3CQ3A

Structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
NPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHB138
publication title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 24
structure length 98
sequence length 98
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3cq3A00
3LNOA 3UX3A 3CQ1A 1XHJA 1TH5A 3CQ2A 3CQ3A 1VEHA 1WCJA 3UX2A 2CU6A 2M5OA 2M5HA 2JNVA 1UWDA 2Z51A
chains in the Genus database with same CATH superfamily
5A2QD 2UUCC 1XRBA 3FCCA 2UXCC 1O92A 2PROA 1K0RA 5T8TA 3ETOA 3CQ1A 3LAXA 4R1LA 2HJGA 2F4VC 3NI2A 1ZB9A 2CXCA 3IEVA 3C5EA 3OTOC 2Y27A 3S82A 4TPSB 4BSZA 4LF7C 1XNRC 1NYEA 2P2FA 2VSQA 2UXDC 1UKKA 4K0KC 2BH1X 3UOWA 4I9FA 4PUHA 4YHHC 5AE2A 1FUGA 1KKGA 1GPMA 3I08A 3L95X 3CW9A 2UUAC 3I07A 5BR8C 4NOZA 4PZPA 3PROC 3LGXA 2D1TA 1XRCA 3DHVA 4JI4C 2D1QA 4GKJC 2E0GA 4JI1C 4GKKC 4OX9C 3L8CA 5LMNC 4NDNA 4DV6C 4LFCC 5BSVA 3A9VA 3E7XA 3NYRA 4LF4C 2QW0X 2E7GA 1WF3A 1NY8A 4MTNA 2NCLA 4DV1C 2MCQA 4PUGA 2PN2A 4L4QA 2CU6A 3SO4A 3NYQA 4B3SC 3CQ2A 4FUQA 5CZVA 4JI6C 4B3TC 2OPLB 1QM4A 4KTTA 1IBKC 5K8FA 5K85A 4X64C 2WD9A 3AY0A 1PA4A 4JI0C 3CW8X 3IPLA 4BCAA 2E8FA 3J80D 5BSWA 4MH4A 1WCJA 4G1IA 5T8SA 1IB8A 4U5YD 4DV0C 3GR1A 4OYCA 3RG2A 5IWAC 3PESA 4PROC 3JAMD 4DR4C 1MDBA 4DR5C 5BSMA 5E7QA 4ZJZA 4GXQA 2V7BA 3TDEA 2JMPA 2VQFC 4AQYC 4DV2C 1ML8A 4RLQA 1AMUA 2P20A 4RVOA 1TH5A 4RM2A 3LNVA 4RM3A 5BUSA 4DR1C 2KZ0A 2OBVA 3R9WA 4LF5C 4PHTA 4D4GA 2P2JA 4KTVA 2EGTA 3RV2A 3H2TA 3TQIA 4DV3C 1VEHA 1YJ7A 3J81D 5A19A 1USPA 4D57A 1HNXC 4JI5C 5ADZA 3T1YC 4X65C 4R1MA 3GPCA 2ATWA 4L2ZA 3T1HC 4L7IA 1N32C 4LFAC 1P4EC 1V26A 4RMNA 2DYJA 3DAYA 3NPDA 5KEIA 1LQLA 5CZXA 2VZEA 2DPLA 1PG4A 4ISBA 2QVYX 4DR3C 1T5DX 1O90A 1PG3A 2BJOA 2P2QA 5BSUA 3UX2A 4YY3C 4ZLPA 2ASBA 5KYVA 3EERA 1ULTA 1JOSA 3N54B 3VNQA 1MXCA 2DHMA 2YWCA 1MXBA 3B7WA 3N2QA 1MDFA 1HR0C 4RLFA 1RG9A 3VNRA 4GXRA 2D1RA 1XMOC 1PU1A 4G37A 3FCEA 1N36C 1HNWC 3UEBA 4I9GA 1EGAA 1HNZC 3R9XA 3A4IA 1XNQC 4NXNC 2PT7G 4JI2C 3E7WA 2Y4NA 4NXMC 2D1SA 2Y4OA 4BBYA 4B3RC 4BC9A 4HPVA 2MMAB 1O93A 5GTDA 1XHJA 4DV5C 1RY2A 4JI3C 5FLXD 1MD9A 4DUZC 4JV5C 5IFIA 2UU9C 4GS5A 2KDNA 1XRAA 2D27A 1HH2P 3G7SA 3UX3A 2MM9A 4K0BA 2YX1A 5IT9D 3O2EA 2D7VA 4DCVA 4DV7C 4XX2A 1O9TA 2QVZX 4DCSA 3PBKA 4DR7C 2ONFA 5LCIA 4DCUA 1LCIA 1N34C 4JYAC 4DG8A 4G36A 4WS9A 2XR1A 4LF8C 3TUFA 3A9UA 4OXIA 2YWBA 1I94C 2E5LC 5DV9A 1FLOA 2P2MA 1IBLC 2QVXX 1USPB 1BA3A 2CY1A 4JI8C 2M5OA 2ZZNA 5BSRA 2UXBC 5AE1A 4EATA 3IEUA 3IMLA 2KZFA 1XS3A 3EQ6A 1N33C 1VLAA 1MXAA 1MKYA 3AF5A 4D4IA 3GR0A 4X66C 2E8CA 1ZB8A 2JNVA 1P4EA 1IBMC 3LNOA 2YCBA 3GKUA 4JI7C 1UWDA 2Z51A 4DR2C 2VQEC 4X62C 4LFBC 2P02A 2QL8A 1V60A 3A25A 4RVNA 2P2BA 5A1IA 5BURA 4DCTA 4DUYC 2UUBC 1XMQC 4JM1A 4B3MC 5AE3A 1FJGC 4FTFA 2WP0C 4DR6C 4BC7A 2D28C 4D56A 4DV4C 3CQ3A 5BSTA 1J5EC 5LMUC 4FUTA 2AYAA 3A26A 4KHPC 4IR7A 4R0MA 2M5HA 2ZZMA 4LE5A 5H9UA 5A1GA 3TR3A 2OPLA 5BUQA 3UZ0A 4IZ6A 5KYTA 1T5HX 3VNSA 3LUSA 1N2FA 1V25A 2HHHC 1M6XC 3ETCA 1P7LA 3CJEA 4LF6C 4ODJA 2ZM6C 3DLPX 3R44A 5JRHA 3AF6A 2E8EA 4PUIA 1M6XA 3KXWA 4DG9A 1L2FA 1WH9A 4LF9C 4WV3A 1QWIA 3K6RA 2OO4A
chains in the Genus database with same CATH topology
3LNOA 3UX3A 3CQ1A 1XHJA 1TH5A 3CQ2A 3CQ3A 1VEHA 1WCJA 3UX2A 2CU6A 2M5OA 2M5HA 2JNVA 1UWDA 2Z51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNO A;  3UX3 A;  3CQ1 A;  1XHJ A;  1TH5 A;  3CQ2 A;  3CQ3 A;  1VEH A;  1WCJ A;  3UX2 A;  2CU6 A;  2M5O A;  2M5H A;  2JNV A;  1UWD A;  2Z51 A; 
#chains in the Genus database with same CATH topology
 5A2Q D;  2UUC C;  1XRB A;  3FCC A;  2UXC C;  1O92 A;  2PRO A;  1K0R A;  5T8T A;  3ETO A;  3CQ1 A;  3LAX A;  4R1L A;  2HJG A;  2F4V C;  3NI2 A;  1ZB9 A;  2CXC A;  3IEV A;  3C5E A;  3OTO C;  2Y27 A;  3S82 A;  4TPS B;  4BSZ A;  4LF7 C;  1XNR C;  1NYE A;  2P2F A;  2VSQ A;  2UXD C;  1UKK A;  4K0K C;  2BH1 X;  3UOW A;  4I9F A;  4PUH A;  4YHH C;  5AE2 A;  1FUG A;  1KKG A;  1GPM A;  3I08 A;  3L95 X;  3CW9 A;  2UUA C;  3I07 A;  5BR8 C;  4NOZ A;  4PZP A;  3PRO C;  3LGX A;  2D1T A;  1XRC A;  3DHV A;  4JI4 C;  2D1Q A;  4GKJ C;  2E0G A;  4JI1 C;  4GKK C;  4OX9 C;  3L8C A;  5LMN C;  4NDN A;  4DV6 C;  4LFC C;  5BSV A;  3A9V A;  3E7X A;  3NYR A;  4LF4 C;  2QW0 X;  2E7G A;  1WF3 A;  1NY8 A;  4MTN A;  2NCL A;  4DV1 C;  2MCQ A;  4PUG A;  2PN2 A;  4L4Q A;  2CU6 A;  3SO4 A;  3NYQ A;  4B3S C;  3CQ2 A;  4FUQ A;  5CZV A;  4JI6 C;  4B3T C;  2OPL B;  1QM4 A;  4KTT A;  1IBK C;  5K8F A;  5K85 A;  4X64 C;  2WD9 A;  3AY0 A;  1PA4 A;  4JI0 C;  3CW8 X;  3IPL A;  4BCA A;  2E8F A;  3J80 D;  5BSW A;  4MH4 A;  1WCJ A;  4G1I A;  5T8S A;  1IB8 A;  4U5Y D;  4DV0 C;  3GR1 A;  4OYC A;  3RG2 A;  5IWA C;  3PES A;  4PRO C;  3JAM D;  4DR4 C;  1MDB A;  4DR5 C;  5BSM A;  5E7Q A;  4ZJZ A;  4GXQ A;  2V7B A;  3TDE A;  2JMP A;  2VQF C;  4AQY C;  4DV2 C;  1ML8 A;  4RLQ A;  1AMU A;  2P20 A;  4RVO A;  1TH5 A;  4RM2 A;  3LNV A;  4RM3 A;  5BUS A;  4DR1 C;  2KZ0 A;  2OBV A;  3R9W A;  4LF5 C;  4PHT A;  4D4G A;  2P2J A;  4KTV A;  2EGT A;  3RV2 A;  3H2T A;  3TQI A;  4DV3 C;  1VEH A;  1YJ7 A;  3J81 D;  5A19 A;  1USP A;  4D57 A;  1HNX C;  4JI5 C;  5ADZ A;  3T1Y C;  4X65 C;  4R1M A;  3GPC A;  2ATW A;  4L2Z A;  3T1H C;  4L7I A;  1N32 C;  4LFA C;  1P4E C;  1V26 A;  4RMN A;  2DYJ A;  3DAY A;  3NPD A;  5KEI A;  1LQL A;  5CZX A;  2VZE A;  2DPL A;  1PG4 A;  4ISB A;  2QVY X;  4DR3 C;  1T5D X;  1O90 A;  1PG3 A;  2BJO A;  2P2Q A;  5BSU A;  3UX2 A;  4YY3 C;  4ZLP A;  2ASB A;  5KYV A;  3EER A;  1ULT A;  1JOS A;  3N54 B;  3VNQ A;  1MXC A;  2DHM A;  2YWC A;  1MXB A;  3B7W A;  3N2Q A;  1MDF A;  1HR0 C;  4RLF A;  1RG9 A;  3VNR A;  4GXR A;  2D1R A;  1XMO C;  1PU1 A;  4G37 A;  3FCE A;  1N36 C;  1HNW C;  3UEB A;  4I9G A;  1EGA A;  1HNZ C;  3R9X A;  3A4I A;  1XNQ C;  4NXN C;  2PT7 G;  4JI2 C;  3E7W A;  2Y4N A;  4NXM C;  2D1S A;  2Y4O A;  4BBY A;  4B3R C;  4BC9 A;  4HPV A;  2MMA B;  1O93 A;  5GTD A;  1XHJ A;  4DV5 C;  1RY2 A;  4JI3 C;  5FLX D;  1MD9 A;  4DUZ C;  4JV5 C;  5IFI A;  2UU9 C;  4GS5 A;  2KDN A;  1XRA A;  2D27 A;  1HH2 P;  3G7S A;  3UX3 A;  2MM9 A;  4K0B A;  2YX1 A;  5IT9 D;  3O2E A;  2D7V A;  4DCV A;  4DV7 C;  4XX2 A;  1O9T A;  2QVZ X;  4DCS A;  3PBK A;  4DR7 C;  2ONF A;  5LCI A;  4DCU A;  1LCI A;  1N34 C;  4JYA C;  4DG8 A;  4G36 A;  4WS9 A;  2XR1 A;  4LF8 C;  3TUF A;  3A9U A;  4OXI A;  2YWB A;  1I94 C;  2E5L C;  5DV9 A;  1FLO A;  2P2M A;  1IBL C;  2QVX X;  1USP B;  1BA3 A;  2CY1 A;  4JI8 C;  2M5O A;  2ZZN A;  5BSR A;  2UXB C;  5AE1 A;  4EAT A;  3IEU A;  3IML A;  2KZF A;  1XS3 A;  3EQ6 A;  1N33 C;  1VLA A;  1MXA A;  1MKY A;  3AF5 A;  4D4I A;  3GR0 A;  4X66 C;  2E8C A;  1ZB8 A;  2JNV A;  1P4E A;  1IBM C;  3LNO A;  2YCB A;  3GKU A;  4JI7 C;  1UWD A;  2Z51 A;  4DR2 C;  2VQE C;  4X62 C;  4LFB C;  2P02 A;  2QL8 A;  1V60 A;  3A25 A;  4RVN A;  2P2B A;  5A1I A;  5BUR A;  4DCT A;  4DUY C;  2UUB C;  1XMQ C;  4JM1 A;  4B3M C;  5AE3 A;  1FJG C;  4FTF A;  2WP0 C;  4DR6 C;  4BC7 A;  2D28 C;  4D56 A;  4DV4 C;  3CQ3 A;  5BST A;  1J5E C;  5LMU C;  4FUT A;  2AYA A;  3A26 A;  4KHP C;  4IR7 A;  4R0M A;  2M5H A;  2ZZM A;  4LE5 A;  5H9U A;  5A1G A;  3TR3 A;  2OPL A;  5BUQ A;  3UZ0 A;  4IZ6 A;  5KYT A;  1T5H X;  3VNS A;  3LUS A;  1N2F A;  1V25 A;  2HHH C;  1M6X C;  3ETC A;  1P7L A;  3CJE A;  4LF6 C;  4ODJ A;  2ZM6 C;  3DLP X;  3R44 A;  5JRH A;  3AF6 A;  2E8E A;  4PUI A;  1M6X A;  3KXW A;  4DG9 A;  1L2F A;  1WH9 A;  4LF9 C;  4WV3 A;  1QWI A;  3K6R A;  2OO4 A; 
#chains in the Genus database with same CATH homology
 3LNO A;  3UX3 A;  3CQ1 A;  1XHJ A;  1TH5 A;  3CQ2 A;  3CQ3 A;  1VEH A;  1WCJ A;  3UX2 A;  2CU6 A;  2M5O A;  2M5H A;  2JNV A;  1UWD A;  2Z51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...