3LNOA

Crystal structure of domain of unknown function duf59 from bacillus anthracis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
NAMSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Crystal Structure of Domain of Unknown Function DUF59 Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3lnoA00
1TH5A 1UWDA 3CQ3A 2M5OA 3LNOA 1WCJA 2M5HA 2Z51A 3CQ2A 2JNVA 3UX3A 2CU6A 3UX2A 1XHJA 1VEHA 3CQ1A
chains in the Genus database with same CATH superfamily
4X65C 3GKUA 4FTFA 2OPLA 5AE2A 1USPB 5BSTA 2D7VA 4OYCA 4RVOA 4RLFA 4BC9A 5DV9A 5A1GA 4JI5C 1IB8A 1P4EA 1MXBA 3AY0A 1ZB8A 4DR3C 1PG3A 2BH1X 4JI0C 2OPLB 2E5LC 5KYVA 3AF6A 4G36A 3PROC 4PZPA 1HNWC 5AE3A 2QVZX 3O2EA 1IBKC 4BC7A 3PBKA 2CXCA 3R44A 1T5HX 4XX2A 4LF6C 1NYEA 1WCJA 3ETCA 3GR1A 5BUSA 1XMOC 3TR3A 4KHPC 2JNVA 3K6RA 4DV5C 2WP0C 3L95X 4G37A 4DR1C 4WV3A 2MMAB 1O9TA 4LFAC 4GKKC 1N36C 4LF7C 3N54B 3NI2A 1XHJA 2EGTA 1ZB9A 3L8CA 1XNRC 2Z51A 1L2FA 5BUQA 4FUQA 2D1SA 2UUBC 4PUIA 4MTNA 5KYTA 2BJOA 2HJGA 2CU6A 2PT7G 5T8SA 2D1RA 2V7BA 2AYAA 2YCBA 5BSMA 1K0RA 3EERA 3I08A 5IFIA 1AMUA 4I9GA 2P2JA 2ONFA 4LFCC 5LMUC 2E7GA 2DYJA 4RVNA 4DR5C 4JI8C 1WF3A 5FLXD 4KTVA 4X64C 3RG2A 2E8EA 4JI6C 4DV7C 4B3RC 4ISBA 1M6XA 4L7IA 4K0KC 1HNXC 1ULTA 3RV2A 3DAYA 1MDFA 5LMNC 2P2QA 2YX1A 2PN2A 4DV2C 1XRAA 3CW9A 1XNQC 4AQYC 1PG4A 4RM3A 3TUFA 5BR8C 4DV1C 5BSWA 5E7QA 4D56A 1PU1A 4D4IA 3J81D 3OTOC 4B3TC 5LCIA 2D1QA 1V25A 3CQ2A 1MKYA 4JYAC 4DR7C 2OBVA 1P7LA 4PUHA 4DUZC 1HH2P 3LNOA 3LNVA 1VLAA 1RY2A 4BCAA 2VZEA 1UKKA 3CQ3A 3JAMD 1N32C 5A1IA 4HPVA 3ETOA 4PUGA 1EGAA 1V60A 1O93A 4JI3C 4I9FA 1UWDA 1QWIA 5K8FA 2CY1A 2P2FA 4DCTA 4R1LA 5IT9D 3GPCA 4DV0C 3NYRA 4IR7A 3T1HC 3I07A 3DLPX 2JMPA 3VNQA 2D1TA 4RM2A 3PESA 4DCSA 2P2MA 4B3MC 3AF5A 3N2QA 4DG8A 2E8FA 5BURA 4DR6C 4NXMC 4IZ6A 3A26A 4NXNC 3VNRA 2UU9C 5K85A 2UXCC 5ADZA 4R0MA 4B3SC 3G7SA 1FLOA 3UX2A 1J5EC 3CJEA 1MXCA 3UEBA 2Y27A 5H9UA 2OO4A 1M6XC 4OXIA 3GR0A 2M5OA 2D28C 1LCIA 3LUSA 4YHHC 3E7WA 1XRCA 4U5YD 4JI1C 1O90A 3UX3A 4FUTA 1NY8A 3IMLA 4GS5A 1XMQC 3TQIA 4DV6C 4ZLPA 5AE1A 1HR0C 4GXQA 2HHHC 2MM9A 1P4EC 3A9UA 2UUCC 4LFBC 1JOSA 1GPMA 4DCUA 2VQFC 1YJ7A 2QVXX 3VNSA 4D4GA 2PROA 5BSVA 3B7WA 1KKGA 4PROC 2E8CA 2ATWA 3FCCA 4RMNA 3T1YC 1PA4A 2YWBA 3NPDA 4D57A 4JI2C 2UXBC 2P2BA 4R1MA 5BSUA 1WH9A 4ZJZA 3CW8X 3H2TA 4LF8C 2KZFA 3UOWA 4L4QA 4DR4C 2WD9A 5JRHA 2ZM6C 4KTTA 3A25A 2Y4NA 2KZ0A 5BSRA 1HNZC 1BA3A 4X66C 2XR1A 2ZZMA 4JM1A 2YWCA 2E0GA 3EQ6A 3E7XA 1QM4A 2Y4OA 3C5EA 4LF4C 2DPLA 5CZXA 3FCEA 4JI4C 3A4IA 4L2ZA 3J80D 2VSQA 4DG9A 4LE5A 1I94C 4GKJC 2M5HA 2UUAC 1XS3A 2QL8A 1MXAA 4G1IA 3A9VA 1V26A 1N33C 1IBMC 1RG9A 2ZZNA 2MCQA 1O92A 3DHVA 4DUYC 4OX9C 1FUGA 4DV3C 2DHMA 2UXDC 1LQLA 3R9XA 5GTDA 1XRBA 5CZVA 3KXWA 1IBLC 1MD9A 5IWAC 4EATA 3NYQA 4PHTA 3IEUA 4LF9C 1TH5A 2KDNA 4JV5C 4DCVA 3IPLA 2QVYX 5A2QD 4DV4C 4NOZA 2P20A 1ML8A 4MH4A 2D27A 4JI7C 2ASBA 1VEHA 4NDNA 2F4VC 1MDBA 5A19A 4LF5C 4YY3C 3LGXA 5KEIA 5T8TA 4TPSB 1N2FA 3LAXA 1N34C 3UZ0A 3IEVA 2QW0X 3CQ1A 4X62C 2P02A 3SO4A 1FJGC 4DR2C 4ODJA 4BBYA 4BSZA 2NCLA 1T5DX 4K0BA 2VQEC 1USPA 4GXRA 3TDEA 4RLQA 3R9WA 4WS9A 3S82A
chains in the Genus database with same CATH topology
1TH5A 1UWDA 3CQ3A 2M5OA 3LNOA 1WCJA 2M5HA 2Z51A 3CQ2A 2JNVA 3UX3A 2CU6A 3UX2A 1XHJA 1VEHA 3CQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TH5 A;  1UWD A;  3CQ3 A;  2M5O A;  3LNO A;  1WCJ A;  2M5H A;  2Z51 A;  3CQ2 A;  2JNV A;  3UX3 A;  2CU6 A;  3UX2 A;  1XHJ A;  1VEH A;  3CQ1 A; 
#chains in the Genus database with same CATH topology
 4X65 C;  3GKU A;  4FTF A;  2OPL A;  5AE2 A;  1USP B;  5BST A;  2D7V A;  4OYC A;  4RVO A;  4RLF A;  4BC9 A;  5DV9 A;  5A1G A;  4JI5 C;  1IB8 A;  1P4E A;  1MXB A;  3AY0 A;  1ZB8 A;  4DR3 C;  1PG3 A;  2BH1 X;  4JI0 C;  2OPL B;  2E5L C;  5KYV A;  3AF6 A;  4G36 A;  3PRO C;  4PZP A;  1HNW C;  5AE3 A;  2QVZ X;  3O2E A;  1IBK C;  4BC7 A;  3PBK A;  2CXC A;  3R44 A;  1T5H X;  4XX2 A;  4LF6 C;  1NYE A;  1WCJ A;  3ETC A;  3GR1 A;  5BUS A;  1XMO C;  3TR3 A;  4KHP C;  2JNV A;  3K6R A;  4DV5 C;  2WP0 C;  3L95 X;  4G37 A;  4DR1 C;  4WV3 A;  2MMA B;  1O9T A;  4LFA C;  4GKK C;  1N36 C;  4LF7 C;  3N54 B;  3NI2 A;  1XHJ A;  2EGT A;  1ZB9 A;  3L8C A;  1XNR C;  2Z51 A;  1L2F A;  5BUQ A;  4FUQ A;  2D1S A;  2UUB C;  4PUI A;  4MTN A;  5KYT A;  2BJO A;  2HJG A;  2CU6 A;  2PT7 G;  5T8S A;  2D1R A;  2V7B A;  2AYA A;  2YCB A;  5BSM A;  1K0R A;  3EER A;  3I08 A;  5IFI A;  1AMU A;  4I9G A;  2P2J A;  2ONF A;  4LFC C;  5LMU C;  2E7G A;  2DYJ A;  4RVN A;  4DR5 C;  4JI8 C;  1WF3 A;  5FLX D;  4KTV A;  4X64 C;  3RG2 A;  2E8E A;  4JI6 C;  4DV7 C;  4B3R C;  4ISB A;  1M6X A;  4L7I A;  4K0K C;  1HNX C;  1ULT A;  3RV2 A;  3DAY A;  1MDF A;  5LMN C;  2P2Q A;  2YX1 A;  2PN2 A;  4DV2 C;  1XRA A;  3CW9 A;  1XNQ C;  4AQY C;  1PG4 A;  4RM3 A;  3TUF A;  5BR8 C;  4DV1 C;  5BSW A;  5E7Q A;  4D56 A;  1PU1 A;  4D4I A;  3J81 D;  3OTO C;  4B3T C;  5LCI A;  2D1Q A;  1V25 A;  3CQ2 A;  1MKY A;  4JYA C;  4DR7 C;  2OBV A;  1P7L A;  4PUH A;  4DUZ C;  1HH2 P;  3LNO A;  3LNV A;  1VLA A;  1RY2 A;  4BCA A;  2VZE A;  1UKK A;  3CQ3 A;  3JAM D;  1N32 C;  5A1I A;  4HPV A;  3ETO A;  4PUG A;  1EGA A;  1V60 A;  1O93 A;  4JI3 C;  4I9F A;  1UWD A;  1QWI A;  5K8F A;  2CY1 A;  2P2F A;  4DCT A;  4R1L A;  5IT9 D;  3GPC A;  4DV0 C;  3NYR A;  4IR7 A;  3T1H C;  3I07 A;  3DLP X;  2JMP A;  3VNQ A;  2D1T A;  4RM2 A;  3PES A;  4DCS A;  2P2M A;  4B3M C;  3AF5 A;  3N2Q A;  4DG8 A;  2E8F A;  5BUR A;  4DR6 C;  4NXM C;  4IZ6 A;  3A26 A;  4NXN C;  3VNR A;  2UU9 C;  5K85 A;  2UXC C;  5ADZ A;  4R0M A;  4B3S C;  3G7S A;  1FLO A;  3UX2 A;  1J5E C;  3CJE A;  1MXC A;  3UEB A;  2Y27 A;  5H9U A;  2OO4 A;  1M6X C;  4OXI A;  3GR0 A;  2M5O A;  2D28 C;  1LCI A;  3LUS A;  4YHH C;  3E7W A;  1XRC A;  4U5Y D;  4JI1 C;  1O90 A;  3UX3 A;  4FUT A;  1NY8 A;  3IML A;  4GS5 A;  1XMQ C;  3TQI A;  4DV6 C;  4ZLP A;  5AE1 A;  1HR0 C;  4GXQ A;  2HHH C;  2MM9 A;  1P4E C;  3A9U A;  2UUC C;  4LFB C;  1JOS A;  1GPM A;  4DCU A;  2VQF C;  1YJ7 A;  2QVX X;  3VNS A;  4D4G A;  2PRO A;  5BSV A;  3B7W A;  1KKG A;  4PRO C;  2E8C A;  2ATW A;  3FCC A;  4RMN A;  3T1Y C;  1PA4 A;  2YWB A;  3NPD A;  4D57 A;  4JI2 C;  2UXB C;  2P2B A;  4R1M A;  5BSU A;  1WH9 A;  4ZJZ A;  3CW8 X;  3H2T A;  4LF8 C;  2KZF A;  3UOW A;  4L4Q A;  4DR4 C;  2WD9 A;  5JRH A;  2ZM6 C;  4KTT A;  3A25 A;  2Y4N A;  2KZ0 A;  5BSR A;  1HNZ C;  1BA3 A;  4X66 C;  2XR1 A;  2ZZM A;  4JM1 A;  2YWC A;  2E0G A;  3EQ6 A;  3E7X A;  1QM4 A;  2Y4O A;  3C5E A;  4LF4 C;  2DPL A;  5CZX A;  3FCE A;  4JI4 C;  3A4I A;  4L2Z A;  3J80 D;  2VSQ A;  4DG9 A;  4LE5 A;  1I94 C;  4GKJ C;  2M5H A;  2UUA C;  1XS3 A;  2QL8 A;  1MXA A;  4G1I A;  3A9V A;  1V26 A;  1N33 C;  1IBM C;  1RG9 A;  2ZZN A;  2MCQ A;  1O92 A;  3DHV A;  4DUY C;  4OX9 C;  1FUG A;  4DV3 C;  2DHM A;  2UXD C;  1LQL A;  3R9X A;  5GTD A;  1XRB A;  5CZV A;  3KXW A;  1IBL C;  1MD9 A;  5IWA C;  4EAT A;  3NYQ A;  4PHT A;  3IEU A;  4LF9 C;  1TH5 A;  2KDN A;  4JV5 C;  4DCV A;  3IPL A;  2QVY X;  5A2Q D;  4DV4 C;  4NOZ A;  2P20 A;  1ML8 A;  4MH4 A;  2D27 A;  4JI7 C;  2ASB A;  1VEH A;  4NDN A;  2F4V C;  1MDB A;  5A19 A;  4LF5 C;  4YY3 C;  3LGX A;  5KEI A;  5T8T A;  4TPS B;  1N2F A;  3LAX A;  1N34 C;  3UZ0 A;  3IEV A;  2QW0 X;  3CQ1 A;  4X62 C;  2P02 A;  3SO4 A;  1FJG C;  4DR2 C;  4ODJ A;  4BBY A;  4BSZ A;  2NCL A;  1T5D X;  4K0B A;  2VQE C;  1USP A;  4GXR A;  3TDE A;  4RLQ A;  3R9W A;  4WS9 A;  3S82 A; 
#chains in the Genus database with same CATH homology
 1TH5 A;  1UWD A;  3CQ3 A;  2M5O A;  3LNO A;  1WCJ A;  2M5H A;  2Z51 A;  3CQ2 A;  2JNV A;  3UX3 A;  2CU6 A;  3UX2 A;  1XHJ A;  1VEH A;  3CQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...