2BJOA

Crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
ALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bacillus Subtilis Ohrb Hydroperoxide-Resistance Protein in a Fully Oxidized State.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
total genus 34
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2bjoA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bjoA02
2UXDC 2UUCC 3M4OI 4DR2C 1TWAI 2J6AA 3VMHA 1EGAA 1UKKA 2ASBA 2YU9I 4NB9A 1N2FA 1VLAA 3GKQA 1X3ZA 2NVYI 3U50C 4A93I 1QYPA 2JMPA 4GKKC 1HH2P 2E5LC 3VMIA 1IBMC 4X62C 1R9TI 2XR1A 3GTJI 1NYEA 4LFAC 4Y52I 1WCMI 4NBAA 4NOZA 3S2DI 3GTPI 4LFBC 3HOXI 5C4XI 3I4NI 3AF5A 4LFCC 3OTOC 1RLYA 4DCUA 3HOVI 2JA8I 3I07A 5IP7I 2UUAC 1X3WA 1L1OC 2JS4A 1MKYA 2P3YA 5C3EI 3I4MI 3EERA 2OPLB 4BY7I 3HOWI 2E2II 1TWGI 2E8EA 2E2HI 2E8CA 4LF7C 2UXBC 3GTGI 1I94C 2VQEC 1N34C 4BXXI 4GKJC 4DUYC 3S16I 4B3RC 4MH4A 4NBGA 4BSZA 3JAMD 3R9WA 2RBLA 1FJGC 4Y7NI 4BBRI 3J80D 2B63I 4NB8A 2NVQI 5BR8C 5LMUC 2QL8A 4JI2C 1TWHI 2E2JI 1WF3A 2EGTA 2NVTI 4B3TC 3GTMI 1ZB8A 3IEUA 2HF1A 1XMOC 2BJOA 4DCVA 3VMGA 3ESWA 3HOYI 2D7VA 2PT7G 4X65C 4DV7C 2DYJA 4DV6C 2F4OA 3FKII 4A3KI 4X66C 4DV4C 1HNZC 4B3SC 4LF8C 5C4JI 3M3YI 2R7ZI 3J81D 4JI6C 3Q87A 4BY1I 5FLXD 3S1RI 3LUSA 4NBCA 1YUAA 2JA7I 2YCBA 1N33C 3S1MI 4DV5C 3GTLI 5IT9D 5CM2M 2ATWA 2NVXI 4DR5C 2UUBC 4A3JI 2ZM6C 3K7AI 3D6WA 1K0RA 4JI0C 1N32C 3S1QI 1PA4A 1TFIA 4A3FI 2PN2A 2JR6A 4KHPC 3GTKI 1NUIA 4JI3C 4DV3C 1USPB 3VB9A 3S15I 3S2HI 2R92I 4X6AI 1TWFI 3CQZI 1L2FA 2OPLA 1IBKC 3IEVA 4BBSI 4DV0C 3PO3S 4LF4C 3GTOI 4A3DI 4MTNA 1DL6A 5C44I 3PO3I 1Y1VS 1Y1VI 2E7GA 3GTMS 4QTUA 2K5RA 4QTTA 4A3GI 2JA6I 2HJGA 3AF6A 4YY3C 1USPA 3RZOI 3CJEA 4DUZC 4DR7C 2DE5A 3RZDI 2R93I 4JV5C 1IBLC 2E8FA 4DCTA 4DR4C 2HHHC 3S17I 4YHHC 4DR1C 4LF6C 3GTQI 4NBFA 3T1YC 4JI4C 1XMQC 2JA5I 1HR0C 4B3MC 4JI7C 3PO2I 4JYAC 2CY1A 5IP9I 2VQFC 1N36C 1RO4A 4OX9C 4DR6C 2KZFA 1WH9A 2UU9C 3S14I 4DV2C 4A3MI 4K0KC 3HOUI 4DCSA 3S1NI 4NBDA 4LF9C 1KKGA 2DE6A 5A2QD 1K83I 1XNQC 4NBEA 1I3QI 1LQLA 2ONFA 4JI1C 4A3EI 1HNWC 1QWIA 4NBHA 4A3CI 1JOSA 2PK7A 1J5EC 4LF5C 2CXCA 2F4MA 1I50I 2KPIA 3H0GI 5FLMI 4JI8C 1ML8A 4A3LI 1HNXC 4JI5C 3GKUA 4A3II 3H3VJ 2JNYA 1SFOI 3HOZI 4X64C 1XNRC 3T1HC 2DE7A 4DV1C 2AKLA 4NXNC 1Y1WI 2UXCC 1PFTA 3GCFA 1WW9A 4NXMC 2F4VC 4NBBA 1I6HI 4AQYC 3R9XA 5IWAC 4DR3C 2VUMI 1ZB9A 4XX2A 4A3BI 1TWCI 5LMNC
chains in the Genus database with same CATH superfamily
2UXDC 2KI7B 5BUQA 3DLPX 3G71Z 4E2ZA 1EGAA 1KC81 3LGXA 2YU9I 5K85A 3PESA 3NFZA 2QRDB 2NVYI 4GKKC 1HH2P 4R1MA 1IBMC 2MMAB 3IR7A 1R9TI 2D1RA 2OTJZ 2IV2X 2M48A 4NBAA 4NOZA 3BG0B 3GTPI 1KC82 5C4XI 3P5JB 5IT9b 2NAPA 3I07A 3CW8X 4RVDA 2JS4A 5A19A 2P3YA 5FLXb 3EERA 4BY7I 2K3RA 2E2II 5T8SA 2HU9A 3TE5B 2E2HI 2QR1B 2E8CA 2P2QA 1VQLZ 2VPXA 2M5HA 4RLFA 2Y4OA 3S16I 4D56A 4DG9A 4MH4A 4NBGA 5GTDA 4GS5A 1AMUA 1K9M2 2RBLA 4MD8A 1FJGC 2ZZNA 2NVQI 3CCR1 1AA6A 2ZZMA 4NDNA 5ADZA 4OYCA 3NH5A 1M6XC 4NH1C 1VQL1 1K9M1 3S82A 3T4NB 2RPRA 3VMGA 5KEIA 2E0GA 5T6BA 4K0KC 4LF8C 1XNRC 2IZ3A 2VPZA 5C4JI 5DV9A 2AYDA 4BY1I 4NBCA 2YCBA 1Q7Y1 3S1MI 3DAYA 1XHJA 4DK1A 5IT9D 2V45A 2PMZA 5CM2M 2NVXI 1MDFA 3LNOA 4DR5C 1VQPZ 4JI0C 1T5DX 4PUGA 2PN2A 3A25A 3EQ6A 1M1K1 4KHPC 3I551 4JI8C 2OTL1 3S15I 1Q822 1IBKC 1TWFI 1YUKA 4HPVA 1RNIA 3PO3S 1K8A2 3A26A 4QTUA 2K5RA 4QTTA 2QKDA 2JA6I 5IT9f 2HJGA 4DR7C 1USPA 3D9XA 4DUZC 4RM3A 4JV5C 1M901 1S7MA 4K0BA 4DCTA 4DR4C 1VQ7Z 3J80f 3NDIA 1K8A1 2OOXB 1VQP1 3NI2A 1PG3A 4LF6C 2GU2A 1XRAA 2JA5I 1FUGA 1YJ9Z 1HR0C 4B3MC 4OX9C 1M902 1WH9A 3DHVA 1RY2A 3KIFA 2JMOA 5A2QD 3CPWZ 2WB1A 1I3QI 4RMNA 3I08A 2QA41 1HNWC 1PU1A 1J5EC 2PK7A 2KPIA 3CCV1 3F3FC 1WZNA 1HNXC 3UOWA 4RV9A 1YJWZ 2JIOA 1FDOA 2DE7A 2QEX1 2AKLA 2M6NA 1XRCA 4ISBA 1QXFA 3L95X 4DR3C 1ZB9A 1JJ2Y 4A3BI 1TWCI 5T64A 1JWHC 3TR3A 2UUCC 4DR2C 4DG8A 1TWAI 3VMHA 1VQ71 3HKZA 3J7A4 3CCU1 1X3ZA 1XRBA 1QYPA 1MXCA 3L8CA 3VMIA 1LCIA 5BSRA 4X62C 1IB8A 5AN9F 4IZ6A 3GTJI 1NYEA 4E2XA 2P02A 4LFBC 4HGYA 1Y8CA 3CQ2A 2PM9A 2H85A 5T67A 3I55Z 2W03A 1V26A 2V8JA 1N8R2 3TDHB 5IP7I 2OOYB 2UUAC 1MKYA 4X64C 2QW0X 2JIMA 3I4MI 1VQ61 1YI21 3HOWI 3IF8A 2E8EA 1Q862 1JJ2Z 4LF7C 2UXBC 2VPYA 1QVFZ 4PZPA 2Y4NA 4GKJC 4DUYC 3NYQA 5AE1A 1YJW1 3JAMD 3TQIA 2OO4A 3CCSZ 2JIPA 4GXRA 2EGTA 1WF3A 1VEHA 5JRHA 1NJI2 1KQSZ 5K8FA 1VQMZ 1X0TA 1YI2Z 3ESWA 4DV7C 4ZLPA 2F4OA 3FKII 4FUQA 4X66C 1P4EC 3M3YI 3E7XA 2IZ4A 5FLXD 1NJI1 5KYVA 2DHMA 3J80b 3AY0A 2P2FA 1O9TA 3EEDA 1MXBA 4E2YA 3K7AI 2R6MA 3D6WA 1PA4A 2JR6A 1NUIA 4X6AI 5AE3A 5BSTA 3D2LA 2R92I 2UXCC 3G7SA 3IEVA 2Z51A 3RG2A 1KQSY 4WS9A 4LF4C 3GTOI 4A3DI 4I9GA 4MTNA 5C44I 3PO3I 1Y1VS 1Y1VI 4TPSB 2V3VA 1VQ91 4L4QA 4YY3C 3CJEA 3RZOI 2R93I 5E7QA 5CZVA 4RVOA 4RLQA 1YIJZ 4HGZA 2YWBA 4G36A 4EWCA 2P28A 3GTQI 4R1LA 3CCQZ 3T1YC 4CL1A 4JI4C 3PO2I 3UX3A 3CCL1 1MDBA 2VQFC 3QWUA 2D1SA 2YADA 4DV2C 4NBDA 4PUIA 4LF9C 2DE6A 1RO2A 3MZLB 4D4GA 1LQLA 4JI1C 1V25A 4A3EI 1Z03A 1YHQ1 2VSQA 1QWIA 4LF5C 2E9HA 4A3CI 1RO0A 2F4MA 1I50I 3UEBA 4L7IA 5BSMA 2JNYA 3CC41 4S1TA 3VNSA 4BCAA 2G2KA 1W2BZ 4EATA 4JM1A 4MD9A 3CCQ1 4NBBA 2VUMI 3UX2A 3PROC 5LMNC 2VUGA 4KTVA 2RT9A 3M4OI 1UKKA 2ASBA 3CCUZ 1KD12 2JIQA 3IX0A 4NB9A 1VLAA 1VQ5Z 3GR1A 3IFUA 3SO4A 2D1QA 1VQ9Z 1ULTA 3CCMZ 4ODJA 4LFAC 3CCE1 3JAMf 1WCMI 3CMEZ 1KD11 2O53A 3HOXI 3I4NI 2P2BA 3AF5A 2P20A 4D4IA 4LFCC 3OTOC 4DQYB 1RLYA 4BC7A 4DCUA 3HOVI 5D1OB 2QVYX 4AYBA 3F3PC 3J81b 2MM9A 1I94C 1N34C 2OBVA 2OTLZ 1VQ51 1Q16A 1KRLA 3CC71 1YJNZ 3CC21 4IR7A 2YWCA 3NPDA 3ETCA 1VQO1 3IPLA 4Y7NI 4BBRI 3H2TA 2OZKA 2B63I 4NB8A 5BR8C 4MONA 1VQM1 4JI2C 1TWHI 4B3TC 4G1IA 3GTMI 1M6XA 4RM2A 4WV3A 3CCJZ 3IEUA 2HF1A 1Q7Y2 3CQ3A 1XMOC 2Y27A 3VNQA 4I9FA 3N54B 1K732 4DCVA 2QREB 4X65C 3ETOA 4PHTA 3CPWY 3TDEA 4B3SC 3NH8A 3G6EZ 2VF1A 2DYJA 3A4IA 1HNZC 1VQ4Z 5H9UA 1YIT1 3S1RI 3LUSA 3O2EA 1YUAA 1YHQZ 2KZ0A 1Q821 4DV5C 1Z02A 1K731 4U5YD 3IMLA 3JAMb 4A3JI 3MZKB 1K0RA 1WJ2A 1VQOZ 1N32C 3S1QI 5D1PA 1FLOA 1TFIA 4A3FI 4E31A 2Y0SA 2LIYA 3GTKI 5BURA 4GXQA 1P7LA 2OPLA 3CQ1A 1L2FA 1RQFA 4PUHA 3J81f 2D27A 5A2Qf 2P2JA 1GPMA 4DV0C 3FCEA 2RIQA 2VPWA 3GTMS 1VQ8Z 1YIJ1 4RVGA 4A3GI 1RG9A 3KXWA 5BSUA 1SIWA 1M1K2 4MXUA 4FTFA 2DE5A 2RHBA 2E8FA 3I561 4MRIA 3KIHA 1VQ41 3LNVA 2HHHC 3S17I 2QVXX 5CZXA 4DR1C 4KTTA 1VQN1 2CY1A 5IP9I 3A9VA 4ZJZA 4E30A 1N36C 1P9NA 1T5HX 3S14I 2QEXZ 4A3MI 1TH5A 3FCCA 3G6E1 2CU6A 1KKGA 1K83I 3CCVZ 1P4EA 5BSVA 1XNQC 1BA3A 1S72Z 2ONFA 3CC2Z 2WAQA 2Q4ZA 4BC9A 2CXCA 3H0GI 3CCS1 4A3LI 3CC4Z 5LL6f 3CCRZ 4JI5C 3H3VJ 3HOZI 3TUFA 2QRCB 2DPLA 2I3CA 4DV1C 5A2Qb 3GCFA 1WW9A 1QVGZ 3B7WA 2F4VC 1VQNZ 1I6HI 2WD9A 3R9XA 4OXIA 4XX2A 1USPB 5A1IA 3CD6Z 3OW2Y 2J6AA 3CMA1 1NY8A 5T8TA 2JUBA 4L2ZA 2NCLA 5A1GA 2QVZX 3NDJA 1N2FA 3MONA 3GKQA 3CCLZ 4A93I 3U50C 3E7WA 2JMPA 4PROC 1N33C 1N8R1 1VQ81 4TNUA 2E5LC 1PG4A 4RS4A 1MXAA 3CCM1 1O93A 2OTJ1 2XR1A 4Y52I 2YX1A 3S2DI 4E2WA 4E32A 5BUSA 3CMAZ 2JA8I 3GR0A 1X3WA 1L1OC 3NH4A 5C3EI 2D1TA 2OPLB 4DGLA 2JNVA 1TWGI 4E33A 2GTHA 3GTGI 2VQEC 3N2QA 4BXXI 1QM4A 2Q51A 1W2BY 4B3RC 3CXCZ 4BSZA 2D28C 4G37A 2O4HA 5IFIA 3R9WA 4MD7A 3C5EA 3J80D 4FUTA 1Q861 4R0MA 5LMUC 3K6RA 2QL8A 2E2JI 2NVTI 3CCJ1 5BSWA 3LAXA 1ZB8A 2PROA 1QVGY 2BJOA 1VQKZ 3HOYI 1O92A 2D7VA 2PT7G 3BG1B 4BBYA 4DV6C 1VQK1 2QLVB 4A3KI 4DV4C 3J81D 4JI6C 2R7ZI 1ZH1A 3OW2Z 1V60A 3Q87A 3UZ0A 2M5OA 2JA7I 2WP0C 4RVFA 3CC7Z 1YJN1 1QVFY 1YJ7A 3CW9A 1Q812 2QA4Z 3GTLI 2ATWA 2UUBC 2ZM6C 4LE5A 1O90A 3I56Z 4JI3C 1WIIA 4DV3C 3VB9A 1Q811 3S2HI 3A9UA 4JI7C 4RVHA 3CQZI 3CCEZ 3CD61 3CME1 1QF8A 5D1OA 3FQMA 4BBSI 1MD9A 2BH1X 1DL6A 2E7GA 2W04A 3AF6A 2JIRA 3RZDI 2LFUA 1IBLC 5FLXf 3VNRA 2ZAEB 3G711 3CXCY 2E7ZA 4YHHC 2V8IA 2KDNA 4NFRA 3R44A 4NBFA 2V7BA 1XMQC 4JYAC 3NYRA 4DR6C 2LEXA 1Z01A 1RO4A 4RVNA 2KZFA 1NP6A 2UU9C 1S721 3VTNA 1XS3A 3HOUI 4DCSA 3G4SZ 3S1NI 3RV2A 2V8KA 4NBEA 3FQQA 3PBKA 5AE2A 4NBHA 1JOSA 1YITZ 1FDIA 1YJ91 5FLMI 1ML8A 2VZEA 5LCIA 1WCJA 4A3II 3GKUA 1SFOI 2MCQA 3G4S1 4D57A 1UWDA 2AYAA 3T1HC 5KYTA 3GPCA 4NXNC 1Y1WI 1PFTA 4HH4A 4NXMC 2P2MA 4AQYC 5IWAC 2GTIA 1VQ6Z
chains in the Genus database with same CATH topology
2UXDC 2KI7B 5BUQA 3DLPX 3G71Z 4E2ZA 1EGAA 1KC81 3LGXA 2YU9I 5K85A 3PESA 3NFZA 2QRDB 2NVYI 4GKKC 1HH2P 4R1MA 1IBMC 1R9TI 2D1RA 2OTJZ 2M48A 4NBAA 4NOZA 3BG0B 3GTPI 1KC82 5C4XI 3P5JB 5IT9b 3I07A 3CW8X 4RVDA 2JS4A 5A19A 2P3YA 5FLXb 3EERA 4BY7I 2K3RA 2E2II 5T8SA 2HU9A 3TE5B 2E2HI 2QR1B 2E8CA 2P2QA 1VQLZ 4RLFA 2Y4OA 3S16I 4D56A 4DG9A 4MH4A 4NBGA 5GTDA 4GS5A 1AMUA 1K9M2 2RBLA 4MD8A 1FJGC 2NVQI 3CCR1 4NDNA 5ADZA 4OYCA 3NH5A 4NH1C 1VQL1 1K9M1 3S82A 3T4NB 2RPRA 3VMGA 5KEIA 2E0GA 5T6BA 4K0KC 4LF8C 1XNRC 2IZ3A 5C4JI 5DV9A 4BY1I 4NBCA 2YCBA 1Q7Y1 3S1MI 3DAYA 4DK1A 5IT9D 5CM2M 2PMZA 2NVXI 1MDFA 4DR5C 1VQPZ 4JI0C 1T5DX 2PN2A 3EQ6A 1M1K1 4KHPC 3I551 4JI8C 2OTL1 3S15I 1Q822 1IBKC 1TWFI 1YUKA 4HPVA 1RNIA 3PO3S 1K8A2 4QTUA 2K5RA 4QTTA 2QKDA 2JA6I 5IT9f 2HJGA 4DR7C 1USPA 3D9XA 4DUZC 4RM3A 4JV5C 1M901 1S7MA 4K0BA 4DCTA 4DR4C 1VQ7Z 3J80f 3NDIA 1K8A1 2OOXB 1VQP1 3NI2A 1PG3A 4LF6C 2GU2A 1XRAA 2JA5I 1FUGA 1YJ9Z 1HR0C 4B3MC 4OX9C 1M902 1WH9A 3DHVA 1RY2A 3KIFA 2JMOA 5A2QD 3CPWZ 2WB1A 1I3QI 4RMNA 3I08A 2QA41 1HNWC 1J5EC 2PK7A 2KPIA 3CCV1 3F3FC 1HNXC 3UOWA 4RV9A 1YJWZ 2DE7A 2QEX1 2AKLA 2M6NA 1XRCA 4ISBA 3L95X 4DR3C 1ZB9A 1JJ2Y 4A3BI 1TWCI 5T64A 1JWHC 2UUCC 4DR2C 4DG8A 1TWAI 3VMHA 1VQ71 3HKZA 3J7A4 3CCU1 1X3ZA 1XRBA 1QYPA 1MXCA 3L8CA 3VMIA 1LCIA 5BSRA 4X62C 5AN9F 4IZ6A 3GTJI 1NYEA 4E2XA 2P02A 4LFBC 4HGYA 2PM9A 2H85A 5T67A 3I55Z 2W03A 1V26A 2V8JA 1N8R2 3TDHB 5IP7I 2OOYB 2UUAC 1MKYA 4X64C 2QW0X 3I4MI 1VQ61 1YI21 3HOWI 3IF8A 2E8EA 1Q862 1JJ2Z 4LF7C 2UXBC 1QVFZ 4PZPA 2Y4NA 4GKJC 4DUYC 3NYQA 5AE1A 1YJW1 3JAMD 3TQIA 2OO4A 3CCSZ 4GXRA 2EGTA 1WF3A 5JRHA 1NJI2 1KQSZ 5K8FA 1VQMZ 1X0TA 1YI2Z 3ESWA 4DV7C 4ZLPA 2F4OA 3FKII 4FUQA 4X66C 3M3YI 3E7XA 2IZ4A 5FLXD 1NJI1 5KYVA 3J80b 2P2FA 1O9TA 3EEDA 1MXBA 4E2YA 3K7AI 2R6MA 3D6WA 1PA4A 2JR6A 1NUIA 4X6AI 5AE3A 5BSTA 2R92I 2UXCC 3G7SA 3IEVA 3RG2A 1KQSY 4WS9A 4LF4C 3GTOI 4A3DI 4I9GA 4MTNA 5C44I 3PO3I 1Y1VS 1Y1VI 4TPSB 1VQ91 4L4QA 4YY3C 3CJEA 3RZOI 2R93I 5E7QA 5CZVA 4RVOA 4RLQA 1YIJZ 4HGZA 2YWBA 4G36A 4EWCA 2P28A 3GTQI 4R1LA 3CCQZ 3T1YC 4CL1A 4JI4C 3PO2I 3CCL1 1MDBA 2VQFC 3QWUA 2D1SA 2YADA 4DV2C 4NBDA 4LF9C 2DE6A 1RO2A 3MZLB 4D4GA 1LQLA 4JI1C 1V25A 4A3EI 1Z03A 1YHQ1 2VSQA 1QWIA 4LF5C 2E9HA 4A3CI 1RO0A 2F4MA 1I50I 4L7IA 5BSMA 2JNYA 3CC41 4S1TA 3VNSA 4BCAA 2G2KA 1W2BZ 4EATA 4JM1A 4MD9A 3CCQ1 4NBBA 2VUMI 3PROC 5LMNC 2VUGA 4KTVA 2RT9A 3M4OI 1UKKA 2ASBA 3CCUZ 1KD12 4NB9A 3IX0A 1VLAA 1VQ5Z 3GR1A 3IFUA 3SO4A 2D1QA 1VQ9Z 1ULTA 3CCMZ 4ODJA 4LFAC 3CCE1 3JAMf 1WCMI 3CMEZ 1KD11 2O53A 3HOXI 3I4NI 2P2BA 3AF5A 2P20A 4D4IA 4LFCC 3OTOC 4DQYB 1RLYA 4BC7A 4DCUA 3HOVI 5D1OB 2QVYX 4AYBA 3F3PC 3J81b 1I94C 1N34C 2OBVA 2OTLZ 1VQ51 1KRLA 3CC71 1YJNZ 3CC21 4IR7A 2YWCA 3NPDA 3ETCA 1VQO1 3IPLA 4Y7NI 4BBRI 3H2TA 2OZKA 2B63I 4NB8A 5BR8C 4MONA 1VQM1 4JI2C 1TWHI 4B3TC 4G1IA 3GTMI 4RM2A 4WV3A 3CCJZ 3IEUA 2HF1A 1Q7Y2 1XMOC 2Y27A 3VNQA 4I9FA 3N54B 1K732 4DCVA 2QREB 4X65C 3ETOA 4PHTA 3CPWY 3TDEA 4B3SC 3NH8A 3G6EZ 2VF1A 2DYJA 3A4IA 1HNZC 1VQ4Z 5H9UA 1YIT1 3S1RI 3LUSA 1YUAA 1YHQZ 1Q821 4DV5C 1Z02A 1K731 4U5YD 3IMLA 3JAMb 4A3JI 3MZKB 1K0RA 1VQOZ 1N32C 3S1QI 5D1PA 1TFIA 4A3FI 4E31A 2Y0SA 2LIYA 3GTKI 5BURA 4GXQA 1P7LA 2OPLA 1L2FA 1RQFA 3J81f 2D27A 5A2Qf 2P2JA 1GPMA 4DV0C 3FCEA 2RIQA 3GTMS 1VQ8Z 1YIJ1 4RVGA 4A3GI 1RG9A 3KXWA 5BSUA 1M1K2 4MXUA 4FTFA 2DE5A 2RHBA 2E8FA 3I561 4MRIA 3KIHA 1VQ41 3LNVA 2HHHC 3S17I 2QVXX 5CZXA 4DR1C 4KTTA 1VQN1 2CY1A 5IP9I 3A9VA 4ZJZA 4E30A 1N36C 1P9NA 1T5HX 3S14I 2QEXZ 4A3MI 3FCCA 3G6E1 1KKGA 1K83I 3CCVZ 1XNQC 5BSVA 1BA3A 1S72Z 2ONFA 3CC2Z 2WAQA 2Q4ZA 4BC9A 2CXCA 3H0GI 3CCS1 4A3LI 3CC4Z 5LL6f 3CCRZ 4JI5C 3H3VJ 3HOZI 3TUFA 2QRCB 2DPLA 2I3CA 4DV1C 5A2Qb 3GCFA 1WW9A 1QVGZ 3B7WA 2F4VC 1VQNZ 1I6HI 2WD9A 3R9XA 4OXIA 4XX2A 1USPB 5A1IA 3CD6Z 3OW2Y 2J6AA 3CMA1 5T8TA 2JUBA 4L2ZA 5A1GA 2QVZX 3NDJA 1N2FA 3MONA 3GKQA 3CCLZ 4A93I 3U50C 3E7WA 2JMPA 4PROC 1N33C 1N8R1 1VQ81 4TNUA 2E5LC 1PG4A 4RS4A 1MXAA 3CCM1 1O93A 2OTJ1 2XR1A 4Y52I 3S2DI 4E2WA 4E32A 5BUSA 3CMAZ 2JA8I 3GR0A 1X3WA 1L1OC 3NH4A 5C3EI 2D1TA 2OPLB 4DGLA 1TWGI 4E33A 2GTHA 3GTGI 2VQEC 3N2QA 4BXXI 1QM4A 2Q51A 1W2BY 4B3RC 3CXCZ 4BSZA 2D28C 4G37A 2O4HA 5IFIA 3R9WA 4MD7A 3C5EA 3J80D 4FUTA 1Q861 4R0MA 5LMUC 2QL8A 2E2JI 2NVTI 3CCJ1 5BSWA 3LAXA 1ZB8A 2PROA 1QVGY 2BJOA 1VQKZ 3HOYI 1O92A 2D7VA 2PT7G 3BG1B 4BBYA 4DV6C 1VQK1 2QLVB 4A3KI 4DV4C 3J81D 4JI6C 2R7ZI 1ZH1A 3OW2Z 3Q87A 3UZ0A 2JA7I 2WP0C 4RVFA 3CC7Z 1YJN1 1QVFY 1YJ7A 3CW9A 1Q812 2QA4Z 3GTLI 2ATWA 2UUBC 2ZM6C 4LE5A 1O90A 3I56Z 4JI3C 1WIIA 4DV3C 3VB9A 1Q811 3S2HI 3A9UA 4JI7C 4RVHA 3CQZI 3CCEZ 3CD61 3CME1 1QF8A 5D1OA 3FQMA 4BBSI 1MD9A 2BH1X 1DL6A 2E7GA 2W04A 3AF6A 3RZDI 2LFUA 1IBLC 5FLXf 3VNRA 2ZAEB 3G711 3CXCY 4YHHC 2V8IA 4NFRA 3R44A 4NBFA 2V7BA 1XMQC 4JYAC 3NYRA 4DR6C 4RVNA 1Z01A 1RO4A 2KZFA 1NP6A 2UU9C 1S721 3VTNA 3HOUI 4DCSA 3G4SZ 3S1NI 3RV2A 2V8KA 4NBEA 3FQQA 3PBKA 5AE2A 4NBHA 1JOSA 1YITZ 1YJ91 5FLMI 1ML8A 2VZEA 3GKUA 4A3II 1SFOI 3G4S1 4D57A 2AYAA 3T1HC 5KYTA 3GPCA 4NXNC 1Y1WI 1PFTA 4HH4A 4NXMC 2P2MA 4AQYC 5IWAC 2GTIA 1VQ6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD C;  2UUC C;  3M4O I;  4DR2 C;  1TWA I;  2J6A A;  3VMH A;  1EGA A;  1UKK A;  2ASB A;  2YU9 I;  4NB9 A;  1N2F A;  1VLA A;  3GKQ A;  1X3Z A;  2NVY I;  3U50 C;  4A93 I;  1QYP A;  2JMP A;  4GKK C;  1HH2 P;  2E5L C;  3VMI A;  1IBM C;  4X62 C;  1R9T I;  2XR1 A;  3GTJ I;  1NYE A;  4LFA C;  4Y52 I;  1WCM I;  4NBA A;  4NOZ A;  3S2D I;  3GTP I;  4LFB C;  3HOX I;  5C4X I;  3I4N I;  3AF5 A;  4LFC C;  3OTO C;  1RLY A;  4DCU A;  3HOV I;  2JA8 I;  3I07 A;  5IP7 I;  2UUA C;  1X3W A;  1L1O C;  2JS4 A;  1MKY A;  2P3Y A;  5C3E I;  3I4M I;  3EER A;  2OPL B;  4BY7 I;  3HOW I;  2E2I I;  1TWG I;  2E8E A;  2E2H I;  2E8C A;  4LF7 C;  2UXB C;  3GTG I;  1I94 C;  2VQE C;  1N34 C;  4BXX I;  4GKJ C;  4DUY C;  3S16 I;  4B3R C;  4MH4 A;  4NBG A;  4BSZ A;  3JAM D;  3R9W A;  2RBL A;  1FJG C;  4Y7N I;  4BBR I;  3J80 D;  2B63 I;  4NB8 A;  2NVQ I;  5BR8 C;  5LMU C;  2QL8 A;  4JI2 C;  1TWH I;  2E2J I;  1WF3 A;  2EGT A;  2NVT I;  4B3T C;  3GTM I;  1ZB8 A;  3IEU A;  2HF1 A;  1XMO C;  2BJO A;  4DCV A;  3VMG A;  3ESW A;  3HOY I;  2D7V A;  2PT7 G;  4X65 C;  4DV7 C;  2DYJ A;  4DV6 C;  2F4O A;  3FKI I;  4A3K I;  4X66 C;  4DV4 C;  1HNZ C;  4B3S C;  4LF8 C;  5C4J I;  3M3Y I;  2R7Z I;  3J81 D;  4JI6 C;  3Q87 A;  4BY1 I;  5FLX D;  3S1R I;  3LUS A;  4NBC A;  1YUA A;  2JA7 I;  2YCB A;  1N33 C;  3S1M I;  4DV5 C;  3GTL I;  5IT9 D;  5CM2 M;  2ATW A;  2NVX I;  4DR5 C;  2UUB C;  4A3J I;  2ZM6 C;  3K7A I;  3D6W A;  1K0R A;  4JI0 C;  1N32 C;  3S1Q I;  1PA4 A;  1TFI A;  4A3F I;  2PN2 A;  2JR6 A;  4KHP C;  3GTK I;  1NUI A;  4JI3 C;  4DV3 C;  1USP B;  3VB9 A;  3S15 I;  3S2H I;  2R92 I;  4X6A I;  1TWF I;  3CQZ I;  1L2F A;  2OPL A;  1IBK C;  3IEV A;  4BBS I;  4DV0 C;  3PO3 S;  4LF4 C;  3GTO I;  4A3D I;  4MTN A;  1DL6 A;  5C44 I;  3PO3 I;  1Y1V S;  1Y1V I;  2E7G A;  3GTM S;  4QTU A;  2K5R A;  4QTT A;  4A3G I;  2JA6 I;  2HJG A;  3AF6 A;  4YY3 C;  1USP A;  3RZO I;  3CJE A;  4DUZ C;  4DR7 C;  2DE5 A;  3RZD I;  2R93 I;  4JV5 C;  1IBL C;  2E8F A;  4DCT A;  4DR4 C;  2HHH C;  3S17 I;  4YHH C;  4DR1 C;  4LF6 C;  3GTQ I;  4NBF A;  3T1Y C;  4JI4 C;  1XMQ C;  2JA5 I;  1HR0 C;  4B3M C;  4JI7 C;  3PO2 I;  4JYA C;  2CY1 A;  5IP9 I;  2VQF C;  1N36 C;  1RO4 A;  4OX9 C;  4DR6 C;  2KZF A;  1WH9 A;  2UU9 C;  3S14 I;  4DV2 C;  4A3M I;  4K0K C;  3HOU I;  4DCS A;  3S1N I;  4NBD A;  4LF9 C;  1KKG A;  2DE6 A;  5A2Q D;  1K83 I;  1XNQ C;  4NBE A;  1I3Q I;  1LQL A;  2ONF A;  4JI1 C;  4A3E I;  1HNW C;  1QWI A;  4NBH A;  4A3C I;  1JOS A;  2PK7 A;  1J5E C;  4LF5 C;  2CXC A;  2F4M A;  1I50 I;  2KPI A;  3H0G I;  5FLM I;  4JI8 C;  1ML8 A;  4A3L I;  1HNX C;  4JI5 C;  3GKU A;  4A3I I;  3H3V J;  2JNY A;  1SFO I;  3HOZ I;  4X64 C;  1XNR C;  3T1H C;  2DE7 A;  4DV1 C;  2AKL A;  4NXN C;  1Y1W I;  2UXC C;  1PFT A;  3GCF A;  1WW9 A;  4NXM C;  2F4V C;  4NBB A;  1I6H I;  4AQY C;  3R9X A;  5IWA C;  4DR3 C;  2VUM I;  1ZB9 A;  4XX2 A;  4A3B I;  1TWC I;  5LMN C; 
#chains in the Genus database with same CATH topology
 2UXD C;  2KI7 B;  5BUQ A;  3DLP X;  3G71 Z;  4E2Z A;  1EGA A;  1KC8 1;  3LGX A;  2YU9 I;  5K85 A;  3PES A;  3NFZ A;  2QRD B;  2NVY I;  4GKK C;  1HH2 P;  4R1M A;  1IBM C;  2MMA B;  3IR7 A;  1R9T I;  2D1R A;  2OTJ Z;  2IV2 X;  2M48 A;  4NBA A;  4NOZ A;  3BG0 B;  3GTP I;  1KC8 2;  5C4X I;  3P5J B;  5IT9 b;  2NAP A;  3I07 A;  3CW8 X;  4RVD A;  2JS4 A;  5A19 A;  2P3Y A;  5FLX b;  3EER A;  4BY7 I;  2K3R A;  2E2I I;  5T8S A;  2HU9 A;  3TE5 B;  2E2H I;  2QR1 B;  2E8C A;  2P2Q A;  1VQL Z;  2VPX A;  2M5H A;  4RLF A;  2Y4O A;  3S16 I;  4D56 A;  4DG9 A;  4MH4 A;  4NBG A;  5GTD A;  4GS5 A;  1AMU A;  1K9M 2;  2RBL A;  4MD8 A;  1FJG C;  2ZZN A;  2NVQ I;  3CCR 1;  1AA6 A;  2ZZM A;  4NDN A;  5ADZ A;  4OYC A;  3NH5 A;  1M6X C;  4NH1 C;  1VQL 1;  1K9M 1;  3S82 A;  3T4N B;  2RPR A;  3VMG A;  5KEI A;  2E0G A;  5T6B A;  4K0K C;  4LF8 C;  1XNR C;  2IZ3 A;  2VPZ A;  5C4J I;  5DV9 A;  2AYD A;  4BY1 I;  4NBC A;  2YCB A;  1Q7Y 1;  3S1M I;  3DAY A;  1XHJ A;  4DK1 A;  5IT9 D;  2V45 A;  2PMZ A;  5CM2 M;  2NVX I;  1MDF A;  3LNO A;  4DR5 C;  1VQP Z;  4JI0 C;  1T5D X;  4PUG A;  2PN2 A;  3A25 A;  3EQ6 A;  1M1K 1;  4KHP C;  3I55 1;  4JI8 C;  2OTL 1;  3S15 I;  1Q82 2;  1IBK C;  1TWF I;  1YUK A;  4HPV A;  1RNI A;  3PO3 S;  1K8A 2;  3A26 A;  4QTU A;  2K5R A;  4QTT A;  2QKD A;  2JA6 I;  5IT9 f;  2HJG A;  4DR7 C;  1USP A;  3D9X A;  4DUZ C;  4RM3 A;  4JV5 C;  1M90 1;  1S7M A;  4K0B A;  4DCT A;  4DR4 C;  1VQ7 Z;  3J80 f;  3NDI A;  1K8A 1;  2OOX B;  1VQP 1;  3NI2 A;  1PG3 A;  4LF6 C;  2GU2 A;  1XRA A;  2JA5 I;  1FUG A;  1YJ9 Z;  1HR0 C;  4B3M C;  4OX9 C;  1M90 2;  1WH9 A;  3DHV A;  1RY2 A;  3KIF A;  2JMO A;  5A2Q D;  3CPW Z;  2WB1 A;  1I3Q I;  4RMN A;  3I08 A;  2QA4 1;  1HNW C;  1PU1 A;  1J5E C;  2PK7 A;  2KPI A;  3CCV 1;  3F3F C;  1WZN A;  1HNX C;  3UOW A;  4RV9 A;  1YJW Z;  2JIO A;  1FDO A;  2DE7 A;  2QEX 1;  2AKL A;  2M6N A;  1XRC A;  4ISB A;  1QXF A;  3L95 X;  4DR3 C;  1ZB9 A;  1JJ2 Y;  4A3B I;  1TWC I;  5T64 A;  1JWH C;  3TR3 A;  2UUC C;  4DR2 C;  4DG8 A;  1TWA I;  3VMH A;  1VQ7 1;  3HKZ A;  3J7A 4;  3CCU 1;  1X3Z A;  1XRB A;  1QYP A;  1MXC A;  3L8C A;  3VMI A;  1LCI A;  5BSR A;  4X62 C;  1IB8 A;  5AN9 F;  4IZ6 A;  3GTJ I;  1NYE A;  4E2X A;  2P02 A;  4LFB C;  4HGY A;  1Y8C A;  3CQ2 A;  2PM9 A;  2H85 A;  5T67 A;  3I55 Z;  2W03 A;  1V26 A;  2V8J A;  1N8R 2;  3TDH B;  5IP7 I;  2OOY B;  2UUA C;  1MKY A;  4X64 C;  2QW0 X;  2JIM A;  3I4M I;  1VQ6 1;  1YI2 1;  3HOW I;  3IF8 A;  2E8E A;  1Q86 2;  1JJ2 Z;  4LF7 C;  2UXB C;  2VPY A;  1QVF Z;  4PZP A;  2Y4N A;  4GKJ C;  4DUY C;  3NYQ A;  5AE1 A;  1YJW 1;  3JAM D;  3TQI A;  2OO4 A;  3CCS Z;  2JIP A;  4GXR A;  2EGT A;  1WF3 A;  1VEH A;  5JRH A;  1NJI 2;  1KQS Z;  5K8F A;  1VQM Z;  1X0T A;  1YI2 Z;  3ESW A;  4DV7 C;  4ZLP A;  2F4O A;  3FKI I;  4FUQ A;  4X66 C;  1P4E C;  3M3Y I;  3E7X A;  2IZ4 A;  5FLX D;  1NJI 1;  5KYV A;  2DHM A;  3J80 b;  3AY0 A;  2P2F A;  1O9T A;  3EED A;  1MXB A;  4E2Y A;  3K7A I;  2R6M A;  3D6W A;  1PA4 A;  2JR6 A;  1NUI A;  4X6A I;  5AE3 A;  5BST A;  3D2L A;  2R92 I;  2UXC C;  3G7S A;  3IEV A;  2Z51 A;  3RG2 A;  1KQS Y;  4WS9 A;  4LF4 C;  3GTO I;  4A3D I;  4I9G A;  4MTN A;  5C44 I;  3PO3 I;  1Y1V S;  1Y1V I;  4TPS B;  2V3V A;  1VQ9 1;  4L4Q A;  4YY3 C;  3CJE A;  3RZO I;  2R93 I;  5E7Q A;  5CZV A;  4RVO A;  4RLQ A;  1YIJ Z;  4HGZ A;  2YWB A;  4G36 A;  4EWC A;  2P28 A;  3GTQ I;  4R1L A;  3CCQ Z;  3T1Y C;  4CL1 A;  4JI4 C;  3PO2 I;  3UX3 A;  3CCL 1;  1MDB A;  2VQF C;  3QWU A;  2D1S A;  2YAD A;  4DV2 C;  4NBD A;  4PUI A;  4LF9 C;  2DE6 A;  1RO2 A;  3MZL B;  4D4G A;  1LQL A;  4JI1 C;  1V25 A;  4A3E I;  1Z03 A;  1YHQ 1;  2VSQ A;  1QWI A;  4LF5 C;  2E9H A;  4A3C I;  1RO0 A;  2F4M A;  1I50 I;  3UEB A;  4L7I A;  5BSM A;  2JNY A;  3CC4 1;  4S1T A;  3VNS A;  4BCA A;  2G2K A;  1W2B Z;  4EAT A;  4JM1 A;  4MD9 A;  3CCQ 1;  4NBB A;  2VUM I;  3UX2 A;  3PRO C;  5LMN C;  2VUG A;  4KTV A;  2RT9 A;  3M4O I;  1UKK A;  2ASB A;  3CCU Z;  1KD1 2;  2JIQ A;  3IX0 A;  4NB9 A;  1VLA A;  1VQ5 Z;  3GR1 A;  3IFU A;  3SO4 A;  2D1Q A;  1VQ9 Z;  1ULT A;  3CCM Z;  4ODJ A;  4LFA C;  3CCE 1;  3JAM f;  1WCM I;  3CME Z;  1KD1 1;  2O53 A;  3HOX I;  3I4N I;  2P2B A;  3AF5 A;  2P20 A;  4D4I A;  4LFC C;  3OTO C;  4DQY B;  1RLY A;  4BC7 A;  4DCU A;  3HOV I;  5D1O B;  2QVY X;  4AYB A;  3F3P C;  3J81 b;  2MM9 A;  1I94 C;  1N34 C;  2OBV A;  2OTL Z;  1VQ5 1;  1Q16 A;  1KRL A;  3CC7 1;  1YJN Z;  3CC2 1;  4IR7 A;  2YWC A;  3NPD A;  3ETC A;  1VQO 1;  3IPL A;  4Y7N I;  4BBR I;  3H2T A;  2OZK A;  2B63 I;  4NB8 A;  5BR8 C;  4MON A;  1VQM 1;  4JI2 C;  1TWH I;  4B3T C;  4G1I A;  3GTM I;  1M6X A;  4RM2 A;  4WV3 A;  3CCJ Z;  3IEU A;  2HF1 A;  1Q7Y 2;  3CQ3 A;  1XMO C;  2Y27 A;  3VNQ A;  4I9F A;  3N54 B;  1K73 2;  4DCV A;  2QRE B;  4X65 C;  3ETO A;  4PHT A;  3CPW Y;  3TDE A;  4B3S C;  3NH8 A;  3G6E Z;  2VF1 A;  2DYJ A;  3A4I A;  1HNZ C;  1VQ4 Z;  5H9U A;  1YIT 1;  3S1R I;  3LUS A;  3O2E A;  1YUA A;  1YHQ Z;  2KZ0 A;  1Q82 1;  4DV5 C;  1Z02 A;  1K73 1;  4U5Y D;  3IML A;  3JAM b;  4A3J I;  3MZK B;  1K0R A;  1WJ2 A;  1VQO Z;  1N32 C;  3S1Q I;  5D1P A;  1FLO A;  1TFI A;  4A3F I;  4E31 A;  2Y0S A;  2LIY A;  3GTK I;  5BUR A;  4GXQ A;  1P7L A;  2OPL A;  3CQ1 A;  1L2F A;  1RQF A;  4PUH A;  3J81 f;  2D27 A;  5A2Q f;  2P2J A;  1GPM A;  4DV0 C;  3FCE A;  2RIQ A;  2VPW A;  3GTM S;  1VQ8 Z;  1YIJ 1;  4RVG A;  4A3G I;  1RG9 A;  3KXW A;  5BSU A;  1SIW A;  1M1K 2;  4MXU A;  4FTF A;  2DE5 A;  2RHB A;  2E8F A;  3I56 1;  4MRI A;  3KIH A;  1VQ4 1;  3LNV A;  2HHH C;  3S17 I;  2QVX X;  5CZX A;  4DR1 C;  4KTT A;  1VQN 1;  2CY1 A;  5IP9 I;  3A9V A;  4ZJZ A;  4E30 A;  1N36 C;  1P9N A;  1T5H X;  3S14 I;  2QEX Z;  4A3M I;  1TH5 A;  3FCC A;  3G6E 1;  2CU6 A;  1KKG A;  1K83 I;  3CCV Z;  1P4E A;  5BSV A;  1XNQ C;  1BA3 A;  1S72 Z;  2ONF A;  3CC2 Z;  2WAQ A;  2Q4Z A;  4BC9 A;  2CXC A;  3H0G I;  3CCS 1;  4A3L I;  3CC4 Z;  5LL6 f;  3CCR Z;  4JI5 C;  3H3V J;  3HOZ I;  3TUF A;  2QRC B;  2DPL A;  2I3C A;  4DV1 C;  5A2Q b;  3GCF A;  1WW9 A;  1QVG Z;  3B7W A;  2F4V C;  1VQN Z;  1I6H I;  2WD9 A;  3R9X A;  4OXI A;  4XX2 A;  1USP B;  5A1I A;  3CD6 Z;  3OW2 Y;  2J6A A;  3CMA 1;  1NY8 A;  5T8T A;  2JUB A;  4L2Z A;  2NCL A;  5A1G A;  2QVZ X;  3NDJ A;  1N2F A;  3MON A;  3GKQ A;  3CCL Z;  4A93 I;  3U50 C;  3E7W A;  2JMP A;  4PRO C;  1N33 C;  1N8R 1;  1VQ8 1;  4TNU A;  2E5L C;  1PG4 A;  4RS4 A;  1MXA A;  3CCM 1;  1O93 A;  2OTJ 1;  2XR1 A;  4Y52 I;  2YX1 A;  3S2D I;  4E2W A;  4E32 A;  5BUS A;  3CMA Z;  2JA8 I;  3GR0 A;  1X3W A;  1L1O C;  3NH4 A;  5C3E I;  2D1T A;  2OPL B;  4DGL A;  2JNV A;  1TWG I;  4E33 A;  2GTH A;  3GTG I;  2VQE C;  3N2Q A;  4BXX I;  1QM4 A;  2Q51 A;  1W2B Y;  4B3R C;  3CXC Z;  4BSZ A;  2D28 C;  4G37 A;  2O4H A;  5IFI A;  3R9W A;  4MD7 A;  3C5E A;  3J80 D;  4FUT A;  1Q86 1;  4R0M A;  5LMU C;  3K6R A;  2QL8 A;  2E2J I;  2NVT I;  3CCJ 1;  5BSW A;  3LAX A;  1ZB8 A;  2PRO A;  1QVG Y;  2BJO A;  1VQK Z;  3HOY I;  1O92 A;  2D7V A;  2PT7 G;  3BG1 B;  4BBY A;  4DV6 C;  1VQK 1;  2QLV B;  4A3K I;  4DV4 C;  3J81 D;  4JI6 C;  2R7Z I;  1ZH1 A;  3OW2 Z;  1V60 A;  3Q87 A;  3UZ0 A;  2M5O A;  2JA7 I;  2WP0 C;  4RVF A;  3CC7 Z;  1YJN 1;  1QVF Y;  1YJ7 A;  3CW9 A;  1Q81 2;  2QA4 Z;  3GTL I;  2ATW A;  2UUB C;  2ZM6 C;  4LE5 A;  1O90 A;  3I56 Z;  4JI3 C;  1WII A;  4DV3 C;  3VB9 A;  1Q81 1;  3S2H I;  3A9U A;  4JI7 C;  4RVH A;  3CQZ I;  3CCE Z;  3CD6 1;  3CME 1;  1QF8 A;  5D1O A;  3FQM A;  4BBS I;  1MD9 A;  2BH1 X;  1DL6 A;  2E7G A;  2W04 A;  3AF6 A;  2JIR A;  3RZD I;  2LFU A;  1IBL C;  5FLX f;  3VNR A;  2ZAE B;  3G71 1;  3CXC Y;  2E7Z A;  4YHH C;  2V8I A;  2KDN A;  4NFR A;  3R44 A;  4NBF A;  2V7B A;  1XMQ C;  4JYA C;  3NYR A;  4DR6 C;  2LEX A;  1Z01 A;  1RO4 A;  4RVN A;  2KZF A;  1NP6 A;  2UU9 C;  1S72 1;  3VTN A;  1XS3 A;  3HOU I;  4DCS A;  3G4S Z;  3S1N I;  3RV2 A;  2V8K A;  4NBE A;  3FQQ A;  3PBK A;  5AE2 A;  4NBH A;  1JOS A;  1YIT Z;  1FDI A;  1YJ9 1;  5FLM I;  1ML8 A;  2VZE A;  5LCI A;  1WCJ A;  4A3I I;  3GKU A;  1SFO I;  2MCQ A;  3G4S 1;  4D57 A;  1UWD A;  2AYA A;  3T1H C;  5KYT A;  3GPC A;  4NXN C;  1Y1W I;  1PFT A;  4HH4 A;  4NXM C;  2P2M A;  4AQY C;  5IWA C;  2GTI A;  1VQ6 Z; 
#chains in the Genus database with same CATH homology
 2UXD C;  2KI7 B;  5BUQ A;  3DLP X;  3G71 Z;  4E2Z A;  1EGA A;  1KC8 1;  3LGX A;  2YU9 I;  5K85 A;  3PES A;  3NFZ A;  2QRD B;  2NVY I;  4GKK C;  1HH2 P;  4R1M A;  1IBM C;  1R9T I;  2D1R A;  2OTJ Z;  2M48 A;  4NBA A;  4NOZ A;  3BG0 B;  3GTP I;  1KC8 2;  5C4X I;  3P5J B;  5IT9 b;  3I07 A;  3CW8 X;  4RVD A;  2JS4 A;  5A19 A;  2P3Y A;  5FLX b;  3EER A;  4BY7 I;  2K3R A;  2E2I I;  5T8S A;  2HU9 A;  3TE5 B;  2E2H I;  2QR1 B;  2E8C A;  2P2Q A;  1VQL Z;  4RLF A;  2Y4O A;  3S16 I;  4D56 A;  4DG9 A;  4MH4 A;  4NBG A;  5GTD A;  4GS5 A;  1AMU A;  1K9M 2;  2RBL A;  4MD8 A;  1FJG C;  2NVQ I;  3CCR 1;  4NDN A;  5ADZ A;  4OYC A;  3NH5 A;  4NH1 C;  1VQL 1;  1K9M 1;  3S82 A;  3T4N B;  2RPR A;  3VMG A;  5KEI A;  2E0G A;  5T6B A;  4K0K C;  4LF8 C;  1XNR C;  2IZ3 A;  5C4J I;  5DV9 A;  4BY1 I;  4NBC A;  2YCB A;  1Q7Y 1;  3S1M I;  3DAY A;  4DK1 A;  5IT9 D;  5CM2 M;  2PMZ A;  2NVX I;  1MDF A;  4DR5 C;  1VQP Z;  4JI0 C;  1T5D X;  2PN2 A;  3EQ6 A;  1M1K 1;  4KHP C;  3I55 1;  4JI8 C;  2OTL 1;  3S15 I;  1Q82 2;  1IBK C;  1TWF I;  1YUK A;  4HPV A;  1RNI A;  3PO3 S;  1K8A 2;  4QTU A;  2K5R A;  4QTT A;  2QKD A;  2JA6 I;  5IT9 f;  2HJG A;  4DR7 C;  1USP A;  3D9X A;  4DUZ C;  4RM3 A;  4JV5 C;  1M90 1;  1S7M A;  4K0B A;  4DCT A;  4DR4 C;  1VQ7 Z;  3J80 f;  3NDI A;  1K8A 1;  2OOX B;  1VQP 1;  3NI2 A;  1PG3 A;  4LF6 C;  2GU2 A;  1XRA A;  2JA5 I;  1FUG A;  1YJ9 Z;  1HR0 C;  4B3M C;  4OX9 C;  1M90 2;  1WH9 A;  3DHV A;  1RY2 A;  3KIF A;  2JMO A;  5A2Q D;  3CPW Z;  2WB1 A;  1I3Q I;  4RMN A;  3I08 A;  2QA4 1;  1HNW C;  1J5E C;  2PK7 A;  2KPI A;  3CCV 1;  3F3F C;  1HNX C;  3UOW A;  4RV9 A;  1YJW Z;  2DE7 A;  2QEX 1;  2AKL A;  2M6N A;  1XRC A;  4ISB A;  3L95 X;  4DR3 C;  1ZB9 A;  1JJ2 Y;  4A3B I;  1TWC I;  5T64 A;  1JWH C;  2UUC C;  4DR2 C;  4DG8 A;  1TWA I;  3VMH A;  1VQ7 1;  3HKZ A;  3J7A 4;  3CCU 1;  1X3Z A;  1XRB A;  1QYP A;  1MXC A;  3L8C A;  3VMI A;  1LCI A;  5BSR A;  4X62 C;  5AN9 F;  4IZ6 A;  3GTJ I;  1NYE A;  4E2X A;  2P02 A;  4LFB C;  4HGY A;  2PM9 A;  2H85 A;  5T67 A;  3I55 Z;  2W03 A;  1V26 A;  2V8J A;  1N8R 2;  3TDH B;  5IP7 I;  2OOY B;  2UUA C;  1MKY A;  4X64 C;  2QW0 X;  3I4M I;  1VQ6 1;  1YI2 1;  3HOW I;  3IF8 A;  2E8E A;  1Q86 2;  1JJ2 Z;  4LF7 C;  2UXB C;  1QVF Z;  4PZP A;  2Y4N A;  4GKJ C;  4DUY C;  3NYQ A;  5AE1 A;  1YJW 1;  3JAM D;  3TQI A;  2OO4 A;  3CCS Z;  4GXR A;  2EGT A;  1WF3 A;  5JRH A;  1NJI 2;  1KQS Z;  5K8F A;  1VQM Z;  1X0T A;  1YI2 Z;  3ESW A;  4DV7 C;  4ZLP A;  2F4O A;  3FKI I;  4FUQ A;  4X66 C;  3M3Y I;  3E7X A;  2IZ4 A;  5FLX D;  1NJI 1;  5KYV A;  3J80 b;  2P2F A;  1O9T A;  3EED A;  1MXB A;  4E2Y A;  3K7A I;  2R6M A;  3D6W A;  1PA4 A;  2JR6 A;  1NUI A;  4X6A I;  5AE3 A;  5BST A;  2R92 I;  2UXC C;  3G7S A;  3IEV A;  3RG2 A;  1KQS Y;  4WS9 A;  4LF4 C;  3GTO I;  4A3D I;  4I9G A;  4MTN A;  5C44 I;  3PO3 I;  1Y1V S;  1Y1V I;  4TPS B;  1VQ9 1;  4L4Q A;  4YY3 C;  3CJE A;  3RZO I;  2R93 I;  5E7Q A;  5CZV A;  4RVO A;  4RLQ A;  1YIJ Z;  4HGZ A;  2YWB A;  4G36 A;  4EWC A;  2P28 A;  3GTQ I;  4R1L A;  3CCQ Z;  3T1Y C;  4CL1 A;  4JI4 C;  3PO2 I;  3CCL 1;  1MDB A;  2VQF C;  3QWU A;  2D1S A;  2YAD A;  4DV2 C;  4NBD A;  4LF9 C;  2DE6 A;  1RO2 A;  3MZL B;  4D4G A;  1LQL A;  4JI1 C;  1V25 A;  4A3E I;  1Z03 A;  1YHQ 1;  2VSQ A;  1QWI A;  4LF5 C;  2E9H A;  4A3C I;  1RO0 A;  2F4M A;  1I50 I;  4L7I A;  5BSM A;  2JNY A;  3CC4 1;  4S1T A;  3VNS A;  4BCA A;  2G2K A;  1W2B Z;  4EAT A;  4JM1 A;  4MD9 A;  3CCQ 1;  4NBB A;  2VUM I;  3PRO C;  5LMN C;  2VUG A;  4KTV A;  2RT9 A;  3M4O I;  1UKK A;  2ASB A;  3CCU Z;  1KD1 2;  4NB9 A;  3IX0 A;  1VLA A;  1VQ5 Z;  3GR1 A;  3IFU A;  3SO4 A;  2D1Q A;  1VQ9 Z;  1ULT A;  3CCM Z;  4ODJ A;  4LFA C;  3CCE 1;  3JAM f;  1WCM I;  3CME Z;  1KD1 1;  2O53 A;  3HOX I;  3I4N I;  2P2B A;  3AF5 A;  2P20 A;  4D4I A;  4LFC C;  3OTO C;  4DQY B;  1RLY A;  4BC7 A;  4DCU A;  3HOV I;  5D1O B;  2QVY X;  4AYB A;  3F3P C;  3J81 b;  1I94 C;  1N34 C;  2OBV A;  2OTL Z;  1VQ5 1;  1KRL A;  3CC7 1;  1YJN Z;  3CC2 1;  4IR7 A;  2YWC A;  3NPD A;  3ETC A;  1VQO 1;  3IPL A;  4Y7N I;  4BBR I;  3H2T A;  2OZK A;  2B63 I;  4NB8 A;  5BR8 C;  4MON A;  1VQM 1;  4JI2 C;  1TWH I;  4B3T C;  4G1I A;  3GTM I;  4RM2 A;  4WV3 A;  3CCJ Z;  3IEU A;  2HF1 A;  1Q7Y 2;  1XMO C;  2Y27 A;  3VNQ A;  4I9F A;  3N54 B;  1K73 2;  4DCV A;  2QRE B;  4X65 C;  3ETO A;  4PHT A;  3CPW Y;  3TDE A;  4B3S C;  3NH8 A;  3G6E Z;  2VF1 A;  2DYJ A;  3A4I A;  1HNZ C;  1VQ4 Z;  5H9U A;  1YIT 1;  3S1R I;  3LUS A;  1YUA A;  1YHQ Z;  1Q82 1;  4DV5 C;  1Z02 A;  1K73 1;  4U5Y D;  3IML A;  3JAM b;  4A3J I;  3MZK B;  1K0R A;  1VQO Z;  1N32 C;  3S1Q I;  5D1P A;  1TFI A;  4A3F I;  4E31 A;  2Y0S A;  2LIY A;  3GTK I;  5BUR A;  4GXQ A;  1P7L A;  2OPL A;  1L2F A;  1RQF A;  3J81 f;  2D27 A;  5A2Q f;  2P2J A;  1GPM A;  4DV0 C;  3FCE A;  2RIQ A;  3GTM S;  1VQ8 Z;  1YIJ 1;  4RVG A;  4A3G I;  1RG9 A;  3KXW A;  5BSU A;  1M1K 2;  4MXU A;  4FTF A;  2DE5 A;  2RHB A;  2E8F A;  3I56 1;  4MRI A;  3KIH A;  1VQ4 1;  3LNV A;  2HHH C;  3S17 I;  2QVX X;  5CZX A;  4DR1 C;  4KTT A;  1VQN 1;  2CY1 A;  5IP9 I;  3A9V A;  4ZJZ A;  4E30 A;  1N36 C;  1P9N A;  1T5H X;  3S14 I;  2QEX Z;  4A3M I;  3FCC A;  3G6E 1;  1KKG A;  1K83 I;  3CCV Z;  1XNQ C;  5BSV A;  1BA3 A;  1S72 Z;  2ONF A;  3CC2 Z;  2WAQ A;  2Q4Z A;  4BC9 A;  2CXC A;  3H0G I;  3CCS 1;  4A3L I;  3CC4 Z;  5LL6 f;  3CCR Z;  4JI5 C;  3H3V J;  3HOZ I;  3TUF A;  2QRC B;  2DPL A;  2I3C A;  4DV1 C;  5A2Q b;  3GCF A;  1WW9 A;  1QVG Z;  3B7W A;  2F4V C;  1VQN Z;  1I6H I;  2WD9 A;  3R9X A;  4OXI A;  4XX2 A;  1USP B;  5A1I A;  3CD6 Z;  3OW2 Y;  2J6A A;  3CMA 1;  5T8T A;  2JUB A;  4L2Z A;  5A1G A;  2QVZ X;  3NDJ A;  1N2F A;  3MON A;  3GKQ A;  3CCL Z;  4A93 I;  3U50 C;  3E7W A;  2JMP A;  4PRO C;  1N33 C;  1N8R 1;  1VQ8 1;  4TNU A;  2E5L C;  1PG4 A;  4RS4 A;  1MXA A;  3CCM 1;  1O93 A;  2OTJ 1;  2XR1 A;  4Y52 I;  3S2D I;  4E2W A;  4E32 A;  5BUS A;  3CMA Z;  2JA8 I;  3GR0 A;  1X3W A;  1L1O C;  3NH4 A;  5C3E I;  2D1T A;  2OPL B;  4DGL A;  1TWG I;  4E33 A;  2GTH A;  3GTG I;  2VQE C;  3N2Q A;  4BXX I;  1QM4 A;  2Q51 A;  1W2B Y;  4B3R C;  3CXC Z;  4BSZ A;  2D28 C;  4G37 A;  2O4H A;  5IFI A;  3R9W A;  4MD7 A;  3C5E A;  3J80 D;  4FUT A;  1Q86 1;  4R0M A;  5LMU C;  2QL8 A;  2E2J I;  2NVT I;  3CCJ 1;  5BSW A;  3LAX A;  1ZB8 A;  2PRO A;  1QVG Y;  2BJO A;  1VQK Z;  3HOY I;  1O92 A;  2D7V A;  2PT7 G;  3BG1 B;  4BBY A;  4DV6 C;  1VQK 1;  2QLV B;  4A3K I;  4DV4 C;  3J81 D;  4JI6 C;  2R7Z I;  1ZH1 A;  3OW2 Z;  3Q87 A;  3UZ0 A;  2JA7 I;  2WP0 C;  4RVF A;  3CC7 Z;  1YJN 1;  1QVF Y;  1YJ7 A;  3CW9 A;  1Q81 2;  2QA4 Z;  3GTL I;  2ATW A;  2UUB C;  2ZM6 C;  4LE5 A;  1O90 A;  3I56 Z;  4JI3 C;  1WII A;  4DV3 C;  3VB9 A;  1Q81 1;  3S2H I;  3A9U A;  4JI7 C;  4RVH A;  3CQZ I;  3CCE Z;  3CD6 1;  3CME 1;  1QF8 A;  5D1O A;  3FQM A;  4BBS I;  1MD9 A;  2BH1 X;  1DL6 A;  2E7G A;  2W04 A;  3AF6 A;  3RZD I;  2LFU A;  1IBL C;  5FLX f;  3VNR A;  2ZAE B;  3G71 1;  3CXC Y;  4YHH C;  2V8I A;  4NFR A;  3R44 A;  4NBF A;  2V7B A;  1XMQ C;  4JYA C;  3NYR A;  4DR6 C;  4RVN A;  1Z01 A;  1RO4 A;  2KZF A;  1NP6 A;  2UU9 C;  1S72 1;  3VTN A;  3HOU I;  4DCS A;  3G4S Z;  3S1N I;  3RV2 A;  2V8K A;  4NBE A;  3FQQ A;  3PBK A;  5AE2 A;  4NBH A;  1JOS A;  1YIT Z;  1YJ9 1;  5FLM I;  1ML8 A;  2VZE A;  3GKU A;  4A3I I;  1SFO I;  3G4S 1;  4D57 A;  2AYA A;  3T1H C;  5KYT A;  3GPC A;  4NXN C;  1Y1W I;  1PFT A;  4HH4 A;  4NXM C;  2P2M A;  4AQY C;  5IWA C;  2GTI A;  1VQ6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...