3LNOA

Crystal structure of domain of unknown function duf59 from bacillus anthracis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
NAMSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Domain of Unknown Function DUF59 Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3lnoA00
2CU6A 3CQ3A 3UX2A 1TH5A 1XHJA 3UX3A 2Z51A 3CQ1A 2JNVA 3LNOA 1UWDA 2M5OA 1WCJA 2M5HA 3CQ2A 1VEHA
chains in the Genus database with same CATH superfamily
1HNWC 4K0BA 3UX2A 1XS3A 3CW9A 2OO4A 4JYAC 5BURA 2M5HA 2DHMA 3LAXA 3AY0A 1N32C 4R1LA 4WV3A 1WCJA 2D7VA 2E0GA 2DPLA 5ADZA 4NOZA 5BUSA 5JRHA 4LF7C 2UUBC 2M5OA 1BA3A 1O9TA 3IEUA 1PG4A 1ZB9A 4OX9C 2Y27A 4I9FA 5E7QA 3FCEA 3JAMD 5BSUA 2D1TA 3S82A 1PA4A 4LF4C 1MKYA 4NXNC 2P02A 1NY8A 4DV0C 3R9XA 2KDNA 4PZPA 3A26A 3GR1A 3UX3A 3R9WA 3CQ2A 3SO4A 4JI3C 4B3SC 3EQ6A 1NYEA 1O90A 2P2QA 4PHTA 5BSRA 4DV4C 2YWCA 1GPMA 1WH9A 4B3TC 3ETOA 2CU6A 4ZJZA 3KXWA 3CQ1A 3I07A 1HH2P 1TH5A 4JI2C 1WF3A 2QW0X 2D1QA 2WP0C 5A19A 3B7WA 2Y4OA 2UXCC 4OYCA 3AF6A 4LF5C 4NXMC 4RMNA 5KEIA 5IT9D 4GKJC 5T8SA 4NDNA 4LFCC 1XRAA 1USPB 3LNOA 3C5EA 1FUGA 2VQFC 2E8EA 1XNQC 4DUYC 2UXBC 3T1YC 2P2MA 1QWIA 3CJEA 2KZFA 3R44A 4DV3C 4XX2A 4GXQA 4AQYC 4JI4C 4K0KC 4RM3A 4LF6C 2PROA 3GPCA 2UUAC 4HPVA 4RVNA 3I08A 3TUFA 4BC9A 3VNRA 5CZXA 3GKUA 3J81D 5IFIA 1IBLC 2MM9A 3AF5A 3UZ0A 4RM2A 5AE3A 3NYQA 2YX1A 5T8TA 5BSMA 4X64C 4LF8C 1XRCA 2ZM6C 4IZ6A 3E7XA 2YWBA 5A1GA 4BC7A 4G36A 3A9UA 5BSTA 4JI5C 4JI8C 5BR8C 1VEHA 2AYAA 2DYJA 3T1HC 2ASBA 2P20A 3VNSA 2VZEA 4JV5C 4DV2C 3PESA 4GS5A 1XRBA 4DCUA 4DUZC 2QVZX 3K6RA 1ML8A 4JM1A 2ONFA 1V26A 5KYTA 5AE1A 1T5HX 5K85A 4IR7A 4FUQA 4KHPC 1V25A 1FLOA 2PT7G 5BSVA 1QM4A 2ATWA 1O93A 4TPSB 2OBVA 4YY3C 1T5DX 3L95X 2JNVA 3L8CA 2V7BA 4G1IA 3A4IA 2D1SA 2D28C 3DHVA 2BJOA 4X66C 3IEVA 3LNVA 2QVYX 1M6XA 4DG9A 2JMPA 2ZZMA 2WD9A 4U5YD 1XMOC 1LCIA 3NI2A 2KZ0A 4JI1C 3VNQA 1P4EC 4B3RC 4D4IA 5KYVA 4X65C 1O92A 4D56A 4JI7C 5BSWA 5A2QD 2P2JA 5H9UA 4PROC 1XHJA 4LF9C 2P2BA 3IPLA 3RG2A 1AMUA 3O2EA 2P2FA 4DV6C 1LQLA 1P4EA 2CXCA 3DLPX 3A25A 1IB8A 1KKGA 3EERA 1JOSA 4DV1C 3NPDA 3NYRA 4RLQA 4EATA 3LGXA 4DG8A 4DR3C 4LFBC 4I9GA 5AE2A 2YCBA 3CQ3A 4R1MA 1XNRC 4DR4C 2OPLB 4X62C 3TQIA 1USPA 5BUQA 1MD9A 2Y4NA 1PG3A 3CW8X 4PUGA 4B3MC 3H2TA 4JI0C 2ZZNA 5CZVA 2E7GA 3UEBA 3N54B 1ULTA 4KTVA 4DCSA 2NCLA 4ZLPA 4OXIA 4PUHA 5GTDA 2E8FA 3OTOC 3RV2A 3J80D 1N2FA 4R0MA 1MDBA 2MMAB 5IWAC 2PN2A 4MTNA 4L7IA 3PBKA 4BBYA 4GKKC 1UWDA 1V60A 1YJ7A 5K8FA 2VQEC 4PUIA 1MXAA 1FJGC 5LMUC 1N33C 3A9VA 4BSZA 4MH4A 4DR7C 4YHHC 4RLFA 1PU1A 5FLXD 3IMLA 4DR6C 4D57A 2MCQA 2CY1A 4DCTA 4JI6C 2E5LC 4FTFA 2UUCC 2OPLA 3G7SA 1N34C 1MDFA 2QVXX 5DV9A 2VSQA 4WS9A 1RG9A 4DV5C 1ZB8A 1MXCA 4L2ZA 3GR0A 1M6XC 1MXBA 3N2QA 5A1IA 4GXRA 4LE5A 2Z51A 4L4QA 3FCCA 1VLAA 4RVOA 4DR5C 4BCAA 4DR2C 3DAYA 1IBMC 4LFAC 1IBKC 5LCIA 2EGTA 1I94C 2HJGA 3ETCA 2F4VC 1HNZC 1N36C 2HHHC 1J5EC 1UKKA 4KTTA 4DCVA 2QL8A 2D1RA 2XR1A 2UU9C 4G37A 1K0RA 2E8CA 1HNXC 3UOWA 1RY2A 4ODJA 4D4GA 5LMNC 4ISBA 1EGAA 1XMQC 3E7WA 1L2FA 2UXDC 3TR3A 3TDEA 1HR0C 1P7LA 4FUTA 4DV7C 2BH1X 3PROC 2D27A 4DR1C 3LUSA
chains in the Genus database with same CATH topology
2CU6A 3CQ3A 3UX2A 1TH5A 1XHJA 3UX3A 2Z51A 3CQ1A 2JNVA 3LNOA 1UWDA 2M5OA 1WCJA 2M5HA 3CQ2A 1VEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU6 A;  3CQ3 A;  3UX2 A;  1TH5 A;  1XHJ A;  3UX3 A;  2Z51 A;  3CQ1 A;  2JNV A;  3LNO A;  1UWD A;  2M5O A;  1WCJ A;  2M5H A;  3CQ2 A;  1VEH A; 
#chains in the Genus database with same CATH topology
 1HNW C;  4K0B A;  3UX2 A;  1XS3 A;  3CW9 A;  2OO4 A;  4JYA C;  5BUR A;  2M5H A;  2DHM A;  3LAX A;  3AY0 A;  1N32 C;  4R1L A;  4WV3 A;  1WCJ A;  2D7V A;  2E0G A;  2DPL A;  5ADZ A;  4NOZ A;  5BUS A;  5JRH A;  4LF7 C;  2UUB C;  2M5O A;  1BA3 A;  1O9T A;  3IEU A;  1PG4 A;  1ZB9 A;  4OX9 C;  2Y27 A;  4I9F A;  5E7Q A;  3FCE A;  3JAM D;  5BSU A;  2D1T A;  3S82 A;  1PA4 A;  4LF4 C;  1MKY A;  4NXN C;  2P02 A;  1NY8 A;  4DV0 C;  3R9X A;  2KDN A;  4PZP A;  3A26 A;  3GR1 A;  3UX3 A;  3R9W A;  3CQ2 A;  3SO4 A;  4JI3 C;  4B3S C;  3EQ6 A;  1NYE A;  1O90 A;  2P2Q A;  4PHT A;  5BSR A;  4DV4 C;  2YWC A;  1GPM A;  1WH9 A;  4B3T C;  3ETO A;  2CU6 A;  4ZJZ A;  3KXW A;  3CQ1 A;  3I07 A;  1HH2 P;  1TH5 A;  4JI2 C;  1WF3 A;  2QW0 X;  2D1Q A;  2WP0 C;  5A19 A;  3B7W A;  2Y4O A;  2UXC C;  4OYC A;  3AF6 A;  4LF5 C;  4NXM C;  4RMN A;  5KEI A;  5IT9 D;  4GKJ C;  5T8S A;  4NDN A;  4LFC C;  1XRA A;  1USP B;  3LNO A;  3C5E A;  1FUG A;  2VQF C;  2E8E A;  1XNQ C;  4DUY C;  2UXB C;  3T1Y C;  2P2M A;  1QWI A;  3CJE A;  2KZF A;  3R44 A;  4DV3 C;  4XX2 A;  4GXQ A;  4AQY C;  4JI4 C;  4K0K C;  4RM3 A;  4LF6 C;  2PRO A;  3GPC A;  2UUA C;  4HPV A;  4RVN A;  3I08 A;  3TUF A;  4BC9 A;  3VNR A;  5CZX A;  3GKU A;  3J81 D;  5IFI A;  1IBL C;  2MM9 A;  3AF5 A;  3UZ0 A;  4RM2 A;  5AE3 A;  3NYQ A;  2YX1 A;  5T8T A;  5BSM A;  4X64 C;  4LF8 C;  1XRC A;  2ZM6 C;  4IZ6 A;  3E7X A;  2YWB A;  5A1G A;  4BC7 A;  4G36 A;  3A9U A;  5BST A;  4JI5 C;  4JI8 C;  5BR8 C;  1VEH A;  2AYA A;  2DYJ A;  3T1H C;  2ASB A;  2P20 A;  3VNS A;  2VZE A;  4JV5 C;  4DV2 C;  3PES A;  4GS5 A;  1XRB A;  4DCU A;  4DUZ C;  2QVZ X;  3K6R A;  1ML8 A;  4JM1 A;  2ONF A;  1V26 A;  5KYT A;  5AE1 A;  1T5H X;  5K85 A;  4IR7 A;  4FUQ A;  4KHP C;  1V25 A;  1FLO A;  2PT7 G;  5BSV A;  1QM4 A;  2ATW A;  1O93 A;  4TPS B;  2OBV A;  4YY3 C;  1T5D X;  3L95 X;  2JNV A;  3L8C A;  2V7B A;  4G1I A;  3A4I A;  2D1S A;  2D28 C;  3DHV A;  2BJO A;  4X66 C;  3IEV A;  3LNV A;  2QVY X;  1M6X A;  4DG9 A;  2JMP A;  2ZZM A;  2WD9 A;  4U5Y D;  1XMO C;  1LCI A;  3NI2 A;  2KZ0 A;  4JI1 C;  3VNQ A;  1P4E C;  4B3R C;  4D4I A;  5KYV A;  4X65 C;  1O92 A;  4D56 A;  4JI7 C;  5BSW A;  5A2Q D;  2P2J A;  5H9U A;  4PRO C;  1XHJ A;  4LF9 C;  2P2B A;  3IPL A;  3RG2 A;  1AMU A;  3O2E A;  2P2F A;  4DV6 C;  1LQL A;  1P4E A;  2CXC A;  3DLP X;  3A25 A;  1IB8 A;  1KKG A;  3EER A;  1JOS A;  4DV1 C;  3NPD A;  3NYR A;  4RLQ A;  4EAT A;  3LGX A;  4DG8 A;  4DR3 C;  4LFB C;  4I9G A;  5AE2 A;  2YCB A;  3CQ3 A;  4R1M A;  1XNR C;  4DR4 C;  2OPL B;  4X62 C;  3TQI A;  1USP A;  5BUQ A;  1MD9 A;  2Y4N A;  1PG3 A;  3CW8 X;  4PUG A;  4B3M C;  3H2T A;  4JI0 C;  2ZZN A;  5CZV A;  2E7G A;  3UEB A;  3N54 B;  1ULT A;  4KTV A;  4DCS A;  2NCL A;  4ZLP A;  4OXI A;  4PUH A;  5GTD A;  2E8F A;  3OTO C;  3RV2 A;  3J80 D;  1N2F A;  4R0M A;  1MDB A;  2MMA B;  5IWA C;  2PN2 A;  4MTN A;  4L7I A;  3PBK A;  4BBY A;  4GKK C;  1UWD A;  1V60 A;  1YJ7 A;  5K8F A;  2VQE C;  4PUI A;  1MXA A;  1FJG C;  5LMU C;  1N33 C;  3A9V A;  4BSZ A;  4MH4 A;  4DR7 C;  4YHH C;  4RLF A;  1PU1 A;  5FLX D;  3IML A;  4DR6 C;  4D57 A;  2MCQ A;  2CY1 A;  4DCT A;  4JI6 C;  2E5L C;  4FTF A;  2UUC C;  2OPL A;  3G7S A;  1N34 C;  1MDF A;  2QVX X;  5DV9 A;  2VSQ A;  4WS9 A;  1RG9 A;  4DV5 C;  1ZB8 A;  1MXC A;  4L2Z A;  3GR0 A;  1M6X C;  1MXB A;  3N2Q A;  5A1I A;  4GXR A;  4LE5 A;  2Z51 A;  4L4Q A;  3FCC A;  1VLA A;  4RVO A;  4DR5 C;  4BCA A;  4DR2 C;  3DAY A;  1IBM C;  4LFA C;  1IBK C;  5LCI A;  2EGT A;  1I94 C;  2HJG A;  3ETC A;  2F4V C;  1HNZ C;  1N36 C;  2HHH C;  1J5E C;  1UKK A;  4KTT A;  4DCV A;  2QL8 A;  2D1R A;  2XR1 A;  2UU9 C;  4G37 A;  1K0R A;  2E8C A;  1HNX C;  3UOW A;  1RY2 A;  4ODJ A;  4D4G A;  5LMN C;  4ISB A;  1EGA A;  1XMQ C;  3E7W A;  1L2F A;  2UXD C;  3TR3 A;  3TDE A;  1HR0 C;  1P7L A;  4FUT A;  4DV7 C;  2BH1 X;  3PRO C;  2D27 A;  4DR1 C;  3LUS A; 
#chains in the Genus database with same CATH homology
 2CU6 A;  3CQ3 A;  3UX2 A;  1TH5 A;  1XHJ A;  3UX3 A;  2Z51 A;  3CQ1 A;  2JNV A;  3LNO A;  1UWD A;  2M5O A;  1WCJ A;  2M5H A;  3CQ2 A;  1VEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...