3CQ3A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
NPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein TTHB138
total genus 24
structure length 98
sequence length 98
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq3A00
3UX3A 2JNVA 3CQ1A 2CU6A 2M5OA 2Z51A 1XHJA 1WCJA 1UWDA 3CQ3A 3LNOA 3CQ2A 3UX2A 1TH5A 1VEHA 2M5HA
chains in the Genus database with same CATH superfamily
2QL8A 4K0BA 3B7WA 1O92A 2ZM6C 4JM1A 5BSVA 1V26A 5T8TA 2HHHC 1HH2P 3CQ2A 2UXDC 4X66C 2P2JA 4LFAC 1KKGA 3J80D 2E8CA 4PUIA 1IB8A 1HR0C 4DR1C 2CXCA 4GXRA 2D7VA 4DG8A 4R0MA 1XRAA 3IEUA 4ISBA 4EATA 4G36A 2DYJA 4DCUA 4OXIA 4RM2A 3TQIA 3AF6A 3UEBA 1HNXC 4OYCA 4AQYC 3DHVA 3CJEA 3R44A 4G37A 4U5YD 3EERA 4NOZA 3DLPX 1XRBA 2Y4OA 1XMQC 4GKJC 1MXCA 4X65C 5BUQA 2OO4A 1FLOA 2P2BA 4WV3A 4LF9C 4I9GA 1N33C 5LMUC 1O9TA 3H2TA 2P2QA 1PA4A 1QM4A 2PT7G 4JI7C 4OX9C 4PUGA 2P20A 1WCJA 5JRHA 4B3TC 1V25A 4DR3C 2KZ0A 5BSWA 3FCEA 4L4QA 1P4EC 3N54B 3CW8X 5BURA 1PG4A 4XX2A 2M5HA 4NDNA 4KTVA 2P2MA 1UWDA 2P2FA 1LCIA 1L2FA 1PG3A 4IR7A 2E5LC 1NYEA 5K8FA 4DV6C 2VZEA 3O2EA 3I08A 4RLQA 2CY1A 2XR1A 5BR8C 4LF6C 2UXBC 4LF7C 4NXNC 3RG2A 1VLAA 1V60A 4LF4C 1HNWC 4D4IA 4DV4C 4DV7C 2Y27A 4IZ6A 4BCAA 2NCLA 2E8EA 5AE1A 2UUBC 1T5HX 3LAXA 2E8FA 3GPCA 3PBKA 2CU6A 1ULTA 2HJGA 3VNRA 2QVYX 2P02A 3UOWA 1XRCA 5LCIA 3NYRA 3TR3A 2D1SA 5LMNC 1M6XA 4MH4A 3CQ1A 4FUTA 1QWIA 4MTNA 1WH9A 3LNVA 1IBKC 1ZB9A 1O90A 2WP0C 4YY3C 4DUYC 3RV2A 5BSUA 2MM9A 1N34C 1XMOC 2UU9C 2KDNA 4D57A 2QVXX 1MDBA 4BC9A 4JI6C 3CW9A 1FUGA 1MD9A 1N2FA 2EGTA 3R9XA 2ATWA 2D1RA 2ASBA 4DR6C 3GR0A 3T1YC 3R9WA 2JMPA 2D27A 4FUQA 1XS3A 4PROC 1M6XC 4DCTA 1MXBA 3LGXA 3A25A 4LFBC 3E7WA 4R1MA 4ZLPA 1RY2A 1FJGC 4DR5C 2WD9A 4I9FA 2PROA 3IMLA 4LE5A 2YWCA 3LUSA 4JI4C 2VSQA 4JI5C 4DCSA 2AYAA 2QVZX 3CQ3A 2ZZMA 4BBYA 3GR1A 1P4EA 4KHPC 3SO4A 3DAYA 1RG9A 3TUFA 3VNSA 5K85A 2D1QA 3G7SA 4GXQA 4X64C 4DG9A 3L95X 4DR4C 2YCBA 1USPA 4DUZC 2BH1X 5AE2A 5T8SA 1ML8A 3EQ6A 4RM3A 2Z51A 5KYTA 4DR2C 3AY0A 4JYAC 4DV1C 1N32C 3GKUA 3IPLA 4TPSB 2E7GA 1UKKA 2UXCC 1T5DX 3S82A 5CZXA 5IT9D 5BSMA 4GKKC 4G1IA 5CZVA 5KYVA 1XNRC 4JI2C 4B3RC 1ZB8A 4B3MC 4PZPA 3ETOA 2MMAB 2ZZNA 2VQFC 3ETCA 4D4GA 4JI8C 2KZFA 4JV5C 2DHMA 4DV0C 1LQLA 3LNOA 2OPLA 3OTOC 1GPMA 1XHJA 1MKYA 2D28C 4LF8C 5FLXD 5KEIA 1EGAA 4NXMC 2UUCC 3UX3A 4LF5C 4X62C 3I07A 4DCVA 5IWAC 3C5EA 2DPLA 3A9UA 4RLFA 1VEHA 3JAMD 4WS9A 4JI1C 5E7QA 3TDEA 1YJ7A 4D56A 1JOSA 5A1GA 4K0KC 4B3SC 3UZ0A 3PROC 3NPDA 3KXWA 3VNQA 2F4VC 1AMUA 2M5OA 5DV9A 1IBMC 4R1LA 3NI2A 1TH5A 1WF3A 5A2QD 4RVNA 2OBVA 3T1HC 5IFIA 4L7IA 1N36C 3FCCA 4ODJA 1HNZC 3PESA 2PN2A 5GTDA 3E7XA 4L2ZA 3A26A 2OPLB 2Y4NA 3A4IA 5BSRA 2MCQA 4PUHA 4RVOA 4DV3C 5BSTA 4GS5A 5H9UA 4KTTA 1NY8A 5A19A 5ADZA 3A9VA 1BA3A 3UX2A 3J81D 3NYQA 3AF5A 3IEVA 3L8CA 1J5EC 4BC7A 3K6RA 1MXAA 1XNQC 4RMNA 3N2QA 2BJOA 4HPVA 5A1IA 2VQEC 4DR7C 1K0RA 4JI0C 4ZJZA 4PHTA 2YX1A 2YWBA 4FTFA 2UUAC 1IBLC 1O93A 1USPB 2E0GA 4DV2C 4YHHC 4JI3C 4LFCC 4BSZA 1PU1A 2ONFA 1MDFA 2QW0X 1I94C 1P7LA 5BUSA 2D1TA 2JNVA 2V7BA 4DV5C 5AE3A
chains in the Genus database with same CATH topology
3UX3A 2JNVA 3CQ1A 2CU6A 2M5OA 2Z51A 1XHJA 1WCJA 1UWDA 3CQ3A 3LNOA 3CQ2A 3UX2A 1TH5A 1VEHA 2M5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UX3 A;  2JNV A;  3CQ1 A;  2CU6 A;  2M5O A;  2Z51 A;  1XHJ A;  1WCJ A;  1UWD A;  3CQ3 A;  3LNO A;  3CQ2 A;  3UX2 A;  1TH5 A;  1VEH A;  2M5H A; 
#chains in the Genus database with same CATH topology
 2QL8 A;  4K0B A;  3B7W A;  1O92 A;  2ZM6 C;  4JM1 A;  5BSV A;  1V26 A;  5T8T A;  2HHH C;  1HH2 P;  3CQ2 A;  2UXD C;  4X66 C;  2P2J A;  4LFA C;  1KKG A;  3J80 D;  2E8C A;  4PUI A;  1IB8 A;  1HR0 C;  4DR1 C;  2CXC A;  4GXR A;  2D7V A;  4DG8 A;  4R0M A;  1XRA A;  3IEU A;  4ISB A;  4EAT A;  4G36 A;  2DYJ A;  4DCU A;  4OXI A;  4RM2 A;  3TQI A;  3AF6 A;  3UEB A;  1HNX C;  4OYC A;  4AQY C;  3DHV A;  3CJE A;  3R44 A;  4G37 A;  4U5Y D;  3EER A;  4NOZ A;  3DLP X;  1XRB A;  2Y4O A;  1XMQ C;  4GKJ C;  1MXC A;  4X65 C;  5BUQ A;  2OO4 A;  1FLO A;  2P2B A;  4WV3 A;  4LF9 C;  4I9G A;  1N33 C;  5LMU C;  1O9T A;  3H2T A;  2P2Q A;  1PA4 A;  1QM4 A;  2PT7 G;  4JI7 C;  4OX9 C;  4PUG A;  2P20 A;  1WCJ A;  5JRH A;  4B3T C;  1V25 A;  4DR3 C;  2KZ0 A;  5BSW A;  3FCE A;  4L4Q A;  1P4E C;  3N54 B;  3CW8 X;  5BUR A;  1PG4 A;  4XX2 A;  2M5H A;  4NDN A;  4KTV A;  2P2M A;  1UWD A;  2P2F A;  1LCI A;  1L2F A;  1PG3 A;  4IR7 A;  2E5L C;  1NYE A;  5K8F A;  4DV6 C;  2VZE A;  3O2E A;  3I08 A;  4RLQ A;  2CY1 A;  2XR1 A;  5BR8 C;  4LF6 C;  2UXB C;  4LF7 C;  4NXN C;  3RG2 A;  1VLA A;  1V60 A;  4LF4 C;  1HNW C;  4D4I A;  4DV4 C;  4DV7 C;  2Y27 A;  4IZ6 A;  4BCA A;  2NCL A;  2E8E A;  5AE1 A;  2UUB C;  1T5H X;  3LAX A;  2E8F A;  3GPC A;  3PBK A;  2CU6 A;  1ULT A;  2HJG A;  3VNR A;  2QVY X;  2P02 A;  3UOW A;  1XRC A;  5LCI A;  3NYR A;  3TR3 A;  2D1S A;  5LMN C;  1M6X A;  4MH4 A;  3CQ1 A;  4FUT A;  1QWI A;  4MTN A;  1WH9 A;  3LNV A;  1IBK C;  1ZB9 A;  1O90 A;  2WP0 C;  4YY3 C;  4DUY C;  3RV2 A;  5BSU A;  2MM9 A;  1N34 C;  1XMO C;  2UU9 C;  2KDN A;  4D57 A;  2QVX X;  1MDB A;  4BC9 A;  4JI6 C;  3CW9 A;  1FUG A;  1MD9 A;  1N2F A;  2EGT A;  3R9X A;  2ATW A;  2D1R A;  2ASB A;  4DR6 C;  3GR0 A;  3T1Y C;  3R9W A;  2JMP A;  2D27 A;  4FUQ A;  1XS3 A;  4PRO C;  1M6X C;  4DCT A;  1MXB A;  3LGX A;  3A25 A;  4LFB C;  3E7W A;  4R1M A;  4ZLP A;  1RY2 A;  1FJG C;  4DR5 C;  2WD9 A;  4I9F A;  2PRO A;  3IML A;  4LE5 A;  2YWC A;  3LUS A;  4JI4 C;  2VSQ A;  4JI5 C;  4DCS A;  2AYA A;  2QVZ X;  3CQ3 A;  2ZZM A;  4BBY A;  3GR1 A;  1P4E A;  4KHP C;  3SO4 A;  3DAY A;  1RG9 A;  3TUF A;  3VNS A;  5K85 A;  2D1Q A;  3G7S A;  4GXQ A;  4X64 C;  4DG9 A;  3L95 X;  4DR4 C;  2YCB A;  1USP A;  4DUZ C;  2BH1 X;  5AE2 A;  5T8S A;  1ML8 A;  3EQ6 A;  4RM3 A;  2Z51 A;  5KYT A;  4DR2 C;  3AY0 A;  4JYA C;  4DV1 C;  1N32 C;  3GKU A;  3IPL A;  4TPS B;  2E7G A;  1UKK A;  2UXC C;  1T5D X;  3S82 A;  5CZX A;  5IT9 D;  5BSM A;  4GKK C;  4G1I A;  5CZV A;  5KYV A;  1XNR C;  4JI2 C;  4B3R C;  1ZB8 A;  4B3M C;  4PZP A;  3ETO A;  2MMA B;  2ZZN A;  2VQF C;  3ETC A;  4D4G A;  4JI8 C;  2KZF A;  4JV5 C;  2DHM A;  4DV0 C;  1LQL A;  3LNO A;  2OPL A;  3OTO C;  1GPM A;  1XHJ A;  1MKY A;  2D28 C;  4LF8 C;  5FLX D;  5KEI A;  1EGA A;  4NXM C;  2UUC C;  3UX3 A;  4LF5 C;  4X62 C;  3I07 A;  4DCV A;  5IWA C;  3C5E A;  2DPL A;  3A9U A;  4RLF A;  1VEH A;  3JAM D;  4WS9 A;  4JI1 C;  5E7Q A;  3TDE A;  1YJ7 A;  4D56 A;  1JOS A;  5A1G A;  4K0K C;  4B3S C;  3UZ0 A;  3PRO C;  3NPD A;  3KXW A;  3VNQ A;  2F4V C;  1AMU A;  2M5O A;  5DV9 A;  1IBM C;  4R1L A;  3NI2 A;  1TH5 A;  1WF3 A;  5A2Q D;  4RVN A;  2OBV A;  3T1H C;  5IFI A;  4L7I A;  1N36 C;  3FCC A;  4ODJ A;  1HNZ C;  3PES A;  2PN2 A;  5GTD A;  3E7X A;  4L2Z A;  3A26 A;  2OPL B;  2Y4N A;  3A4I A;  5BSR A;  2MCQ A;  4PUH A;  4RVO A;  4DV3 C;  5BST A;  4GS5 A;  5H9U A;  4KTT A;  1NY8 A;  5A19 A;  5ADZ A;  3A9V A;  1BA3 A;  3UX2 A;  3J81 D;  3NYQ A;  3AF5 A;  3IEV A;  3L8C A;  1J5E C;  4BC7 A;  3K6R A;  1MXA A;  1XNQ C;  4RMN A;  3N2Q A;  2BJO A;  4HPV A;  5A1I A;  2VQE C;  4DR7 C;  1K0R A;  4JI0 C;  4ZJZ A;  4PHT A;  2YX1 A;  2YWB A;  4FTF A;  2UUA C;  1IBL C;  1O93 A;  1USP B;  2E0G A;  4DV2 C;  4YHH C;  4JI3 C;  4LFC C;  4BSZ A;  1PU1 A;  2ONF A;  1MDF A;  2QW0 X;  1I94 C;  1P7L A;  5BUS A;  2D1T A;  2JNV A;  2V7B A;  4DV5 C;  5AE3 A; 
#chains in the Genus database with same CATH homology
 3UX3 A;  2JNV A;  3CQ1 A;  2CU6 A;  2M5O A;  2Z51 A;  1XHJ A;  1WCJ A;  1UWD A;  3CQ3 A;  3LNO A;  3CQ2 A;  3UX2 A;  1TH5 A;  1VEH A;  2M5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...