 5F8IA 2HJGA 5DO2A 1D9AA 2K1RB 3KJVB 3QWPA 5T7LB 5KEIA 4NCBA 2DGWA 2GHWA 1VQLS 1X4FA 3PDNA 4ZVPB 1SH2A 3EXYA 3KXWA 2C3PA 4DV4F 2W7OA 4PUIA 1DTQB 5SZTA 4LF7F 4ZCKA 4LR9A 4CLFA 7FD1A 5CA5A 2UXDF 1XMOF 2YY3A 3CD7A 3MECB 2J0WA 2RH3A 7FDRA 2I8EA 4PPDA 1KSPA 4EK2A 3IGNA 4ANCA 5IWAJ 1K1SA 2OTLS 1OSDA 2LQ9A 1CULA 2FVCA 3CJ4A 3MR5A 4JI7C 1N5TA 4NI2B 3DHWC 4A48A 1UFWA 1TAQA 2MLZA 3W61A 4DPYA 4DR5C 1T03B 3R5GA 4TNOA 3CVKA 1WC6A 3RV2A 1FKPA 4OZ1A 3FFIB 4RJVA 5BSWA 3OJUA 5I3UA 1X4BA 3LAXA 2HRTA 2A18A 1S76D 2DNRA 1YRXA 1MMLA 2MPUA 2CQ1A 1HQEB 5DG8A 3I9V9 5FD1A 1N34C 3QLHA 2VDIA 4LR7A 1S1XA 1WSVA 2QL7B 3EVMA 3DOLB 4RZRA 1N48A 1LWXA 3D2WA 2CVEA 1S0OA 1GQEA 1R0CB 2AX1A 3D67A 1RWMB 3GV8B 3O2IA 4DV7C 2M5OA 4YQWA 1MXBA 4BC7A 2W8KA 2MGZB 2XR1A 3HVTA 2ZWPA 3KMSA 2DH9A 2D3ZA 4NYPA 1URNA 4CO3A 1M1KT 3E01A 2QLXA 1RU2A 2Y4OA 4CLZA 1SCJB 4F0KA 1P7LA 1DHMA 2KN4A 2BM1A 1K9MT 3FCHA 2NXCA 2BZ2A 2DGVA 4OYWA 2YWEA 2UU9F 4JI4J 4OL8A 2VDHA 4IDKB 1T5HX 4DQQA 5F0WA 4ES3A 1VS3A 2HHHF 1ZTWA 2UVUA 3ICLA 1O93A 3BN4A 4CO4A 1RT7A 3HHLA 4BLGA 4NZ6A 2OPPA 3SBMA 1BXNA 4UW2A 1H7XA 3TUZC 4R5PA 4DUZF 4X4RA 4TQRA 3T9ZA 5KG2A 5LMNC 1S48A 1M6XC 4FKXA 1CULB 1RG9A 4A46A 3V6KA 1NJZA 4USKA 2WCXA 2FHOB 4MKBA 2RDIA 3TUIC 4OYOA 2DY1A 5KG5A 2L48A 3MUVP 1F0XA 2CWXA 5ADZA 1FKPB 1FXDA 3FCVA 3LH2S 3CJSA 1SUQA 4ZN3A 3M8WA 2Z2ZA 4K0KJ 4ED5A 2CYYA 5T14A 2BM0A 3I0RA 2HKEA 4MJKA 2AGOA 3T1YJ 1MLAA 2HVEA 1KS2A 4AD6A 5C42B 1L3SA 1S1XB 3P5TL 2ZBQA 4EATA 3MZIA 2UUAF 4LF8C 1T7PA 3BSOA 4PG8A 1X7VA 2XLIA 3OL9A 1XK8A 1EP4A 1S6PB 4CNYA 2E8EA 3B7WA 2VHGA 2R7UA 2QC3A 1R89A 1V3SA 3E01B 4PABA 3CXCR 4LSZB 2YCBA 2VD3A 2E1PA 3UCGA 1F60B 1UVIA 1MDFA 2KO1A 2YX4A 4JI6J 3PV8A 4K2XA 1GXTA 2YNFB 2Q79A 5D6GA 1G3OA 1HLWA 1VDHA 2BACA 2HG4A 4QU7A 2WRMA 1C4CA 3NS7B 3MPUB 3MM8A 2QTWA 3CT9A 4X65J 1NB2A 4PWDA 4KKOA 2MQ8A 1S0MA 3DLPX 1RT7B 2HWTA 1DAXA 4ZLLA 4M94A 2UUBF 4A8OA 5E5NA 4ZJOA 4JV2A 3NL0A 3L3CA 2HS4A 3TJ9A 4U96A 2EFGA 1J27A 3C15A 5MLCV 3PW2A 1BQNB 1GFWB 5D4OA 2IAJA 1PYOB 5K8MA 4DFJA 1T8EA 1S77D 1HD0A 1ICEB 2E5IA 4FDFA 2HWIA 3ZFVA 4RX6A 3OL8A 3HK2A 4ZS6A 5LT5A 5J2PA 5HROA 1RT5B 4PXDA 4BCAA 3GJRB 4B3MJ 1HL6A 3CD0A 3OR2B 5IM0B 5IT9D 4J9RA 3NGSA 4DX8H 1PIEA 4A8QA 1WELA 3IRXA 4DLGA 4RBVA 1WC0A 3G7SA 4MKVA 5BR8C 3I0RB 4FF2A 4JI0J 2UXBC 2YPYA 1RT2A 3TYTA 1R0BG 3T5KA 2QVZX 1XN9A 4OZLA 4JI3F 5L1JA 2E8FA 3TJ8A 4JI5J 2X3GA 2DHSA 2LFVA 2E5JA 3SZ2A 1K0RA 5THWA 3Q86A 1IR0A 4UZCA 4QWCA 2HAIA 2QGFB 5HP1B 1SL1A 3BZQA 5IOLA 1KNZA 4OX9J 2HBQB 4Q2LA 2ERRA 4NX9A 4DV1C 2RILA 1BQMA 1X4HA 4JV5C 2JOQA 4Q5VA 2ZH1A 1U1NA 1S1WA 1XS3A 2NYIA 2R7VA 1TL5A 3DRRA 2KFYA 2DB1A 4WXOA 1KQKA 4CTAA 3NGDA 2WVCA 4L75A 3AQOA 5BYSA 4D4GA 2XMUA 2R7SA 2AJFE 1VCTA 1J5OA 2HZVA 3MM8B 3SSSA 2MJNA 1OMSA 4KKOB 4W4MA 1TV6B 1RE1B 3M32A 2M0GB 5KFSA 4CT9A 1FRHA 2LVWA 1TUGB 3ENVA 4KHPJ 3TOQA 2KZ0A 4B9UA 3I5BA 2XO7A 1V3ZA 1OQ6A 1PJ6A 4B3RF 1MROA 2YX7A 1ML8A 3SV4A 4KY3A 3HDSA 4BSZA 1PCAA 2RT3A 2J6TA 1TH5A 4P2SA 3LANA 1UPPA 1HBNA 1MKYA 2L9DA 1VLOA 5HROB 4XX2A 3NOGA 3SCJE 4WV3A 2JVOA 3IAS9 1O0PA 4TYAA 1ZA2B 2OTJS 4C0OC 3G8SA 1WOOA 1NH7A 2IM0A 2VBWA 1S79A 4ZVQB 2QW0X 1HNZF 5CCLA 1X9SA 3IRXB 1S99A 4YMEA 3K58A 3KJFB 4B17A 1RT2B 3PRBA 5BSMA 3LP1A 2WK4A 3OXGA 5BR8F 1S6UA 4C8LA 1YITS 4ZVTB 5K14B 3UDCA 4XTTA 3QFWA 5KTQA 1FRLA 3QRQA 3FGVA 3IBWA 2DHXA 1X5OA 2ASJA 2OJ3A 3CCZA 1U1MA 3RG2A 1HNWF 3QGPA 4C8NA 2LXUA 5F0UA 5C2GA 2HQFA 2QYCA 1BQMB 4FKYA 3O2EA 1WF0A 1QSLA 1G1XA 1S1WB 4LF9F 1NDKA 2CQ2A 2EC0A 5SUHA 1UJ6A 3DRRB 4G6VB 1G4CA 1R6YA 3DDIA 2ZE2A 1IWAA 4AFFA 3FUYA 1YRTA 2HQDA 2P2FA 4NLDA 3PYFA 1H72C 1F1BB 2ZBRA 4J9KA 3NWRA 5KFUA 1U8SA 4BWJA 2W2QP 3RW6A 3M8YA 1SL0A 3VVUA 4USIA 3N9UC 2CPFA 1FWLA 4X62F 4NEYA 3V6DA 4Q2MA 1HBNB 1TK8A 2R7RA 3UPFA 3EZUA 3Q83A 4LF6J 4NLUA 4ZLNA 2A2CA 2B51A 1XRAA 4C4WA 5ETQA 2L9WA 3AA8A 3QWUA 4JUZA 2IRXA 3KHHA 3BPSP 3E7XA 3Q8RB 2HK2A 3CCES 5CQGA 3WC0A 3J7ZT 4B3SF 4R25A 3LP1B 3HSZA 1GMVA 4RLEA 1RHQB 1KVIA 2ZZNA 3CD5A 4WP9A 5K85A 3MFHA 1MXAA 1F5BA 5A1IA 3KK2B 3Q8UA 2YQ0A 3CDBA 2UP1A 4Q45A 3DOMB 4DL4A 2GFFA 2V5HG 2FJBB 1OS5A 3G9CA 3P8BB 1RI7A 4MFBA 5IXUA 5JUMA 4NPOA 1SKSA 2DBBA 1EZZB 4WPAA 4QR0A 1C4AA 3DLEB 3RB3A 3W9JA 4G65A 3T1AA 1N33J 3RB6A 4R1LA 3DMJB 4JI1C 3W2VB 3J81j 3TX8A 3OLBA 2DNGA 5C25A 1TFYA 1T9VA 3CJKB 4QIVA 4FXWA 1S9EA 3CO0P 2P6SA 4CLKA 3SYZA 3EE3A 1WACA 4FVMA 4FXDA 1UPMB 4MMOA 2X51A 3HMJG 3ADAC 3V6DB 1F2GA 3KDNA 3FNNA 4EBDA 2BJOA 2DNMA 1ZPVA 4F3OA 2NUUG 1RCXB 2ZH8A 3D6FB 4OLOA 4OI2A 3C46A 2NXUA 1RHKB 5HANA 1MW7A 2HGMA 3I4HX 2WB1D 2AX0A 2HNDB 2EK6A 1FRJA 3MGJA 3CPWR 1D9FA 4PWWA 1Q8BA 2FJXA 2DNYA 3H8YA 4MK9A 3Q8PB 4B9NA 3PYGA 4ZN1A 5M2PA 4ERDA 3PXGa 1SJ4P 2ZVIA 1Q4RA 4ED1A 2CZ4A 3R7NB 3SQGB 3FEYB 5I3PA 5K20B 1N32J 1FJGJ 2LMIA 3Q2SC 1VFJA 1P8GA 2W4DA 1RTJA 3BKUA 3N0VA 1G2EA 4J9SA 5B0BA 2IM2A 1VLAA 3IBFB 2RDJA 4MFBB 4PAAA 1TL7B 5B0FA 3QJLA 1FTRA 3MM9A 2UV8A 3DXSX 4WP3A 3TR5A 2VQEJ 1B7FA 3MDFA 3QGHA 3H20A 1NKBA 2PE8A 3PO5A 4QU6A 2UXCC 4CDIA 5FLXY 3RTVA 2A6OA 2IJRA 2X7IA 1KHWA 2Z8QA 3PKYA 3MEDA 1KEKA 1S9EB 5CZXA 1CQMA 3V4IA 1TR0A 2AJQA 3C16A 4USVA 3A9VA 3B54A 4EEYA 1NK6A 3ZTQA 5LOQA 4YFUA 3MMCB 3KTQA 4NZ7A 2BJ1A 2WSCC 4CH1A 2F63A 1GMUA 1L2FA 4WYLA 2CNNB 3VQTA 2QYGA 3LTOA 3QFHA 3T1HF 2B8QA 3NPDA 2O01C 4TLRA 3HHKA 1VQOS 2XULA 1VYAA 2YH0A 1HBMA 3L7PA 1FXLA 2FY8A 4WK3A 1TK5A 2W2PP 1VBKA 1PA4A 3R2DJ 3OVAA 3HJFA 1J5EC 4F02A 3M2RA 3VGTA 2GVZA 3THTA 3QAUA 3LA0A 1JXVA 3HP6A 2KRBA 1QTMA 1PBUA 5ETPA 4Q8EA 4C0BA 4IR7A 4ZP8A 4C3KA 1YJTA 3MMAA 1UCNA 4FBUA 4RVOA 4RW4B 1U1KA 4J37A 2ADCA 1Q1KA 5HLFA 3H42A 3M2VA 4RW7A 2G1DA 4WKYA 4ES1A 3K89A 2CPHA 4U67Q 5FJ4A 2DYAA 3OLAA 2RMLA 2C28A 2EKNA 3QPIA 4GKJF 3ET6B 3I31A 1SJ1A 4JOUA 5CD4H 2YKQA 3W1YC 4ER8A 3HI9A 2R7TA 1WCJA 5ETSA 3OHAA 1X0FA 2GC8A 4LFCC 4DR4F 1HQ2A 2XM3A 5A8WB 4QIEA 2G2ZA 5FLXU 2XGPA 3DRSA 1WEYA 2W7AA 5MAOA 2B8PA 3MEDB 3LGMA 2OEKA 2IVYA 3IN5A 3D5MA 3C16B 4C8MA 3VNQA 2CJQA 1IKYB 2IM1A 4QYZK 4IG3A 2F9DA 1O92A 1FRKA 3G8QA 2DT9A 4L72B 3SFGA 2HWHA 4ETXA 2LQ5A 5KYVA 4F4XA 1JNRB 2NCKL 4OYXA 4LFAJ 1HBMB 1X5TA 1S9FA 5KFRA 3GZ7A 4LRDA 4ZP9A 2HK3A 1IBMC 1SKRA 3WZ0A 4L3KA 3CMES 5DZ7A 4U95A 4URSA 1HNIA 3DYAA 3UD3P 1FLOA 2KL8A 5HQLA 3A26A 4DV3J 2KYZA 3TWZA 3MEEA 3H40A 1XNQJ 3G4SS 1DZ5A 3LWMA 1WHVA 1N8RT 2DRDA 3IMQJ 4FP9A 2QEXS 5C7PA 3MMAB 5A6PA 5DV9A 2PC6A 3UDEA 3LWLA 5BYRA 4M8LA 3M9MB 5HLFB 2CVIA 4M5MA 1WF3A 2C2RA 1CVJA 1Y5LB 3SIPB 1I94F 2KFNA 1LWEA 4X64C 2K06A 3BGRB 3ITHA 3LP2A 4I0WA 4LVOP 1IKXA 4M5NA 5JJBA 1KTQA 5KOXA 2WONA 4ZOSA 5HJYA 4NA1A 4FS1A 3RRKA 2BVZA 2J8SA 3NLCA 3QATA 2LDIA 3DLHA 4DSLA 4K59A 4DV0F 2PGCA 3TA1A 1WDDA 4C6AA 2DXDA 1VRTB 4IFYA 5BUSA 1DJ0A 4IG3B 4R0EA 4DQSA 1T5DX 2NZ4A 2DPLA 3G6VA 4WFAQ 1RWOB 3G87A 1PC5A 2ZHBA 1MWZA 1EARA 1N2FA 4M1KA 3UN5A 3ZZYA 4Y2KA 5IFIA 3HLUA 3C14A 3PW7A 4HR2A 1HNIB 3DYAB 4RMNA 4ZIWA 1RY2A 4TPSB 2V2QA 3H0PA 5J2QA 3W7BA 3TARA 3BKFA 2DR9A 3MEEB 3C3LA 4RU9A 1KWMA 1JJCB 2FVPA 5GMEA 3A8IA 4USMA 2K7JA 4HHUA 3HF5A 3KLEA 2COLA 2ZH5A 3VCDA 1WKJA 2IYGA 4GO5X 4QJVA 2OHDA 1FFWB 2HFOA 4DL0C 4IH5A 4U7UK 3BR9A 3LPYA 3V81A 4M5LA 3AD9C 4PG7A 4F4ZA 2AYAA 1SJQA 3IEUA 4OYZA 2QLFB 3MTKA 5AXMA 3C6UA 2FZCB 3GE9A 1LWEB 3CO9A 3ITHB 2GW8A 5ITHA 4HLBA 1IKXB 4QW8A 2DR7A 2B7BB 2EEYA 2J6SA 2WONB 4NL5A 3Q23A 1ZBTA 3AY0A 4DS4A 1FWKA 2AT1B 4DR6C 2JZ5A 1PO6A 1KFDA 1HWJA 2AJ0A 2AD9A 3C8YA 1JLQA 4ZPDA 2ZJRQ 4DV5F 1RTZA 3R7BB 4LMZA 2QMWA 1FA0A 2JLEA 1IBKC 2PN2A 2NXJA 4YDXA 1U1RA 1WOPA 4L3NA 1HNXC 4NASA 4IFYB 4RPFA 2XEXA 1RT6A 3EDRB 2PT7G 2DPJA 4F4WA 2WSFC 1YG0A 3QMQA 5AJ3F 2HRYA 4GKKF 5A8KA 1OQ3A 1RB0A 3MMBA 5H9EK 3M8SA 2AJ2A 2W2NP 2BE2A 4ZKAA 2W9CB 3C14B 2DTJA 3IA0A 1XMQC 1RAJA 2Z2YB 3VAFA 3PO4A 3CCSS 1S1UA 4ED6A 1ULTA 3EJMA 4A8WA 1AYEA 3CF5Q 1QM4A 4P72A 3KLEB 3UNYA 1HPZB 1N6QA 2DNQA 3TA2A 3PX4A 1S1VA 2CJBA 2LCWA 4Q43A 3TVKA 1RKIA 2CDQA 3C6UB 2AGQA 4I4BA 4RU2A 1YJ9S 1ELOA 3KFWX 4PKDB 2J7KA 4GS5A 5L38A 3KG0A 3RRHA 3OQ2A 4WFXA 2XYPB 3NBPA 2VH7A 2PSZA 3E51A 1NLKL 2IJNA 1JJ4A 4OJHA 1Q16B 3SCLE 4IRCA 1KBRA 2G2YA 1SIZA 4ZK7M 3W5ZA 4GVBB 2OPSB 3MD1A 5KFEA 1KN6A 1AT1B 3FVYA 1P9QC 4MH4A 3IC1A 3FMBA 2QG9B 1CG2A 3BQ0A 2BW7A 1M1GA 2VG7A 1RT6B 1GMWD 2B3TB 1IBKF 2H4YB 2JNJA 4LVNP 5IC6B 4PG6A 3PIPQ 3MR2A 1SC6A 1VQ9S 4TKTA 4ISBA 1I6JA 2HFNA 3MD3A 5A8KB 4OYBA 5L1IA 1U2FA 3MMBB 2VKZG 1TKTB 5AXKA 4C8KA 3F0NA 1S5ZA 2Y9HA 3CJEA 2NLWA 2XSJA 3BR8A 4C11A 4WFBQ 3I4PA 1FD8A 4AT1B 2E8CA 1RK8A 1JLBB 2ILYA 5EUHA 1P4EA 2BJDA 4DR3J 3FZ2A 3BREA 2XQCA 4FXVA 2GIQA 1R0AA 5HK4A 1N6QB 4NOZA 2BQ3A 2UUCC 1E6VA 3U7JA 3CCMS 2QLWA 4X4QA 2YQ1A 1FK9A 3K5OA 1GEHA 1QJHA 3V6HA 4UOFA 3BH6B 4AQYF 2VJVA 5LMUJ 3PKMA 3D0GE 3JTOA 4B3OB 2R8GA 1JLEA 4ZVFA 3TUFA 1M5OC 4Q0BA 4JI1J 5J2NA 4KHMA 2ROGA 3NBPB 1NCLA 4Y6IA 4X66J 2QL8A 4TXSA 4NXMF 2XMTA 1H6KX 4G1IA 4DV2C 2ACYA 2EK1A 2K3IA 4XPCA 4NMLA 2DHMA 4LSLA 3CE8A 1VOMA 4YN3B 4HACA 4JI2C 2G0CA 3CCQS 2BX6A 2AJ4A 2VG5B 4WU3A 1JQGA 4ZP7A 3U1MA 5KFYA 2DPIA 2A0FB 2B43A 4YB6A 2FHJD 2EBGA 2M5YA 3JXOA 2FYXA 1N5QA 3ENQA 4RO0A 3PACA 2DO0A 2D1CA 3FK4A 2E5GA 4WS9A 1FKOA 1N36C 4KTTA 1N5VA 2D69A 1UFLA 2PI5A 1FFSB 2XSJB 2QVYX 3FQLA 4FS2A 1LOUA 1Y3JA 1QWIA 2G0IA 2VFTA 1JB0C 4DUYC 4LR8A 3A4TA 5KFZA 5K5MA 2KM8C 2BABA 2XSFA 3SDEA 2MHNA 1IUJA 4PROC 2PO4A 2IJFA 1I5OB 4TN2A 1QUVA 5I42B 1R0AB 4Q8FA 2Y1RI 2XY7A 1E6VB 3OUYA 3ISNC 5ETTA 3VALA 3EWGA 1FK9B 1YBTA 1U48A 4QW9A 2F8EX 2UUCF 1AFJA 2QA4G 4NDNA 2IMWP 4NLQA 2KI2A 2GMHA 1Q95G 3B4MA 3M8ZA 4I6AA 3BS9A 3PCOB 5L9NA 4A8XA 2FLOA 3M1VA 4ZDNA 4MK8A 2CIMA 2CNKB 1LW0B 2BOPA 3PM9A 1C0TA 4Q0BB 2CG8A 5HBMB 2R8HA 3S82A 4DV4J 1NHKL 5T41A 4CYUA 1NB7A 2BR0A 3M2UA 3OTDA 4NWBA 1HH2P 4KO0A 1LWCB 2ALYB 4MKYA 3GV5B 3EDQB 2YXLA 3UOWA 2O5DA 1Q86T 3G2XA 2UXDJ 5EDWA 5KFFA 4DPWA 1UVNA 1HBUB 4CNZA 5K9FA 4M95A 4LSLB 2XTJP 2CQGA 1P4EC 2DGTA 5IS2A 2NXNA 2DRBA 1UTAA 5A8RA 4AUKA 2VOPA 3SSQA 1RLCL 4JI2F 4ZCMA 4FTFA 3THPA 4R0JA 3D1QA 4DCJB 3DNCA 3EERA 1NNDA 3GJQB 1T02A 2P9EA 1QLNA 4URQU 1YIJS 1WSRA 2LEAA 2JC0A 1FUGA 3GJTB 2J0QD 2EFNA 4HKQA 4O0IA 4RUCA 5IWAC 3CQ3A 2ZUAA 2MZJA 4ZPCA 3SEOA 3TW0A 5D15A 3TQEA 2LQJA 2R8KA 4Y2IA 4RW9B 3SDEB 4P75A 1BGXT 5DETA 4LF5F 2B5JB 2M52A 1GT8A 3R44A 1RT4A 4LRBA 2XMJA 2JLFA 4DBQA 4CQ1A 2VPWB 2E1MC 2HQCA 1V6HA 2BRLA 3PR5B 5IQ6A 5AXNA 3R2CJ 2XYHB 4OX7A 2DRAA 1U2RA 3OTOC 2ASYA 4J9OA 1Y0HA 4Y2AA 2UU9J 4LFCJ 3R5JB 4P7TA 1NU4A 5KT5A 1VQ5S 2HHHJ 3BN7A 3P96A 1VQ8S 1T9TA 1VC6A 4CYUB 2LXFA 3SCKE 1KQSR 3RR8A 1SH3A 4DUZJ 3OL7A 4E98A 4LQ3A 1DY3A 4LT6A 4DCTA 1JOSA 3UD4P 1Q53A 3H2VE 2ATLA 1NK4A 2BQRA 5HO4A 1MNEA 2Y8YA 4JI4C 2XCPA 1RKJA 1W26A 4PRFA 3MURP 5DZ6A 1N5SA 5CAAA 3AOBA 1HNVB 3N5BA 2GIRA 1J2VA 3GQCA 2LKZA 4ED4A 1TKXB 1K0VA 5A2QY 5BSVA 3OW2R 3VNRA 3DI6B 2BMBA 3TVZA 4K4YA 1CS4A 2G1HA 1IJEB 3MUTP 2MTLA 2DR8A 4RUBA 2KG0A 4ID5A 4PHTA 4B9TA 2JDJA 4LRAA 2NQPA 4IOCQ 3NP5A 3PRDA 1X4DA 2CPYA 2FD2A 3T41A 4CO1A 5HMXA 2UUAJ 1KKHA 5DGAA 3M8QA 1NJIT 4DCVA 5D4PA 4FPIA 2J7UA 5D0RA 3PHEA 1RT4B 2F4VF 3FSIA 3G96A 3S1TA 4I64A 4K0KC 1Q5VA 2U1AA 2OBVA 3UE2A 4E8UA 3T1YC 2MMYA 1JLAA 2FC9A 5F8LA 3RBDA 4N8NA 2CQDA 2DY9A 3EZOA 4UF4A 5KFXA 5A76A 4N5SA 3NGRA 3KLHB 3BGLA 3TR3A 4ED7A 1RWUA 4D57A 3F56A 4UZBA 1KOHA 4ETZA 1GK8A 5KFIA 1YRUA 2KT3A 2B9YA 3LAMA 3A8JA 4YEAA 3KLIB 4GC6A 4M63A 2UUBJ 2BE7D 2DEJA 4IQXA 1JXLA 2V34A 5IQQA 1RUSA 2VSQA 1SV5A 4JI6C 3D6TB 1TL3A 4PXBA 2P02A 1M5HA 3D66A 4F0HA 3WIVA 4FF4A 4DHVA 1RXOB 4ICLA 4RKUC 3MCMA 4MIWA 4CH7A 1PJ5A 2IBKA 4X65C 2RRAA 3IM9A 5F3ZA 1HBOB 1GTEA 1VQ6S 5A2QU 4ILLA 5HVFA 3O44A 4PUGA 1KFSA 4NLSA 1JXEA 2B6AA 2R8JA 3UDVA 4I2PB 4ID5B 1T05A 4PG5A 4NOHA 4EYIB 3PX6A 1L5UA 2QE5A 3R8YA 4D4IA 4RM2A 4JI3J 2V69A 3M8QB 1S10A 5B0DA 3NGUA 4OQJA 2J9DA 3NAIA 4U7UD 1CJVA 3LO3A 2C3YA 2WOMA 3J80D 3JAMD 3TVYA 5D8HB 3MF5A 2DGQA 4B3MC 2DNHA 4ED8A 3OV7A 2VOOA 4WFNQ 1EAYC 2H5JB 1NKCA 3GYGA 2HZCA 2G13A 4JI0C 2KRRA 2ASDA 1WJ9A 3UN3A 3J81D 1JLAB 2OFGX 5KT2A 4J9UE 2GS8A 4O3OA 1WHWA 4CLWA 3T5LA 3I56S 3FSXA 4JV0A 2HQGA 3GFXA 4U6PA 4HTJA 5DS7A 3QIPB 5L9XA 1ULRA 3ZTRA 4ECYA 3R6LB 2HQ3A 2FB0A 2LA4A 3RW7A 3QYYA 2KZMA 1PKUA 4OHWA 4DQPA 3UR0A 2O67A 2P2QA 4OX9C 2FGCA 1RAHB 3ZZ0A 5H9FK 3IBCB 4H54A 1VQ7S 4GO7X 3AXMA 2PI4A 5AE2A 2E1RA 1SV5B 4B3RJ 1TL3B 1NRKA 1WTFA 3UW1A 4L2ZA 2YNHB 3K7RA 1ZETA 3UN2A 5G0RB 4U5YD 4EBCA 4ECSA 1BQXA 4HVZA 1T3OA 2BKNA 4WFYA 4WZMA 1SC1B 1RZMA 1IQTA 2YWFA 2R2TA 2G4BA 2NSBA 4DMZA 2B7CB 1HNZJ 4C9DA 2B6AB 3GPAA 5D78A 3VTIA 2BOAA 4D3GA 1QE1B 1YZ7A 1L3VA 1S6QA 4WCEQ 1AFIA 2BA9A 2HHUA 3MAAB 2HHXA 1XR5A 1H0HB 4BWMA 4A8KA 2F9JA 1CJVB 2ZOGA 3GR1A 3H2UB 2B56A 1XR7A 3NNHA 1HNWJ 2ZJQQ 3NYRA 4H4KC 2RUSA 2P8IA 5KFTA 4DR1F 1H98A 1ZTTA 3PJ9A 1Q8IA 4LF9J 2FHMA 2FGOA 3HHLD 3HFVA 4PUOB 4DR7F 2D3UA 4JI0F 4OZ5A 3OD2A 3N6LA 4E2FB 2HBZB 2CJYB 2HLUA 3MEGA 1MXCA 4B3TJ 3MM7A 3QGIA 4F4YA 4PZPA 3NGTA 4AL7A 4NXNF 3LAKA 1HMVB 3W60A 1N4LA 2BJEA 2MKKA 3CJTA 4JI5F 1UFKA 4AYBD 2JMPA 4WTOB 3MWBA 2HIQA 5IZHA 4DL7A 4DL3A 3CDEA 2G9OA 1H74A 4KH1B 2QIFA 4OJ3A 1PSDA 4C0HA 1U8WA 2AEJA 5KFJA 1Y9OA 2ATWA 1HWLA 2KH9A 1WF2A 4X4OA 4ZVHA 4M5DA 2Y1JA 2DD8S 1IQZA 4F4AA 2P5VA 2VA2A 3EVWA 1MWYA 2FZKB 2AHOB 3MM6A 1VC5A 5LXRA 3CUNA 4P73A 2RQ4A 3FBCA 2VFSA 4I68A 2R2RA 3POTA 3CCLS 1JKHB 2FJEB 5IT9Y 2GJFA 4NCAA 4HEA9 4B3SJ 3DHVA 3M9OB 1S6QB 2A10A 4KHPF 2D3OR 2J9CA 2HQIA 3EZ5A 2VBYA 1V26A 4EI2A 3DM2B 2RE1A 4FPRA 1FFGB 4LF6C 3VGSA 4P7VA 4LF4F 9RUBA 3RG6A 3HFKA 2CQPA 1WUUA 3ONQA 2HGNA 4NCGB 2R7WA 1FHTA 3DHXA 3HKWA 2ZOFA 2I38A 4ZVOB 2GGPA 1KLMA 4IFVA 3UFCX 3DDNA 2VASA 3KYLA 4O44A 2JC1A 4FF3A 2PEBA 4KC5A 1X31C 2CFXA 3BSCA 3MEGB 3MM7B 1HW9A 2KDOA 3TRGA 2AW0A 2N3LA 2O66A 2ZD1A 1YGYA 3I82A 3FRZA 3S7RA 3TAPA 4LSNA 3CJ5A 5KFLA 2OIHA 1U6FA 1NUEA 5AE3A 1VISA 4USUA 1O5JA 1FRXA 4DSEA 2XY6A 1YI2S 4K0BA 4JI8F 4KPYA 3UX2A 2D27A 1WC3A 3TQ1A 4DV6F 4O4GA 2OEJA 4RL1A 2HEKA 1O51A 2DNLA 3EPIA 1N33C 1UJ4A 5CZVA 3DLKA 4GVLA 3CSKA 1UEUA 3R9LA 3ULHA 4OZJA 3NI2A 5BXIA 1FRMA 1OJ4A 3QSIA 1FT8A 4ID8A 2AYGA 1YJ7A 5D77A 4I7FA 3QSYB 4ZHRA 3POTB 4C7QA 2DXEA 2Y3YA 1KHVA 1U6BA 4DZ6A 5KFWA 2L3MA 3CD6S 5H1SV 1XR6A 2HVDA 5FDLB 4KYZA 2KXFA 3DLGA 3UWTA 1IBLF 2ZM6F 4B9MA 2MQQA 1TMJA 1S4EA 1M1HA 3PNIA 3R5CA 3QGGA 4K5RA 3TZYA 4LF6F 1EGAA 3HVWA 3R7SB 1U0HB 2R8IA 3VGVA 1O8BA 1M6XA 2GGPB 1KLMB 1RWNB 4IFVB 5DDPC 5C2CA 1NXIA 2AKWB 1VGYA 3DXBA 3E3XA 4DDFA 4N56A 4O44B 3OFEA 1VQNS 5B0AA 4DL5A 4RNHA 5HAOA 5KG4A 1T9UA 4FN5A 1R8BA 2ZD1B 4A8FA 4LSNB 1N32C 4CLTA 1FJGC 1RTDA 4LE5A 2QMXA 1T3NA 3D9BA 5BUQA 5EWGA 2KZZA 1RACB 4V19J 2Q3PA 4I9GA 3QRRA 2F3JA 3BQ2A 1RWPB 2CRLA 4ZIVA 1ZH5A 2IA6A 3V5RA 2VQEC 1BC6A 4O4GB 3WC2A 5KOWA 1DTTB 3WBZA 2E9ZA 4FYVB 4B9SA 3T1HJ 5F8NA 4N8OA 3KLFB 4K4UA 5A0YB 1I51B 2C2DA 4ZITA 3BSNA 2I2YA 4RNOA 1Z1ZA 1YSJA 4CLUA 2HFSA 1IKVB 2IBOA 1F9EB 3JS9A 2F65A 4P74A 4N41A 4I7FB 2QL5B 3M4XA 3I0SA 4ZHRB 3Q8YA 5DG9A 4NLRA 4ELUA 2XMVA 3A1YG 4TU9A 4FYYB 2IVFB 2MJUA 2DGXA 1FCAA 3WDOA 4JYAC 4CP5A 1R8PA 1MN9A 3QO9A 4ZVUB 1RT3A 8AT1B 2XZDB 5LSRA 2OEMA 3KNAA 3DLGB 3TAMB 3R5BA 4HH1A 4WIIA 3CEDA 3RB0A 2CQCA 4YHHF 2HS0A 2IC3B 4I67A 3OTOJ 2XMKA 2P2JA 3CW8X 2WHOA 3DRXA 3CNQP 1NZAA 3D3BJ 4GKJJ 3PY8A 1WG5A 3RGIA 1S57A 3CCJS 1WEZA 1RBOB 4HYKA 3VQSA 1YK9A 1VK8A 2AYEA 4URGA 2DYJA 2JLGA 2HHSA 4MIBA 1FDAA 2V94A 2MQOA 1H2VZ 1TZ0A 1R31A 3QBCA 5KFCA 3HSGA 2GNKA 1UW9A 2RD5C 2R7OA 3EXCX 1FNOA 2RSQA 2DHGA 2OH2A 4TYBA 3ZZTA 2EGTA 5EWEA 5KYTA 3BDPA 5M2UA 3VVTA 1FERA 5LM7E 1YJNS 1WC5A 3HZGA 2HHVA 3WX8A 2GIFA 2V9WA 1VBZA 3KWMA 2B0GA 3BYPA 1YTYA 3K5MA 3CDAA 4Z7CA 1UWBA 1QSYA 1APSA 4OYIA 2RHQB 1KC8T 3ZZOA 2CUYA 2HRUA 2FC8A 4U7CA 1DFDA 5I3QA 3K0JA 3ZXWA 1BD6A 2ACMA 1VEHA 4PQUA 1CLFA 3HFZB 2IMOA 1HI0P 1S0VA 2MHEA 5L39A 1X9MA 4Z2XA 5AXLA 1TTHB 1OSCA 4JI7F 1JWWA 4OZNA 3IPLA 3QO9B 4CM0A 1KVJA 1NBEB 5I3UB 4G1PA 4DR5F 1JLGA 6FDRA 1SB6A 4LFAC 1OYEA 3SI8A 3MMJA 2D7VA 2MZTA 2DR6A 2RU9A 2RS2A 1F9FA 3DOKA 1VBXA 3QLHB 4I6WA 3LGXA 1AA1B 2KT5A 1BWEA 2H51B 4DV3C 1JNZB 2XHCA 1I94J 1R8HA 2Z51A 1D8YA 2IIHA 2MQPA 1N34F 5DLFA 2Q43A 9ATCB 2CQ3A 1XNQC 2J8AA 5BYQA 4QWBA 3CC7S 3HVTB 4DCUA 4IOBA 5E41A 4DV7F 4KE5A 3N6MA 1NO8A 1S12A 2FVQA 3RJMB 1OPZA 2H48B 2GQQA 2PN6A 2VG6A 4DV0J 4UQTA 2C2ZB 2ALZA 3AQPA 2C42A 5IT4A 3W62A 2V4RA 2UVVA 4DCSA 5E3RA 2RVJA 2YTCA 4F04B 4WTYA 4TQSA 2G0JA 3WHIA 2AEFA 3FSYA 2Q66A 2W4PA 1FE0A 2EPIA 1SVDA 3HHLB 2OPPB 1P27B 3K8WA 2DNPA 4HT7A 1TL4A 3OFGA 2E5LC 2LECA 4KBIA 4R5PB 4U8YA 2YWKA 2MLYA 1XC9A 2E7VA 3JTNA 2KG1A 1UWBB 1FXRA 1UA0A 2R2SA 2ASLA 3CDWA 3AOCA 4IR1A 3UX3A 2DCUB 4ZVSB 2KDNA 5LMNF 4KFBA 4PQUB 1NKEA 2FLPA 2KJVA 2EXUA 1RQ0A 1ZM2A 4EU0A 1D3WA 1SUQB 5HI7A 3PR4A 4ZCIA 1VC0A 1JLGB 2Y27A 4DSJA 3AT1B 3NWGA 4CRJA 3AH6A 4Y2CA 1EB0A 2X1FA 2E7XA 4H4OA 3DOKB 3PVXA 3PJXA 2AZ1A 4LFAF 4OZ3A 4JV1A 3BV8A 3CJ8A 3OVBA 1DURA 2AJ1A 2BANA 2B4UA 2XI2A 1XNRJ 4YB7A 1EP4B 4MTNA 5B0GA 4LF8F 1QSSA 3DC2A 2LXIA 3IG1A 2M88A 4AL6A 3BGOP 4XAKA 4PXCA 1E6YA 3GU0A 2YWWA 4ZVRB 2VBXA 4DV5J 1FEHA 2MKIA 2W9AA 2QA1A 2YKAA 2YQ3A 2KKHA 3OFFA 1CC7A 4J9VA 5E3CA 2ZBIA 2W8LA 1U1LA 2JL9A 2C1EB 5L1KA 2AU0A 4PWDB 3BH7B 5AJ3J 4NMXA 4GKKJ 3V6JA 4OJ1A 3W5YA 1ZOTA 5KFVA 1A9NB 1NK5A 4O3RA 2EFVA 1VR6A 2CXEA 1AUDA 4X4PA 4L7IA 2F40A 4BBYA 3C15B 3GFYA 2IAJB 1CJTA 3NYQA 5GAEI 2VFRA 2XGQA 4CT8A 1GX5A 5J2PB 3M6WA 3N6NA 1U2CA 3MI7X 3CCVS 1JLCA 3GONA 1U1OA 5HQ8A 1LWFA 1UP1A 2Y8WA 1GNKA 3N4WA 3JQMA 4RNNA 2PFFB 3HD1A 4DPOA 5KT4A 4Q44A 2HAFA 1Z2LA 2H65B 5E2QA 3LPEA 3TAQA 3UI3A 1HR0J 1HHTP 3FJ2A 2UXBF 1Q7LB 5LSOA 2B4PA 2XS5A 2CG4A 4ED2A 3T9NA 2VONA 1FTCA 3RYLA 1UW4A 5IC4B 2V2VA 2BH1X 4DG8A 1DRZA 3IG1B 1NK8A 2O3DA 3TNVA 1VQSA 1O90A 2L08A 2IA0A 3LOUA 1GH8A 4DV1F 4JV5F 4O0NA 2N4DA 4ECQA 5HVGA 2UUWA 4P2XA 4CTAB 3MXHP 4IH7A 4DR2C 3H90A 2DIUA 3VAHA 5EHHA 1A7GE 2KYXA 5EGYA 2Q6CA 2C2OB 1J5OB 1IJFB 3G82A 4OI3A 5F8JA 3M32B 2ZHAA 1FWPA 1S9GA 2I9SA 2UV8G 4L6V3 1NSQA 2HNZA 2QA4S 2H4WB 3GWCA 4UT4A 4UOCA 3BB5A 1MROB 3RAMA 1R43A 1VBYA 4IZ6A 3TEGA 3I96A 2XNQA 1TUWA 2B9EA 3FDSA 4DG1A 1PYSB 1CJTB 2N7YA 3KK1A 1Y11A 4RUAA 3HXMA 1REVA 2DO4A 3MPYA 2H3EB 2W4CA 2F8HA 4DU8A 1NDPA 2FJWA 1B4SA 3V2UC 4IO1A 2DISA 1JLCB 3BBFA 3D54A 3MOZA 4ILMA 2OI2A 1RAFB 1VQ4S 4YOEA 1LW2A 4EO8A 4I2QA 4G37A 3ILJA 3OJSA 1PGZA 2AQ4A 3LNVA 4FYXB 1SPBP 1K47A 3CQ1A 3B4DA 4AQYJ 4C8ZA 4PG4A 2XY5A 3PYEA 1B70B 2CQHA 1MMDA 4TY9A 1KKGA 1M5KC 1WEXA 4DR3C 1CPZA 4NLTA 1HI8A 2X1AA 4F2SA 5F41A 3CCRS 2QJ3A 7AT1B 4ECZA 1ZAXA 4Q7AA 3AB4B 3CCTA 3J7YI 3FKBA 4NXMJ 2J9DE 3G6ES 3JB9k 2OO4A 1S6OA 2FZGB 2DH7A 3FRYA 5LMUC 2DHHA 4PYAA 3R9XA 5HL7Q 2WAQD 2ZE2B 2VQFC 3H4DA 4NLYA 3W65A 3ZZUA 4MTPA 2GVDA 2JFDA 2PD1A 2DNZA 3G86A 3LUSA 8RUCA 3G82B 1U1PA 2H1YA 1IWGA 5DM6Q 2HURA 4ECWA 4X66C 4CH0S 1WHYA 2YKNA 1FD2A 2J76E 2A1BA 3EYZA 4Y3CA 3BM7A 4IR9A 3EGWB 1BMQB 5HVHA 2HNZB 2XZTB 4CM2A 3DRYA 1IKWA 3GIKA 3DN9A 1H73A 1DARA 4FYDA 2QN6B 2JJ4D 2WBRA 2RJZA 5D4LA 4USWA 1VQMS 4IUFA 3P4UB 5DG7A 4DG1B 1XEZA 2XS2A 3KLVA 3PBKA 2QFIA 4ZJZA 2XCAA 4N77A 2U2FA 1HHQA 4M5IA 4IKAA 3SV3A 4WJBA 1TL1A 2DVIA 3T5HA 2IPOB 3TANA 4J7CA 2JEGA 1D0EA 3MCSA 2W9BA 1NH8A 3WIUA 2E5HA 3A8EA 2ATCB 4FNHA 5F8HA 3VR1A 1V9OA 4KPCA 3GPCA 4ZLJA 4KIAA 2LU1A 1EQMA 2LEBA 1C1BA 4KB7A 3CGIA 3D4JA 2MZ1A 5J1EA 3CJ0A 2RRBA 2H54B 1V3RA 3IGVA 4DL2A 1GXLA 3R5DA 4R0MA 4X2BA 4GMKA 2CJKA 4ES2A 2KHDA 4OJGA 3RBZA 2Z2LA 1T0TV 4J9MA 5KFBA 2IDEA 4OXIA 5DLGA 3JSMA 3B82A 2PFDA 1SJRA 1WTBA 1ZA1B 3MFIA 3MPWA 1RHJB 4OHVA 5JMNA 4ZPTR 1HWKA 1NK0A 4YR2A 1TU0B 1VK3A 2QRRA 2W1BA 1Y5IB 4JB8B 2GVDB 2MKCA 2F4FA 3PRVA 2XB2D 2JWNA 2ZH3A 2Z56B 1NAQA 4J9QA 4E0DA 4F0MA 2K1RA 2HVZA 5C25B 5T7LA 4DV4C 2J5AA 4W90B 1HWIA 4JI1F 2M7SA 2RB7A 3N54B 3HHDA 3OL6A 4A47A 2I5JA 2VBZA 2UXDC 4OI6A 4C3MA 2YWCA 4YY3J 2IM3A 4YR0A 4JYAJ 3PFOA 5DDRC 2A6MA 1PG4A 5FIIA 3ZTSA 3R3TA 1Q7YT 3D68A 1F2HA 3O3LA 2MY7A 1TL1B 2CPDA 4LF5J 1C0UA 2DKOB 2YBVA 4X4NA 2ROPA 2BE9B 1UWDA 5GAGI 2W9BB 2NUHA 1VIXA 4OYMA 2BJ9A 3PW0A 1EKSA 1VJWA 3VGUA 3ZO7A 3FFIA 3HM9A 2XHWA 1LFPA 2JEIA 2APOA 2Q1LA 5J1EB 1HQEA 4LUBA 3H98A 3JQJA 2MZQA 4ELVA 1YJRA 2KTQA 3IMLA 2H5IB 2GV1A 3Q0AA 4PYDA 3T5JA 1RTJB 4V19X 2NPFA 3PJWA 4O3NA 1T9WA 4HDGA 2MGZA 2PROA 3BQ1A 3JSMB 2V9KA 3MM9B 1I3OB 2DR5A 5E33A 4O23A 4DSFA 4OI1A 2EVZA 3G6XA 3X1LB 2UU9C 4ZCLA 1RSCA 5KG0A 4DQRA 1TP7A 3IFEA 2HHHC 2UXCF 2CNLB 3HVAA 5A1GA 4IDKA 5D0GA 4Y28C 4J90A 3V4IB 3CIMA 2K7KA 2MKJA 2I5JB 4X84A 1PILA 4DXLA 4DUZC 3HSDA 1ZAWA 2OUGA 3NMAA 3OXLA 4C8OA 3K5NA 2ZH6A 3BBCA 2CJAA 3DLBA 2QT7A 1OO0B 1UWAA 3LGNA 3AJDA 1X5SA 1PJ7A 1BWVA 5E7QA 3TUPA 2NYHA 3FC9A 2ZJPQ 1C0UB 1HHSA 2PMWA 1JX4A 3VZIA 2EFOA 1HI1A 2QLJB 4F2RA 1QVGR 2F4VJ 3M2RB 4N47A 3O6QA 2GVZB 4C8YA 1V5VA 2GAGC 1J5EF 1SXLA 1A6LA 2BKOA 4WWSA 3EPGA 2C2MB 2XZWA 5AT1B 2ADBA 2J0XA 1NY8A 4RW8A 1SQGA 4LF1A 4IYQA 2C22A 1YHQS 5KT6A 2IRYA 4MH8A 1X9WA 5CD4A 1S49A 2OPQA 3LW5C 4J9LA 2UUAC 3LGHA 3ETOA 2C2KB 5C42A 4O4RA 3M2VB 4RW7B 1KR4A 3NGKA 3UD5A 3K59A 2AGPA 2K2PA 2GAHC 4KRWA 2BW2A 3H7HB 1S6PA 2OPLA 3QT8A 3KXDA 3W63A 4C48A 5B0CA 2FQQB 4ODJA 2HGLA 3S8SA 3IM8A 2DGSA 1X5PA 3ELHA 1PAUB 2E5LJ 4EFAC 1X4AA 1QAJA 3DRSB 4CO2A 2YNFA 2HHWA 5A19A 2AF6A 2VPXB 4LFCF 5K8FA 4HL9A 3GG0A 4KTVA 1RYSA 4LF2A 2HS3A 2JVRA 2UUBC 1DBDA 1Y00A 3J7A1 4A4JA 3KHGA 2DCLA 1S7HA 2FLNA 3N28A 3F44A 4OI4A 4P6QA 2OKQA 2ZH2A 2E7GA 1KVKA 2YKOA 3N2QA 1HA1A 3NS6A 2XLJA 5KG1A 3CMQA 2FJAB 3VZHA 1BQNA 2Y1IA 3AA9A 1K1QA 3CWJA 4WK1A 5T8TA 3ZNJ1 1AXQA 1KDNA 5ETRA 2HBRB 1XWLA 2YKPA 5KFOA 4FYWB 1XQIA 1IBMF 3PIOQ 3VAJA 3PESA 1RT5A 3GV7B 1T11A 1TMMA 2WTFA 2ZHOA 3OR2A 5IM0A 2XMAA 2A3JA 3VAMA 3MHYA 2I6WA 4RW8B 2FDNA 3ETMA 3ZNUA 3A9UA 5HN0A 1A0OB 3QJJA 3K5PA 2QLBB 2OPQB 4JI3C 2FUG9 2ZBPA 1Q81T 1KOOA 2IFXA 1U49A 1UJ5A 2N7CA 5HATA 2JEFA 3MTJA 4ATNA 3I55S 5KG3A 3BO3A 3IP0A 1VJQA 1VI7A 1EQ0A 2RKIA 3LP2B 3W64A 2OPLB 4B08A 1WKLA 5HP1A 4DU7A 2C2NA 5GMKa 4X64F 3H5SA 1NSAA 3Q8VA 5E0OA 3U1LA 3EGZA 4DPTA 1XRCA 4HI1A 2JEJA 3GIJA 2MB0B 3HO1A 4PCQA 3OPKA 2BDPA 2V2ZA 3RZAA 4P2MA 4YB5A 2DGUA 1HQUA 1QAIA 2POKA 2SXLA 2C3UA 1RWKB 1U6ZA 1N56A 5ETLA 4F25A 3FMWA 3ILOA 4P9SA 2LQBA 3W3SA 4NLVA 2E9TA 5IV3A 3LQVA 1TV6A 2QA2A 2MQMA 2D1RA 3RB4A 4B3RC 2DXFA 1T9YA 3KJNB 6AT1B 5GTDA 4ECUA 2MY8A 2P2CB 2KT2A 1ZM3A 3PFEA 4OHZA 1O9TA 1ITPA 4R8UA 1RDRA 2NREA 3A8KA 1N54B 2MQLA 1QTNB 3WQPA 1OY8A 2QSFA 1LQLA 3PEHA 5J2QB 3B8HA 1UVLA 1HNZC 4ZJLA 4DR1J 2V50A 3AXKA 2GJIA 3H4BA 4QQBA 2BYCA 1WHXA 2KXNB 1IBCB 4G36A 4DR7J 4K4WA 4J9NA 1XMBA 3C6TA 4I1TA 3TDEA 1Y10A 2V8VA 2WW8A 3V81B 4MIAA 4NXNJ 4DUTA 4LIWA 1Y4ZB 5K14A 2JHEA 4X4UA 1FF2A 5LL6d 1B7YB 3HHLC 1HNWC 1ZZFA 3TZZA 3SFUA 4CLYA 1W2IA 2RKIB 4EZ9A 3M9NB 2MMAB 3ENAA 4DR2J 3T3FA 3S6EA 1P1TA 2OSRA 3FZBA 2UVWA 4LBPA 4LF9C 1Q8KA 3KUGA 4IRDA 4B3TC 3I08A 1HQUB 3GIRA 4ILRA 1JLQB 4DX6A 4OV1A 1FNXH 5T8SA 4DR6F 1HW8A 2KZFA 1IR1A 2XG8A 4ANDA 2VUGA 1NHVA 1RU1A 3AJ1A 1B64A 1UEVA 4FF1A 3IWLA 3NKYA 3GJSB 2XWXA 1HNXF 1OY6A 5KG6A 3AFGA 1NJWA 1LQ9A 1P9YA 4X62C 2M9KA 2D1TA 1XBWA 1V60A 3M8PA 1U02A 4R8UB 2AP6A 3A4IA 2BE2B 4WFZA 4LF4J 3Q8SB 3UZ0A 3ETCA 3HT3A 5HSPA 5B08A 4QIFA 4F3QA 3CDUA 3SQOP 3JAMY 3J80Y 1W2BR 5JRHA 4J9PA 1S1UB 1XMQF 2MKHA 2DNOA 1H2TZ 1P6TA 4B3SC 3MCOA 4Y00A 1QM9A 5GAEU 1S1VB 4TU7A 3C6TB 1HYSA 1UVJA 3CB4A 3J81Y 4Y2MA 1QUPA 2BBEA 3GLJA 1EIYB 4L76A 4A8YA 2Z4PA 3CJ3A 5D4NA 4NZ0A 4GXQA 2VQFJ 4LBHA 3KK2A 1F9HA 4XDCA 2J9EA 1YJUA 3A3PB 4JI8J 3DOMA 4ED3A 3R1LA 3X3UA 4W98A 3B78A 2KM8B 4DV6J 3EUNA 5LJ5Y 4KGZB 1KQGB 2CWKA 4I9FA 1ZAVA 2JFKA 2RIJA 2OPRA 2EKYA 1S4FA 3ILIA 3GTYX 3JTPA 5KFNA 4KR0B 3KHRA 2D1QA 3DLEA 2AYMA 4B3TF 2HSEB 1K44A 2MZSA 3DMJA 1U24A 3U27A 1MU2A 1TKZA 3ILLA 3W2VA 2VG7B 1D09B 2MLXA 3A3OB 3CJKA 1UETA 3MPDA 3K17A 1UVKA 4LFBJ 1EETA 3DGPA 2OD4A 2CPEA 2H5EA 2RF2A 1YBUA 2G2OA 4KV8A 2W2OP 2V4QA 1U7LA 3EX7B 3ZTPA 2ZEJA 3M8PB 2QFJA 4M5GA 2KVQE 1RAAB 1IBLJ 1UZHA 2N82B 1S72S 2V68A 3VHQA 1XIQA 1U09A 2ZM6J 1LKZA 3OTCA 1DLOA 4C11B 2F5GA 1UA1A 3R1HA 1JLFA 3IRWP 2HNYA 4K4VA 4CO5A 1F3FA 3IO1A 1S7IA 2GQCA 2HIYA 3S01A 2VB6A 5KFAA 3J80U 3JAMU 5F3TA 4WKRA 4DLEA 1SC3B 4K50A 2X3DA 2HNDA 1OWXA 2ZNZA 4PPZA 3IR6B 1HYSB 1GTHA 2E44A 4FUQA 3G71S 3J81U 5LJ3Y 2DHAA 3KLGA 3SMZA 3NOCA 1DQAA 1NM2A 3SQGA 1JLEB 4DF8A 4A8MP 3NNAA 2D7SA 5J2NB 4OX8A 1GXUA 2EFPA 1G7CB 1U25A 4QYRA 4X4VA 2CPZA 3DAYA 1B0TA 4LF7J 1TL7A 2BKPA 2OPRB 4GRSA 4L74A 3TJAA 2IRUA 1XMOJ 2XC9A 4CO0A 2GJ2A 1FEEA 4DV2F 4HACB 3J7YU 4B9LA 1JJ2R 4TLQA 5BSTA 4QBUA 4ZMMA 1MU2B 2Z2MA 3NNCA 3D1HA 1TKZB 2LYVA 5L8RC 2K8GA 4XO0A 2E1AA 5IFMA 1EETB 3DGPB 1KD1T 3O8WA 2RF2B 4KV8B 2BRKA 3P6YC 1NDLA 1FKOB 1OIAA 3ZZZA 1FNMA 3T1HC 3MMCA 2RDDA 1WNEA 2F8MA 2P2BA 4NLOA 1DLOB 1N36F 5CCMA 4C3LA 3HJVA 4YDDB 3DGVA 2RQKA 1JLFB 4Z7YA 4YHHJ 4QIWD 2HNYB 1S0NA 3NG8A 3PHTA 1Q0NA 2BJ3A 2JRSA 1ZM9A 3NAHA 2NR0A 1U0SA 4CLLA 4HPVA 2HFZA 1QAXA 4K4XA 3D3CJ 4DUYF 1XERA 1X0PA 2LEPA 5CYMA 4WXWA 4F4KA 1Y7PA 2KHCA 4WE1A 2QMUB 3BDEA 3OUYB 4HH0A 5DQHA 5BSUA 2VA3A 1YWXA 5HQMA 2IDLA 3KLGB 4EUVA 1Q5YA 4RM3A 1PYTA 3CW9A 1RA7A 3IAM9 3NCPA 3M1VB 2XBPA 1RWXB 3WX4A 3AD7C 4RW4A 4F26A 1C0TB 2YNGA 2RUGA 4GKJC 3AB2B 1B99A 3FCCA 3EQ6A 4Z37A 4QYZJ 2MKSA 4PUHA 2D9PA 3M2UB 3P45B 3TI0A 1FO1A 4KO0B 1MMNA 1RADB 1Q79A 3ET6A 4DR4C 2WP0C 3PX0A 2HVHA 1YLXA 1ZPWX 2JSXA 3BGUA 3RBXA 3HULA 3GYNA 4NEZA 1R6VA 2WVEA 5A8WA 3FEZA 2X1GA 5A8RB 3PZPA 4JBCA 3GIMA 1F5CA 4UUWA 1FJEB 3NY0A 2C3MA 1RAIB 4ECXA 1WI8A
chains in the Genus database with same CATH topology
1JLGB 4Q43A 2VQFF 2Y27A 1IKYA 3TVKA 1RKIA 4DSJA 2CDQA 2VC1A 3KJVA 3NWGA 1GPMA 3C6UB 2GO8A 3RAXA 2AGQA 1CC8A 4I4BA 3AH6A 4Y2CA 2YKNB 4RU2A 4BS2A 4NA3A 3UQSA 1ELOA 1YJ9S 2E7XA 4H4OA 3L95X 2X1FA 3DOKB 3KFWX 3PVXA 3PJXA 4PKDB 4LF7C 2J7KA 4LFAF 4QZVB 2VPYB 3OVSA 4JV1A 2R2UA 4X66F 4GS5A 5L38A 2HHQA 3BO4A 1IKWB 1UKUA 1X4CA 3KG0A 2EW9A 1XMOC 3RRHA 2Y4NA 1Y5NB 3MOJB 3AF5A 3OVBA 1DTQA 3OQ2A 1DURA 1DTTA 3NCQA 4WFXA 4FUTA 3NBPA 3IS9A 3RBEA 2AJ1A 2BANA 2PSZA 2VH7A 2WSEC 3E51A 5B0EA 3CCWA 2IJNA 4I6YA 4XDDA 2B4UA 4NRTA 5IWAF 2XI2A 4RNFA 4YB7A 5IT0A 1EP4B 4MKAA 3KLFA 1JJ4A 4WF9Q 1KTVA 4MTNA 5B0GA 4LF8F 3MECA 3GYXB 5A0YA 1QSSA 4OJHA 1FVQA 1Q16B 3D0HE 1IKVA 5CYMB 3DC2A 2LXIA 3SCLE 2D41A 4IRCA 2OMOA 1T94A 3IG1A 1SIZA 4ZK7M 2M88A 2OPSB 3MD1A 4ZA1A 5KFEA 4WE1B 1KN6A 3O1LA 5G4DA 3FVYA 5DRKA 4AL6A 1P9QC 3HPOA 5DQGA 4MH4A 3IC1A 4O3QA 1URRA 2K3KA 3FMBA 4XAKA 4PXCA 1E6YA 1CG2A 2XMMA 3H2TA 3BQ0A 4FZVA 4K4ZA 5A2QD 4ZP6A 2RQCA 2QZ8A 2VBXA 1C2PA 1FEHA 4LFBF 2MKIA 5KFKA 2VG7A 3HHNB 1RT6B 2W9AA 1OPIA 2QA1A 4I69A 5GAGU 2B3TB 2YKAA 2KKHA 2YQ3A 3OFFA 4U9RA 1T03A 1IBKF 3CMAS 1RISA 1CC7A 1X4EA 1SQEA 5E3CA 4LVNP 2ZBIA 2W8LA 2W25A 1U1LA 2JL9A 4PG6A 5L1KA 3PIPQ 3MR2A 1SC6A 3MR6A 3N79A 2AU0A 1VQ9S 4TKTA 4YHHC 4ISBA 2FHKA 1I94C 1I6JA 1VLYA 2HFNA 3TAMA 4RVNA 4XIUA 3MD3A 5A8KB 4KJIA 2YNGB 4RWWA 5L1IA 4PWDB 1HFEL 3U02A 4J5OA 1C1BB 1U2FA 3MMBB 3OTOF 2KU7A 2VKZG 1TKTB 5AXKA 4C8KA 3R5AA 4OYCA 3CJEA 2NLWA 2ZH7A 2IC3A 3V6JA 6FD1A 3BGRA 2XSJA 4OJ1A 3BR8A 4C11A 4WFBQ 3C5EA 1ZOTA 3I4PA 4IO9Q 2LLZA 2VZEA 2XI3A 4K4SA 2VFVA 5KFVA 1A9NB 2OFHX 3TP2A 1FD8A 1NK5A 3ISND 3OXFA 4DN0A 4O3RA 2EFVA 5KFPA 4IRKA 1RK8A 4KQZA 3DOLA 3JSBA 4LIRA 3V4MA 2E8CA 3RRGA 1AUDA 1K0TA 1BA3A 5F9LA 4X4PA 4L7IA 2F40A 1JLBB 2E1CA 2ILYA 1X8DA 5EUHA 3FCEA 4BBYA 1MSWD 3GFYA 2BJDA 2IAJB 1BLUA 3FZ2A 3CULA 4H4KA 2V2KA 3NYQA 3GG1A 3SXLA 4DV0C 3BREA 5KT3A 3GFZA 5GAEI 4C97A 3GR0A 2VFRA 1MDBA 2XGQA 3GILA 4CT8A 4FXVA 2N4CA 1GX5A 3BO2A 2GIQA 5J2PB 2BXJA 1R0AA 3M6WA 3UDLA 3N6NA 1N6QB 4KAIA 3MI7X 1SI9A 3KG1A 3P49B 3CCVS 4NOZA 4UY85 1JLCA 2E66A 2BQ3A 1U1OA 3DFEA 5HQ8A 2UUCC 1E6VA 1NK9A 4PR6A 4HHJA 1LWFA 1UP1A 3U7JA 4JI4F 3CCMS 2QLWA 4X4QA 5F8IA 1GNKA 1FK9A 3K5OA 3N4WA 5M2RA 1VRTA 1QJHA 2HJGA 3V6HA 5DO2A 3H5YA 1D9AA 4AQYF 2K1RB 3KJVB 1DQ8A 3QWPA 4RNNA 2PFFB 5T7LB 4DPOA 5KT4A 4Q44A 1FDNA 3PKMA 5KEIA 1Z2LA 4NCBA 3D0GE 3JTOA 4ECVA 4B3OB 2R8GA 2DGWA 2GHWA 5E2QA 1VQLS 3GKUA 1JLEA 4ZVFA 1X4FA 2ZFHA 3PDNA 1FJCA 1SH2A 3EXYA 3TAQA 3KXWA 2C3PA 3UI3A 4DV4F 3TUFA 1M5OC 3UCUP 2CJ9A 1HHTP 3FJ2A 2W7OA 4Q0BA 2UXBF 5J2NA 1Q7LB 5LSOA 5DGBA 4KHMA 1DTQB 3H59A 5SZTA 4LF7F 2B4PA 2XS5A 2ROGA 2CG4A 4ED2A 4ZCKA 3NBPB 3IS9B 3OTBA 3T9NA 2VONA 4UY8T 1FTCA 4RLQA 4Y6IA 7FD1A 4G1QA 5CA5A 2UXDF 3RYLA 1XMOF 2DK2A 2QL8A 2YY3A 3CD7A 2MZRA 4TXSA 3MECB 1UW4A 4NXMF 2J0WA 2RH3A 7FDRA 2I8EA 4PPDA 2XMTA 1KSPA 2BH1X 4DG8A 1H6KX 4G1IA 4DV2C 1RT1A 2ACYA 2EK1A 3IGNA 1DRZA 1K1SA 2K3IA 2OTLS 3IG1B 1OSDA 2LQ9A 2FVCA 4XPCA 1NK8A 3CJ4A 2O3DA 4NMLA 3TNVA 4LSLA 1VQSA 3CE8A 1VOMA 1O90A 3MR5A 4JI2C 4JI7C 1N5TA 2L08A 2G0CA 3DHWC 4A48A 1UFWA 4QWDA 2E9RX 5CZXA 2IA0A 3T6BA 1CEZA 1TAQA 3VNSA 3CCQS 2D74B 3LOUA 1GH8A 4DV1F 1IN0A 2AJ4A 2IYIA 3DDKA 2VG5B 3QJPA 4WU3A 4ZP7A 3U1MA 2N4DA 4ECQA 4JV5F 2UUWA 1HD1A 5KFYA 4K5SA 4DR5C 1T03B 4TNOA 4CTAB 3CVKA 4H4MA 2DPIA 3MXHP 4IH7A 3VAKA 4K0KF 3RV2A 2B43A 1FKPA 4OZ1A 4YB6A 4WZQA 2FHJD 2EBGA 2M5YA 4NDNA 4DR2C 3FFIB 4A8SA 5BSWA 2DIUA 3VAHA 5EHHA 1A7GE 3OJUA 2KYXA 5EGYA 4EZ6A 5I3UA 2Q6CA 1N5QA 3ENQA 3T1YF 3PACA 2DO0A 1X4BA 1J5OB 3LAXA 1IJFB 4OI3A 5F8JA 2D1CA 2ABYA 2E5GA 4WS9A 1FKOA 1N36C 2A18A 4KTTA 3M32B 2ZHAA 1N5VA 1S76D 2DNRA 1S9GA 1YRXA 2I9SA 2UV8G 1XNRC 1UFLA 2PI5A 1MMLA 4L6V3 2MPUA 2CQ1A 1HQEB 5DG8A 2GHVC 3I9V9 5FD1A 1N34C 2XSJB 2QVYX 3QLHA 4BHQA 2HNZA 3FQLA 4QPXA 2QA4S 2O1PA 1GAOA 4FS2A 1S1XA 2VFUA 3GWCA 1LOUA 1WH9A 1GX6A 1Y3JA 3DOLB 4RZRA 4UOCA 3OFHA 1N48A 1QWIA 3BB5A 1H7WA 2VFTA 3LF0A 1MROB 1JB0C 4DUYC 3D2WA 2CVEA 1S0OA 1GQEA 1PC4A 3RAMA 1R43A 3VF0B 5KFZA 2AX1A 1VBYA 5K5MA 3GV8B 3O2IA 2BABA 3J7Z5 2XSFA 3N5FA 3I96A 1NEEA 2OLWA 3SDEA 2KM8C 4YQWA 2MHNA 4DV7C 2XNQA 4I56A 4BC7A 5H9EJ 1IUJA 2W8KA 1MXBA 3FDSA 4DG1A 2MGZB 2KFZA 4DV5C 2XR1A 2N7YA 3HVTA 3KK1A 4PROC 4F67A 3KMSA 2PO4A 2DH9A 2D3ZA 2IJFA 2LA6A 4NYPA 4TN2A 2GMLA 4RUAA 3HXMA 1QUVA 4QWEA 1REVA 5I42B 1R8AA 2DO4A 1R0AB 4Q8FA 3M6VA 1URNA 3MPYA 4CO3A 2Y1RI 2W4CA 2F8HA 2KVIA 1M1KT 2XY7A 3E01A 2QLXA 3V2UC 2FJWA 2Y0SD 4IO1A 4JI6F 2DISA 1JLCB 2Y4OA 4ZVGA 1P7LA 1DHMA 4ECTA 4ICLB 1E6VB 3D54A 3MOZA 4ILMA 3OUYA 4NLPA 4YP3A 3ISNC 3VALA 3AHPA 2KN4A 2BM1A 1YJWS 1FK9B 1K9MT 3FCHA 1U48A 1VQ4S 4QW9A 2BZ2A 4YOEA 2F8EX 1LW2A 2ZNYA 4EO8A 2DGVA 4I2QA 2UUCF 1AFJA 2YWEA 2UU9F 4G37A 3OJSA 2QA4G 1PGZA 1TFWA 2QSWA 3P3DA 2IMWP 4NLQA 2AQ4A 4OL8A 2KI2A 2GMHA 3LNVA 3DRPA 4GKKC 4IDKB 3B4MA 1VQYA 4X65F 1T5HX 1U47A 4I6AA 4DQQA 3BS9A 5F0WA 4ES3A 5L9NA 1VS3A 4A8XA 2FLOA 2P20A 2HHHF 2FIUA 3M1VA 4ZDNA 1ZTWA 4MK8A 3B4DA 2CIMA 2OP5A 4PG4A 1LW0B 2XY5A 4C8ZA 2UVUA 3ICLA 2BOPA 3PM9A 4J9KA 1O93A 3BN4A 1C0TA 4CO4A 1T05B 5EX0A 4Q0BB 2CQHA 1MMDA 4R1MA 4TY9A 1RT7A 3HHLA 5HBMB 1KKGA 4NZ6A 2OPPA 2R8HA 1M5KC 1WEXA 1TAUA 1D1UA 4DR3C 1CPZA 3GMGA 3S82A 4NLTA 1HI8A 4UW2A 2X1AA 4F2SA 1H7XA 5T41A 3TUZC 4G1QB 5F41A 1NB7A 4DF4A 4R5PA 2BR0A 3M2UA 3OTDA 2W9CA 4DUZF 4X4RA 4TQRA 4NWBA 1HH2P 3CCRS 4KO0A 1LWCB 4ECZA 3T9ZA 3GV5B 3K5LA 3R27A 4MKYA 1RT1B 5KG2A 1ZAXA 3UOWA 4Q7AA 2O5DA 2WOMB 3AB4B 3DCAA 1Q86T 5LMNC 3CCTA 5EDWA 3J7YI 1S48A 5KFFA 2J9DE 1UVNA 1RG9A 1HBUB 4A46A 4CNZA 5K9FA 4M95A 4LSLB 2CQGA 3N01A 4FNIA 3V6KA 1NJZA 2DGTA 2WCXA 3G6ES 2V7BA 2MSTA 5IS2A 2FHOB 4MKBA 2VODA 2RDIA 2OO4A 3TUIC 3JB9k 4F8RA 1S6OA 4B3MF 3TQIA 1TQLA 2DH7A 3FRYA 1WG4A 5LMUC 2DRBA 5KG5A 2L48A 5A8RA 4AUKA 3R9XA 5HL7Q 3GFHA 1F0XA 3MUVP 2WAQD 3SSQA 5ADZA 1HPZA 2VOPA 2ZE2B 4H4MB 2VQFC 3H4DA 1IXKA 4NLYA 4JI2F 4EYHB 1FKPB 3ZZUA 1FXDA 3THPA 4FVCA 4R0JA 4MTPA 4ZCMA 4FTFA 3D1QA 3DNCA 3LH2S 2R9LA 4RWXA 3EERA 1NNDA 2JFDA 1SUQA 2PD1A 2DNZA 1T02A 2HHTA 2P9EA 1HR0C 3G86A 3LUSA 1QLNA 1ZB9A 4ED5A 3M6UA 2CYYA 4URQU 1YIJS 1U1PA 2LEAA 5T14A 4RNMA 5DM6Q 2JC0A 2YWBA 2BM0A 2ZKUA 3I0RA 4ECWA 4MJKA 4X66C 1FUGA 2BQUA 2AGOA 4CH0S 2J0QD 1WHYA