3LNOA

Crystal structure of domain of unknown function duf59 from bacillus anthracis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
NAMSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Domain of Unknown Function DUF59 Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3lnoA00
2M5HA 3CQ1A 2CU6A 2M5OA 3CQ2A 3UX2A 3UX3A 1UWDA 3LNOA 1TH5A 1VEHA 1XHJA 3CQ3A 1WCJA 2Z51A 2JNVA
chains in the Genus database with same CATH superfamily
2QVZX 4RLQA 5BSMA 3RG2A 3AF6A 1NY8A 2KZFA 4R1LA 4DR3C 2ONFA 1MD9A 3A9UA 4DV1C 2KDNA 4NXMC 3UX3A 4B3TC 1ML8A 2Y4OA 2QVXX 5K8FA 3PBKA 2WP0C 2D1TA 4X66C 5BSWA 4I9GA 2P02A 5IFIA 4DV7C 4DR6C 5KEIA 1IBLC 3SO4A 1O9TA 2P20A 4DG8A 4GS5A 4U5YD 5K85A 3NI2A 5KYTA 4L4QA 3CJEA 1K0RA 1MDFA 2E5LC 4RLFA 1TH5A 1FJGC 4D57A 1UKKA 3R9XA 2M5HA 4GXRA 1GPMA 5E7QA 3AY0A 3UZ0A 4B3SC 4I9FA 1XNQC 4BC7A 3CQ2A 2VSQA 2ZZMA 1QWIA 4LFCC 3R44A 5A1IA 2P2MA 4DV5C 5LCIA 1USPB 4OXIA 3NYQA 4DR2C 2PN2A 4JYAC 1XS3A 3CQ3A 3VNSA 4KTTA 4PHTA 1IBKC 1PG3A 3GPCA 2OBVA 1KKGA 1HNXC 3TUFA 2PROA 2UUAC 5AE3A 3E7WA 4D56A 4JI3C 4DR4C 3LNOA 4NDNA 5T8TA 4D4IA 4TPSB 4BCAA 5BSUA 5BSVA 4LE5A 2D28C 4DV0C 1HNZC 1N32C 2CXCA 2ASBA 4PROC 1IB8A 3L8CA 1LCIA 3UX2A 1QM4A 5AE2A 2P2BA 2MMAB 4B3MC 2DYJA 2D1QA 3ETCA 4LF8C 4L2ZA 3N2QA 2QVYX 3LNVA 4L7IA 5BUQA 3GR1A 1MXAA 3A4IA 2UXBC 1HH2P 4RM2A 1V25A 3L95X 4R1MA 1XMQC 4X64C 5BSRA 2E8FA 3B7WA 3CW9A 4K0BA 4MH4A 1WH9A 4PZPA 4DV3C 1XNRC 1MXCA 4X65C 4JV5C 1HNWC 2EGTA 2E8EA 4JI2C 3I08A 5H9UA 4BSZA 4DUYC 1MKYA 4DUZC 1XRAA 5GTDA 4NOZA 3A25A 3EQ6A 3NYRA 1O93A 1XRCA 1O90A 3OTOC 4X62C 1FLOA 3CW8X 1MDBA 2OPLB 1V60A 4B3RC 2ZM6C 4JI1C 2MCQA 2YWBA 1N34C 3GR0A 3FCCA 2Y4NA 2CY1A 1IBMC 2Z51A 3RV2A 5BR8C 3CQ1A 3C5EA 4LF4C 1WF3A 4OYCA 2XR1A 2UXCC 1T5DX 3TDEA 2F4VC 3IEVA 4ZJZA 4RVOA 4BC9A 4RM3A 4PUIA 2UXDC 3E7XA 4JI4C 2VQFC 4DV2C 4FUQA 4NXNC 3JAMD 4LFAC 3IPLA 2AYAA 4PUHA 4HPVA 3LGXA 2NCLA 4FUTA 2P2FA 4YHHC 5IWAC 1PG4A 5KYVA 4KHPC 2UU9C 3N54B 4PUGA 1M6XA 2JNVA 4LF6C 4YY3C 4EATA 1BA3A 4G36A 4WV3A 5LMNC 4LF7C 4LF9C 4DV6C 4DCUA 4LFBC 4FTFA 4JI8C 2YX1A 1P7LA 4D4GA 4ISBA 5BURA 3J80D 1M6XC 3IMLA 4GKKC 4OX9C 3AF5A 5LMUC 1PA4A 1P4EC 2VZEA 2E7GA 5A2QD 1LQLA 2DHMA 3A26A 1L2FA 4DR5C 2CU6A 2E8CA 1O92A 4DR1C 1N2FA 4GXQA 4DCVA 1XHJA 2QW0X 1USPA 5DV9A 2E0GA 2YCBA 1V26A 2YWCA 1XRBA 1JOSA 3DAYA 3R9WA 3FCEA 3LAXA 1MXBA 1UWDA 1J5EC 4G1IA 3DLPX 5T8SA 2D27A 1P4EA 2WD9A 4RVNA 2D1RA 2VQEC 2UUBC 3GKUA 2MM9A 3A9VA 3I07A 1T5HX 2D7VA 1ULTA 2KZ0A 1RY2A 2HHHC 2Y27A 1N33C 1FUGA 5CZVA 5FLXD 4DV4C 1ZB9A 3DHVA 3T1YC 2ZZNA 3G7SA 3IEUA 3S82A 1VEHA 1PU1A 3VNQA 4ZLPA 3H2TA 3O2EA 1NYEA 5BSTA 2V7BA 3T1HC 3KXWA 1XMOC 1I94C 4DG9A 5A19A 4RMNA 2OO4A 5BUSA 3TR3A 1HR0C 4MTNA 3VNRA 3UEBA 1RG9A 2DPLA 4LF5C 1VLAA 4K0KC 2HJGA 4BBYA 2ATWA 2JMPA 4XX2A 4JI0C 5ADZA 5CZXA 2OPLA 2P2JA 2BH1X 2PT7G 5IT9D 2P2QA 4DCSA 4DR7C 3PESA 2M5OA 4JI5C 4JM1A 5JRHA 1N36C 2UUCC 1YJ7A 5AE1A 2D1SA 4IR7A 4GKJC 2QL8A 3NPDA 3PROC 3TQIA 4JI6C 1ZB8A 4WS9A 4KTVA 1WCJA 1EGAA 3UOWA 1AMUA 4IZ6A 2BJOA 4JI7C 4AQYC 3K6RA 4R0MA 3ETOA 4DCTA 3EERA 4G37A 4ODJA 5A1GA 3J81D 3LUSA
chains in the Genus database with same CATH topology
2M5HA 3CQ1A 2CU6A 2M5OA 3CQ2A 3UX2A 3UX3A 1UWDA 3LNOA 1TH5A 1VEHA 1XHJA 3CQ3A 1WCJA 2Z51A 2JNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5H A;  3CQ1 A;  2CU6 A;  2M5O A;  3CQ2 A;  3UX2 A;  3UX3 A;  1UWD A;  3LNO A;  1TH5 A;  1VEH A;  1XHJ A;  3CQ3 A;  1WCJ A;  2Z51 A;  2JNV A; 
#chains in the Genus database with same CATH topology
 2QVZ X;  4RLQ A;  5BSM A;  3RG2 A;  3AF6 A;  1NY8 A;  2KZF A;  4R1L A;  4DR3 C;  2ONF A;  1MD9 A;  3A9U A;  4DV1 C;  2KDN A;  4NXM C;  3UX3 A;  4B3T C;  1ML8 A;  2Y4O A;  2QVX X;  5K8F A;  3PBK A;  2WP0 C;  2D1T A;  4X66 C;  5BSW A;  4I9G A;  2P02 A;  5IFI A;  4DV7 C;  4DR6 C;  5KEI A;  1IBL C;  3SO4 A;  1O9T A;  2P20 A;  4DG8 A;  4GS5 A;  4U5Y D;  5K85 A;  3NI2 A;  5KYT A;  4L4Q A;  3CJE A;  1K0R A;  1MDF A;  2E5L C;  4RLF A;  1TH5 A;  1FJG C;  4D57 A;  1UKK A;  3R9X A;  2M5H A;  4GXR A;  1GPM A;  5E7Q A;  3AY0 A;  3UZ0 A;  4B3S C;  4I9F A;  1XNQ C;  4BC7 A;  3CQ2 A;  2VSQ A;  2ZZM A;  1QWI A;  4LFC C;  3R44 A;  5A1I A;  2P2M A;  4DV5 C;  5LCI A;  1USP B;  4OXI A;  3NYQ A;  4DR2 C;  2PN2 A;  4JYA C;  1XS3 A;  3CQ3 A;  3VNS A;  4KTT A;  4PHT A;  1IBK C;  1PG3 A;  3GPC A;  2OBV A;  1KKG A;  1HNX C;  3TUF A;  2PRO A;  2UUA C;  5AE3 A;  3E7W A;  4D56 A;  4JI3 C;  4DR4 C;  3LNO A;  4NDN A;  5T8T A;  4D4I A;  4TPS B;  4BCA A;  5BSU A;  5BSV A;  4LE5 A;  2D28 C;  4DV0 C;  1HNZ C;  1N32 C;  2CXC A;  2ASB A;  4PRO C;  1IB8 A;  3L8C A;  1LCI A;  3UX2 A;  1QM4 A;  5AE2 A;  2P2B A;  2MMA B;  4B3M C;  2DYJ A;  2D1Q A;  3ETC A;  4LF8 C;  4L2Z A;  3N2Q A;  2QVY X;  3LNV A;  4L7I A;  5BUQ A;  3GR1 A;  1MXA A;  3A4I A;  2UXB C;  1HH2 P;  4RM2 A;  1V25 A;  3L95 X;  4R1M A;  1XMQ C;  4X64 C;  5BSR A;  2E8F A;  3B7W A;  3CW9 A;  4K0B A;  4MH4 A;  1WH9 A;  4PZP A;  4DV3 C;  1XNR C;  1MXC A;  4X65 C;  4JV5 C;  1HNW C;  2EGT A;  2E8E A;  4JI2 C;  3I08 A;  5H9U A;  4BSZ A;  4DUY C;  1MKY A;  4DUZ C;  1XRA A;  5GTD A;  4NOZ A;  3A25 A;  3EQ6 A;  3NYR A;  1O93 A;  1XRC A;  1O90 A;  3OTO C;  4X62 C;  1FLO A;  3CW8 X;  1MDB A;  2OPL B;  1V60 A;  4B3R C;  2ZM6 C;  4JI1 C;  2MCQ A;  2YWB A;  1N34 C;  3GR0 A;  3FCC A;  2Y4N A;  2CY1 A;  1IBM C;  2Z51 A;  3RV2 A;  5BR8 C;  3CQ1 A;  3C5E A;  4LF4 C;  1WF3 A;  4OYC A;  2XR1 A;  2UXC C;  1T5D X;  3TDE A;  2F4V C;  3IEV A;  4ZJZ A;  4RVO A;  4BC9 A;  4RM3 A;  4PUI A;  2UXD C;  3E7X A;  4JI4 C;  2VQF C;  4DV2 C;  4FUQ A;  4NXN C;  3JAM D;  4LFA C;  3IPL A;  2AYA A;  4PUH A;  4HPV A;  3LGX A;  2NCL A;  4FUT A;  2P2F A;  4YHH C;  5IWA C;  1PG4 A;  5KYV A;  4KHP C;  2UU9 C;  3N54 B;  4PUG A;  1M6X A;  2JNV A;  4LF6 C;  4YY3 C;  4EAT A;  1BA3 A;  4G36 A;  4WV3 A;  5LMN C;  4LF7 C;  4LF9 C;  4DV6 C;  4DCU A;  4LFB C;  4FTF A;  4JI8 C;  2YX1 A;  1P7L A;  4D4G A;  4ISB A;  5BUR A;  3J80 D;  1M6X C;  3IML A;  4GKK C;  4OX9 C;  3AF5 A;  5LMU C;  1PA4 A;  1P4E C;  2VZE A;  2E7G A;  5A2Q D;  1LQL A;  2DHM A;  3A26 A;  1L2F A;  4DR5 C;  2CU6 A;  2E8C A;  1O92 A;  4DR1 C;  1N2F A;  4GXQ A;  4DCV A;  1XHJ A;  2QW0 X;  1USP A;  5DV9 A;  2E0G A;  2YCB A;  1V26 A;  2YWC A;  1XRB A;  1JOS A;  3DAY A;  3R9W A;  3FCE A;  3LAX A;  1MXB A;  1UWD A;  1J5E C;  4G1I A;  3DLP X;  5T8S A;  2D27 A;  1P4E A;  2WD9 A;  4RVN A;  2D1R A;  2VQE C;  2UUB C;  3GKU A;  2MM9 A;  3A9V A;  3I07 A;  1T5H X;  2D7V A;  1ULT A;  2KZ0 A;  1RY2 A;  2HHH C;  2Y27 A;  1N33 C;  1FUG A;  5CZV A;  5FLX D;  4DV4 C;  1ZB9 A;  3DHV A;  3T1Y C;  2ZZN A;  3G7S A;  3IEU A;  3S82 A;  1VEH A;  1PU1 A;  3VNQ A;  4ZLP A;  3H2T A;  3O2E A;  1NYE A;  5BST A;  2V7B A;  3T1H C;  3KXW A;  1XMO C;  1I94 C;  4DG9 A;  5A19 A;  4RMN A;  2OO4 A;  5BUS A;  3TR3 A;  1HR0 C;  4MTN A;  3VNR A;  3UEB A;  1RG9 A;  2DPL A;  4LF5 C;  1VLA A;  4K0K C;  2HJG A;  4BBY A;  2ATW A;  2JMP A;  4XX2 A;  4JI0 C;  5ADZ A;  5CZX A;  2OPL A;  2P2J A;  2BH1 X;  2PT7 G;  5IT9 D;  2P2Q A;  4DCS A;  4DR7 C;  3PES A;  2M5O A;  4JI5 C;  4JM1 A;  5JRH A;  1N36 C;  2UUC C;  1YJ7 A;  5AE1 A;  2D1S A;  4IR7 A;  4GKJ C;  2QL8 A;  3NPD A;  3PRO C;  3TQI A;  4JI6 C;  1ZB8 A;  4WS9 A;  4KTV A;  1WCJ A;  1EGA A;  3UOW A;  1AMU A;  4IZ6 A;  2BJO A;  4JI7 C;  4AQY C;  3K6R A;  4R0M A;  3ETO A;  4DCT A;  3EER A;  4G37 A;  4ODJ A;  5A1G A;  3J81 D;  3LUS A; 
#chains in the Genus database with same CATH homology
 2M5H A;  3CQ1 A;  2CU6 A;  2M5O A;  3CQ2 A;  3UX2 A;  3UX3 A;  1UWD A;  3LNO A;  1TH5 A;  1VEH A;  1XHJ A;  3CQ3 A;  1WCJ A;  2Z51 A;  2JNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...