2BJOA

Crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
ALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
publication title Structure of the Bacillus Subtilis Ohrb Hydroperoxide-Resistance Protein in a Fully Oxidized State.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 34
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2bjoA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bjoA02
1X3ZA 1SFOI 2F4OA 4DUYC 3S2HI 4A93I 2F4VC 2DE5A 4GKKC 4BBSI 4QTTA 3GTKI 1I94C 4DV6C 2JA8I 2XR1A 3FKII 3GTPI 3H0GI 4B3SC 4LF7C 4LFBC 3GTOI 5C4JI 5FLXD 4A3CI 2NVQI 1TWHI 4DV3C 2JA7I 4A3KI 2HJGA 1N32C 1XMQC 4DR6C 1VLAA 2ATWA 1XNQC 2OPLB 5C3EI 1I6HI 1ZB8A 1ZB9A 4DR7C 3VMGA 2RBLA 2ZM6C 2HF1A 3S1MI 3M3YI 1K83I 4YY3C 4NXNC 1NYEA 1IBMC 3I4NI 4X66C 1TWCI 2JMPA 1XNRC 3S16I 4BY7I 4DCTA 5IP7I 2JS4A 4A3MI 2PN2A 2P3YA 4GKJC 3S15I 1ML8A 3Q87A 4QTUA 4BXXI 4DUZC 1TWGI 4DV0C 4DR3C 2E2JI 1IBKC 1XMOC 2JNYA 4X62C 2DE6A 2J6AA 2VQEC 3RZDI 3PO2I 2OPLA 3AF5A 1K0RA 2HHHC 3CJEA 4BBRI 3EERA 4JI6C 4NBEA 3PO3S 3HOUI 1L1OC 1PFTA 3D6WA 3GTJI 3HOYI 1NUIA 4BY1I 3HOZI 4DCSA 3K7AI 2DE7A 3ESWA 4NB8A 2UUCC 3JAMD 4JI8C 4JI2C 1HH2P 2UXCC 4LF8C 4XX2A 1LQLA 4A3II 1WH9A 4LF6C 5IP9I 4OX9C 5A2QD 5IWAC 5CM2M 4DV4C 3T1YC 1QYPA 2K5RA 4DR1C 1TFIA 4A3DI 2R93I 2YCBA 2VUMI 1WW9A 2UU9C 4NXMC 1Y1VS 1I50I 1RO4A 1WCMI 3GCFA 2E8EA 3CQZI 4DR2C 2NVTI 2JA5I 4NB9A 2NVYI 3PO3I 2CY1A 4Y52I 2EGTA 4YHHC 3S2DI 1HNWC 4AQYC 1N33C 5C44I 3S14I 4NBHA 1IBLC 4JI7C 3VMHA 4B3RC 4JV5C 4A3GI 4DCUA 2UUAC 2BJOA 2UXBC 4KHPC 1TWFI 4X65C 4X64C 1HR0C 3RZOI 1HNZC 4JI0C 3GTQI 4MTNA 2VQFC 3R9XA 3HOVI 2CXCA 3IEUA 2NVXI 1UKKA 4JI5C 2R7ZI 5FLMI 1L2FA 1J5EC 3HOWI 1EGAA 3M4OI 3R9WA 1Y1WI 2E8FA 2ASBA 4LF9C 3J80D 3HOXI 5LMUC 2F4MA 3OTOC 3I07A 1X3WA 4NBCA 5LMNC 5IT9D 3GKQA 2YU9I 2AKLA 4NBAA 3AF6A 4DR4C 4NBDA 3GTMS 3S17I 3H3VJ 4DV5C 2E8CA 3GKUA 1R9TI 2KPIA 2PT7G 4JYAC 2E2II 4DV1C 1WF3A 1USPB 1N2FA 3GTLI 1JOSA 3GTGI 2KZFA 3S1NI 3U50C 4A3JI 1QWIA 4X6AI 4NOZA 2D7VA 1HNXC 1TWAI 2ONFA 4DV2C 4DR5C 1N36C 2E2HI 2E7GA 4BSZA 1RLYA 4NBFA 2R92I 1DL6A 3IEVA 1PA4A 4A3EI 2UUBC 3VMIA 4NBGA 2E5LC 3VB9A 4A3BI 3GTMI 4LF5C 4LF4C 1USPA 1KKGA 3LUSA 1N34C 4K0KC 4JI1C 1FJGC 3T1HC 2JR6A 1Y1VI 5BR8C 1I3QI 3S1RI 3J81D 4A3FI 3I4MI 2JA6I 2B63I 4JI3C 3S1QI 4MH4A 4LFCC 4NBBA 4DCVA 2UXDC 4B3MC 2PK7A 4LFAC 1YUAA 4A3LI 5C4XI 2QL8A 4Y7NI 4DV7C 4B3TC 1MKYA 2DYJA 4JI4C
chains in the Genus database with same CATH superfamily
1X3ZA 1SFOI 3NPDA 1XRBA 2F4OA 4DUYC 3S2HI 4A93I 1KD12 2F4VC 2LIYA 3IF8A 2YWCA 2DE5A 4E2XA 4GKKC 4BBSI 4R1LA 1S72Z 3FQMA 4QTTA 2D27A 3GTKI 5AN9F 1I94C 4G1IA 4DV6C 1QVGZ 1QXFA 2JA8I 1KQSZ 2XR1A 2JIPA 5FLXb 3FKII 3CCE1 3FQQA 4E2ZA 3GTPI 3H0GI 4MD9A 4B3SC 4LF7C 4LFBC 3GTOI 1NP6A 4RVDA 1PG3A 1MDBA 1VQMZ 5C4JI 5FLXD 2VPXA 4A3CI 3CC2Z 2JUBA 3E7WA 5ADZA 3G6EZ 1YJW1 2NVQI 1TWHI 4JM1A 4DV3C 1PU1A 1XS3A 2JA7I 5A1GA 4A3KI 2HJGA 1N32C 1VQ51 1XMQC 4DR6C 1VLAA 1X0TA 3MZKB 1NJI2 4L2ZA 2I3CA 2OBVA 2ATWA 1VQN1 1XNQC 2WP0C 4GXQA 2YADA 2OPLB 5C3EI 3G7SA 1I6HI 2P02A 1KRLA 3CXCY 5T8SA 1ZB8A 4BC9A 4RVFA 1ZB9A 4DR7C 3VMGA 1K8A2 2M5OA 4RVNA 2RBLA 1JJ2Y 2HF1A 2P2FA 3S1MI 2ZM6C 1M1K2 3M3YI 3CCLZ 1K83I 3TDEA 4YY3C 4NXNC 1Q811 5K85A 1M6XA 3NYRA 1NY8A 3TQIA 1NYEA 3CCJ1 3EQ6A 3UZ0A 1IBMC 1T5DX 4ZLPA 3PROC 3I4NI 4X66C 4L4QA 4OXIA 1TWCI 1Q861 2JMPA 2AYAA 4RVGA 4RVHA 3CC71 4E30A 2QEXZ 1XNRC 1Q7Y1 3S16I 2QVZX 1Z03A 4E33A 5BSUA 3VTNA 3CCRZ 4BY7I 4DCTA 5IP7I 2JS4A 3AY0A 1S721 4DQYB 4A3MI 4E31A 2PN2A 2P3YA 4S1TA 1V60A 3S15I 2RHBA 2OO4A 5T8TA 4GKJC 3G4SZ 2HU9A 1ML8A 1Q16A 5AE3A 3Q87A 4QTUA 1RO2A 2GTIA 1YIJ1 4BXXI 3CPWY 1FDIA 3TE5B 1RY2A 4DUZC 1TWGI 4DV0C 2DPLA 2P28A 4TPSB 3E7XA 1VQM1 1MXCA 3H2TA 1XRAA 3I08A 2JIOA 3UX2A 1K732 2Y4OA 4DR3C 4MD8A 2QRCB 2QREB 2RPRA 3CC21 2E2JI 1IBKC 1XMOC 2JNYA 4X62C 2DE6A 1TH5A 4R1MA 4DG8A 3J80f 2J6AA 5AE2A 1KQSY 2Y27A 4PUIA 2VQEC 3NYQA 3NDJA 3RZDI 3PO2I 2OPLA 1K9M1 3AF5A 1K0RA 2HHHC 3CJEA 4BBRI 3EERA 4JI6C 3LGXA 3CQ2A 4NBEA 3A9VA 3PO3S 5BSWA 5IT9f 1L1OC 1PFTA 3HOUI 3GR0A 1Z02A 3D6WA 3S82A 3DHVA 2PM9A 1RO0A 4G37A 3GTJI 1V25A 5H9UA 3G71Z 2OOYB 3HOYI 1QF8A 2BH1X 1MXBA 4DG9A 5BSVA 1NUIA 2QVXX 4BY1I 1LCIA 3O2EA 3CCL1 1VQ41 3CD61 2WB1A 3HOZI 4DCSA 3K7AI 1P9NA 4NDNA 2DE7A 3JAMb 3ESWA 3CMEZ 4NB8A 5BURA 3D2LA 4NFRA 1RQFA 4D57A 4TNUA 4K0BA 1N8R1 5IT9b 2V7BA 5BSTA 4D56A 1Q821 3CCM1 5D1OB 2UUCC 3JAMD 4GS5A 3RV2A 4WS9A 4JI8C 4RV9A 4JI2C 2QA4Z 1HH2P 1YITZ 2UXCC 1W2BZ 2E0GA 4PHTA 5A2Qb 4XX2A 4LF8C 3CCR1 1VQ8Z 1LQLA 1VQ91 1YJ9Z 4WV3A 3VNQA 4A3II 5A1IA 1WH9A 3BG0B 4LF6C 2OTLZ 3G4S1 1SIWA 3KIHA 2V8IA 3MONA 5IP9I 5A2QD 4OX9C 5IWAC 5CM2M 4DV4C 3T1YC 1QYPA 1UWDA 3IFUA 4PROC 2K5RA 3A9UA 4DR1C 4FUTA 1TFIA 4HGZA 4A3DI 1KD11 2R93I 3NFZA 2D28C 2YCBA 2Z51A 2VSQA 2VUMI 1T5HX 3N54B 1YJNZ 5KEIA 5LL6f 1WW9A 2NAPA 2VPWA 3CCV1 1ZH1A 2W03A 2JIMA 4E2YA 1YI2Z 4NXMC 2UU9C 1Y1VS 1I50I 1RO4A 1V26A 1BA3A 2MM9A 3UX3A 1WCMI 3PESA 3IEVA 3GCFA 1WCJA 2QR1B 2E8EA 5BSRA 3CQZI 1P4EC 4DR2C 2NVTI 3OW2Y 2JA5I 4RLFA 3CCQZ 3G711 3D9XA 3I56Z 4NB9A 2RIQA 2NVYI 3PO3I 4L7IA 4MD7A 4I9FA 2CY1A 4Y52I 2EGTA 1Q812 4YHHC 4LE5A 1VQL1 4HH4A 1VQ7Z 3S2DI 2P20A 2VPZA 1HNWC 5D1OA 3IPLA 3IX0A 4AQYC 1N33C 5C44I 3S14I 2ZZNA 3TDHB 1WJ2A 4NBHA 1IBLC 2P2QA 3NH4A 4MONA 2QW0X 4ISBA 1XHJA 2IZ4A 3L95X 1QVFZ 4JI7C 2QA41 1ULTA 3GPCA 3NH5A 1YIT1 4U5YD 3VMHA 4RLQA 3NH8A 4B3RC 1VQKZ 4JV5C 4E2WA 1YJ91 5LCIA 4A3GI 4DCUA 2M6NA 3UEBA 2OTL1 2PROA 3LNOA 1YHQZ 2JIQA 2VUGA 2UUAC 2G2KA 2BJOA 2UXBC 4KHPC 1Y8CA 2QRDB 3J81f 1TWFI 2JMOA 4X65C 1MD9A 3CW9A 3ETCA 3CW8X 4X64C 1GPMA 4I9GA 1HR0C 3RZOI 3G6E1 1HNZC 1M901 4JI0C 1QVGY 4KTVA 3R44A 1JWHC 3GTQI 4MTNA 3RG2A 5KYTA 1YI21 2VQFC 2QKDA 3CCEZ 1KC82 3R9XA 4RM3A 3HOVI 2D1QA 5KYVA 2CXCA 1K731 3I55Z 3IEUA 2NVXI 1FLOA 1UKKA 4JI5C 5CZXA 2R7ZI 3PBKA 3CQ3A 5FLMI 1L2FA 2M5HA 2NCLA 2GU2A 1YJWZ 4MXUA 3J80b 1J5EC 2P2JA 3HOWI 4CL1A 3CCSZ 1EGAA 4HGYA 2O53A 3M4OI 2YX1A 3R9WA 2OOXB 1Y1WI 1XRCA 1VQ5Z 2E8FA 3C5EA 4RMNA 2ASBA 3UOWA 1YUKA 1VQOZ 1VQ71 1Z01A 1VQNZ 4LF9C 3A26A 3J80D 3HOXI 4G36A 5LMUC 2F4MA 1VQPZ 2RT9A 3OTOC 2MCQA 2V45A 3I07A 3KIFA 1X3WA 3IR7A 4MRIA 4E32A 1RG9A 4NBCA 2QEX1 3LNVA 1VEHA 3KXWA 5LMNC 5IT9D 4HPVA 1MXAA 1VQK1 3CC4Z 3GKQA 2YU9I 2AKLA 4NBAA 3A4IA 5FLXf 1MDFA 3VNSA 1YHQ1 3L8CA 2ZZMA 3AF6A 3LAXA 4DR4C 1QVFY 4NBDA 3CPWZ 4IR7A 1QM4A 2OTJZ 2IV2X 3CCUZ 3CC7Z 3GTMS 3S17I 2Q4ZA 3H3VJ 4AYBA 1VQ6Z 5T64A 4DV5C 2Y4NA 3HKZA 2E8CA 3DAYA 3GKUA 3MZLB 1R9TI 1RNIA 1S7MA 2KPIA 3P5JB 4PZPA 3ETOA 4ODJA 2PT7G 2WD9A 3F3PC 4ZJZA 2E2II 4EATA 4JYAC 4DV1C 2WAQA 1YIJZ 4NH1C 1AA6A 1WF3A 1FUGA 1USPB 4DK1A 3NI2A 2JNVA 3I551 1AMUA 2IZ3A 4KTTA 2P2MA 1N2FA 2ZAEB 3F3FC 3GTLI 3K6RA 1JOSA 3T4NB 3CCS1 5BSMA 3B7WA 4D4IA 4RS4A 1NJI1 3GTGI 2KZFA 3S1NI 2QVYX 2E9HA 1M6XC 1VQO1 3U50C 3A25A 4A3JI 3CME1 1VQP1 1QWIA 4X6AI 1P4EA 4NOZA 3FCEA 2M48A 2KZ0A 1FDOA 1Q862 2E7ZA 1K8A1 4BCAA 2D7VA 2D1SA 1O93A 1HNXC 1M1K1 1TWAI 1Q7Y2 1VQ4Z 1VQ81 3CD6Z 2ONFA 5E7QA 4DV2C 2H85A 3CC41 4DR5C 5GTDA 2GTHA 3CMAZ 3NDIA 1N36C 2O4HA 4RM2A 2E2HI 2KI7B 4BBYA 2E7GA 3CCMZ 4RVOA 4BSZA 1RLYA 4NBFA 2R92I 1DL6A 5AE1A 2OTJ1 3QWUA 1W2BY 3CCU1 2OZKA 2VZEA 2D1RA 3FCCA 1WZNA 3N2QA 4BC7A 1PA4A 5BUSA 1VQ61 4A3EI 4GXRA 2UUBC 3VMIA 4NBGA 4PUGA 5BUQA 2Y0SA 1M902 1VQ9Z 4DGLA 1YJN1 1WIIA 2E5LC 3VB9A 4A3BI 3GTMI 2AYDA 4LF5C 4EWCA 4LF4C 1O9TA 1USPA 2VF1A 2W04A 2R6MA 4OYCA 4D4GA 1K9M2 1KKGA 2PMZA 3LUSA 1N34C 4K0KC 3J81b 2CU6A 3DLPX 2LEXA 5IFIA 4JI1C 1FJGC 1P7LA 3J7A4 2V8KA 2JR6A 3T1HC 5A19A 3CQ1A 5CZVA 3GR1A 5T67A 1O90A 3CCQ1 3VNRA 2Q51A 1Y1VI 3I561 3CXCZ 5BR8C 1I3QI 2V3VA 2P2BA 3S1RI 3OW2Z 3J81D 4A3FI 3I4MI 3TUFA 2JA6I 1O92A 1JJ2Z 2B63I 3TR3A 3CCVZ 4R0MA 1KC81 5JRHA 3JAMf 4JI3C 5D1PA 3S1QI 4MH4A 4FTFA 4IZ6A 5K8FA 4LFCC 4NBBA 5T6BA 4DCVA 2VPYA 2MMAB 1N8R2 2QLVB 2K3RA 1Q822 2UXDC 4FUQA 1IB8A 1YJ7A 4B3MC 2PK7A 4LFAC 2JIRA 1YUAA 5A2Qf 4A3LI 3SO4A 3IMLA 5C4XI 4PUHA 1VQLZ 3CCJZ 3CMA1 2QL8A 2V8JA 4Y7NI 1PG4A 2DHMA 4DV7C 4B3TC 2LFUA 1MKYA 2YWBA 2DYJA 2D1TA 3BG1B 5DV9A 3EEDA 4JI4C 2KDNA
chains in the Genus database with same CATH topology
1X3ZA 1SFOI 3NPDA 1XRBA 2F4OA 4DUYC 3S2HI 4A93I 1KD12 2F4VC 2LIYA 3IF8A 2YWCA 2DE5A 4E2XA 4GKKC 4BBSI 4R1LA 1S72Z 3FQMA 4QTTA 2D27A 3GTKI 5AN9F 1I94C 4G1IA 4DV6C 1QVGZ 2JA8I 1KQSZ 2XR1A 5FLXb 3FKII 3CCE1 3FQQA 4E2ZA 3GTPI 3H0GI 4MD9A 4B3SC 4LF7C 4LFBC 3GTOI 1NP6A 4RVDA 1PG3A 1MDBA 1VQMZ 5C4JI 5FLXD 4A3CI 3CC2Z 2JUBA 3E7WA 5ADZA 3G6EZ 1YJW1 2NVQI 1TWHI 4JM1A 4DV3C 2JA7I 5A1GA 4A3KI 2HJGA 1N32C 1VQ51 1XMQC 4DR6C 1VLAA 1X0TA 3MZKB 1NJI2 4L2ZA 2I3CA 2OBVA 2ATWA 1VQN1 1XNQC 2WP0C 4GXQA 2YADA 2OPLB 5C3EI 3G7SA 1I6HI 2P02A 1KRLA 3CXCY 5T8SA 1ZB8A 4BC9A 4RVFA 1ZB9A 4DR7C 3VMGA 1K8A2 4RVNA 2RBLA 1JJ2Y 2HF1A 2P2FA 3S1MI 2ZM6C 1M1K2 3M3YI 3CCLZ 1K83I 3TDEA 4YY3C 4NXNC 1Q811 5K85A 3NYRA 3TQIA 1NYEA 3CCJ1 3EQ6A 3UZ0A 1IBMC 1T5DX 4ZLPA 3PROC 3I4NI 4X66C 4L4QA 4OXIA 1TWCI 1Q861 2JMPA 2AYAA 4RVGA 4RVHA 3CC71 4E30A 2QEXZ 1XNRC 1Q7Y1 3S16I 2QVZX 1Z03A 4E33A 5BSUA 3VTNA 3CCRZ 4BY7I 4DCTA 5IP7I 2JS4A 1S721 4DQYB 4A3MI 4E31A 2PN2A 2P3YA 4S1TA 2OO4A 3S15I 2RHBA 5T8TA 4GKJC 3G4SZ 2HU9A 1ML8A 5AE3A 3Q87A 4QTUA 1RO2A 2GTIA 1YIJ1 4BXXI 3CPWY 3TE5B 1RY2A 4DUZC 1TWGI 4DV0C 2DPLA 2P28A 4TPSB 3E7XA 1VQM1 1MXCA 3H2TA 1XRAA 3I08A 1K732 2Y4OA 4DR3C 4MD8A 2QRCB 2QREB 2RPRA 3CC21 2E2JI 1IBKC 1XMOC 2JNYA 4X62C 2DE6A 4R1MA 4DG8A 3J80f 2J6AA 5AE2A 1KQSY 2Y27A 2VQEC 3NYQA 3NDJA 3RZDI 3PO2I 2OPLA 1K9M1 3AF5A 1K0RA 2HHHC 3CJEA 4BBRI 3EERA 4JI6C 3LGXA 4NBEA 3A9VA 3PO3S 5BSWA 5IT9f 1L1OC 1PFTA 3HOUI 3GR0A 1Z02A 3D6WA 3S82A 3DHVA 2PM9A 1RO0A 4G37A 3GTJI 1V25A 5H9UA 3G71Z 2OOYB 3HOYI 1QF8A 2BH1X 1MXBA 4DG9A 1NUIA 2QVXX 4BY1I 1LCIA 3CCL1 1VQ41 3CD61 2WB1A 3HOZI 4DCSA 3K7AI 1P9NA 4NDNA 2DE7A 3JAMb 3ESWA 3CMEZ 4NB8A 5BURA 4NFRA 1RQFA 4D57A 4TNUA 4K0BA 1N8R1 5IT9b 2V7BA 5BSTA 4D56A 1Q821 3CCM1 5D1OB 2UUCC 3JAMD 4GS5A 3RV2A 4WS9A 4JI8C 4RV9A 4JI2C 2QA4Z 1HH2P 1YITZ 2UXCC 1W2BZ 2E0GA 4PHTA 5A2Qb 4XX2A 4LF8C 3CCR1 1VQ8Z 1LQLA 1VQ91 1YJ9Z 4WV3A 3VNQA 4A3II 5A1IA 1WH9A 3BG0B 4LF6C 2OTLZ 3G4S1 3KIHA 2V8IA 3MONA 5IP9I 5A2QD 4OX9C 5IWAC 5CM2M 4DV4C 3T1YC 1QYPA 3IFUA 4PROC 2K5RA 3A9UA 4DR1C 4FUTA 1TFIA 4HGZA 4A3DI 1KD11 2R93I 3NFZA 2D28C 2YCBA 2VSQA 2VUMI 1T5HX 3N54B 1YJNZ 5KEIA 5LL6f 1WW9A 3CCV1 1ZH1A 2W03A 4E2YA 1YI2Z 4NXMC 2UU9C 1Y1VS 1I50I 1RO4A 1V26A 1BA3A 1WCMI 3PESA 3IEVA 3GCFA 2QR1B 2E8EA 5BSRA 3CQZI 4DR2C 2NVTI 3OW2Y 2JA5I 4RLFA 3CCQZ 3G711 3D9XA 3I56Z 4NB9A 2RIQA 2NVYI 3PO3I 4L7IA 4MD7A 4I9FA 2CY1A 4Y52I 2EGTA 1Q812 4YHHC 4LE5A 1VQL1 4HH4A 1VQ7Z 3S2DI 2P20A 1HNWC 5D1OA 3IPLA 3IX0A 4AQYC 1N33C 5C44I 3S14I 3TDHB 4NBHA 1IBLC 2P2QA 3NH4A 4MONA 2QW0X 4ISBA 2IZ4A 3L95X 1QVFZ 4JI7C 2QA41 1ULTA 3GPCA 3NH5A 1YIT1 4U5YD 3VMHA 4RLQA 3NH8A 4B3RC 1VQKZ 4JV5C 4E2WA 1YJ91 4A3GI 4DCUA 2M6NA 2OTL1 2PROA 1YHQZ 2UUAC 2VUGA 2G2KA 2BJOA 2UXBC 4KHPC 2QRDB 3J81f 1TWFI 2JMOA 4X65C 1MD9A 3CW9A 3ETCA 3CW8X 4X64C 1GPMA 4I9GA 1HR0C 3RZOI 3G6E1 1HNZC 1M901 4JI0C 1QVGY 4KTVA 3R44A 1JWHC 3GTQI 4MTNA 3RG2A 5KYTA 1YI21 2VQFC 2QKDA 3CCEZ 1KC82 3R9XA 4RM3A 3HOVI 2D1QA 5KYVA 2CXCA 1K731 3I55Z 3IEUA 2NVXI 1UKKA 4JI5C 5CZXA 2R7ZI 3PBKA 5FLMI 1L2FA 2GU2A 1YJWZ 4MXUA 3J80b 1J5EC 2P2JA 3HOWI 4CL1A 3CCSZ 1EGAA 4HGYA 2O53A 3M4OI 3R9WA 2OOXB 1Y1WI 1XRCA 1VQ5Z 2E8FA 3C5EA 4RMNA 2ASBA 3UOWA 1YUKA 1VQOZ 1VQ71 1Z01A 1VQNZ 4LF9C 3J80D 3HOXI 4G36A 5LMUC 2F4MA 1VQPZ 2RT9A 3OTOC 4MRIA 3I07A 3KIFA 1X3WA 4E32A 1RG9A 4NBCA 2QEX1 3LNVA 3KXWA 5LMNC 5IT9D 4HPVA 1MXAA 1VQK1 3CC4Z 3GKQA 2YU9I 2AKLA 4NBAA 3A4IA 5FLXf 1MDFA 3VNSA 1YHQ1 3L8CA 3AF6A 3LAXA 4DR4C 1QVFY 4NBDA 3CPWZ 4IR7A 1QM4A 2OTJZ 3CCUZ 3CC7Z 3GTMS 3S17I 2Q4ZA 3H3VJ 4AYBA 1VQ6Z 5T64A 4DV5C 2Y4NA 3HKZA 2E8CA 3DAYA 3GKUA 3MZLB 1R9TI 1RNIA 1S7MA 2KPIA 3P5JB 4PZPA 3ETOA 4ODJA 2PT7G 2WD9A 3F3PC 4ZJZA 2E2II 4EATA 4JYAC 4DV1C 2WAQA 1YIJZ 4NH1C 1WF3A 1FUGA 1USPB 4DK1A 3NI2A 3I551 1AMUA 2IZ3A 4KTTA 2P2MA 1N2FA 2ZAEB 3F3FC 3GTLI 1JOSA 3T4NB 3CCS1 5BSMA 3B7WA 4D4IA 4RS4A 1NJI1 3GTGI 2KZFA 3S1NI 2QVYX 2E9HA 1VQO1 3U50C 4A3JI 3CME1 1VQP1 1QWIA 4X6AI 4NOZA 3FCEA 2M48A 1Q862 1K8A1 4BCAA 2D7VA 2D1SA 1O93A 1HNXC 1M1K1 1TWAI 1Q7Y2 1VQ4Z 1VQ81 3CD6Z 2ONFA 5E7QA 4DV2C 2H85A 3CC41 4DR5C 5GTDA 2GTHA 3CMAZ 3NDIA 1N36C 2O4HA 4RM2A 2E2HI 2KI7B 4BBYA 2E7GA 3CCMZ 4RVOA 4BSZA 1RLYA 4NBFA 2R92I 1DL6A 5AE1A 2OTJ1 3QWUA 1W2BY 3CCU1 2OZKA 2VZEA 2D1RA 3FCCA 3N2QA 4BC7A 5BUSA 1PA4A 1VQ61 4A3EI 4GXRA 2UUBC 3VMIA 4NBGA 5BUQA 2Y0SA 1M902 1VQ9Z 4DGLA 1YJN1 1WIIA 2E5LC 3VB9A 4A3BI 3GTMI 4LF5C 4EWCA 4LF4C 1O9TA 1USPA 2VF1A 2W04A 2R6MA 4OYCA 4D4GA 1K9M2 1KKGA 2PMZA 3LUSA 1N34C 4K0KC 3J81b 3DLPX 5IFIA 4JI1C 1FJGC 1P7LA 3J7A4 2V8KA 2JR6A 3T1HC 5A19A 5CZVA 3GR1A 5T67A 1O90A 3CCQ1 3VNRA 2Q51A 1Y1VI 3I561 3CXCZ 5BR8C 1I3QI 2P2BA 3S1RI 3OW2Z 3J81D 4A3FI 3I4MI 3TUFA 2JA6I 1O92A 1JJ2Z 2B63I 3CCVZ 4R0MA 1KC81 5JRHA 3JAMf 4JI3C 5D1PA 3S1QI 4MH4A 4FTFA 4IZ6A 5K8FA 4LFCC 4NBBA 5T6BA 4DCVA 1N8R2 2QLVB 2K3RA 1Q822 2UXDC 4FUQA 1YJ7A 4B3MC 2PK7A 4LFAC 1YUAA 5A2Qf 4A3LI 3SO4A 3IMLA 5C4XI 1VQLZ 3CCJZ 3CMA1 2QL8A 2V8JA 4Y7NI 1PG4A 4DV7C 4B3TC 2LFUA 1MKYA 2YWBA 2DYJA 2D1TA 3BG1B 5DV9A 3EEDA 4JI4C 5BSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z A;  1SFO I;  2F4O A;  4DUY C;  3S2H I;  4A93 I;  2F4V C;  2DE5 A;  4GKK C;  4BBS I;  4QTT A;  3GTK I;  1I94 C;  4DV6 C;  2JA8 I;  2XR1 A;  3FKI I;  3GTP I;  3H0G I;  4B3S C;  4LF7 C;  4LFB C;  3GTO I;  5C4J I;  5FLX D;  4A3C I;  2NVQ I;  1TWH I;  4DV3 C;  2JA7 I;  4A3K I;  2HJG A;  1N32 C;  1XMQ C;  4DR6 C;  1VLA A;  2ATW A;  1XNQ C;  2OPL B;  5C3E I;  1I6H I;  1ZB8 A;  1ZB9 A;  4DR7 C;  3VMG A;  2RBL A;  2ZM6 C;  2HF1 A;  3S1M I;  3M3Y I;  1K83 I;  4YY3 C;  4NXN C;  1NYE A;  1IBM C;  3I4N I;  4X66 C;  1TWC I;  2JMP A;  1XNR C;  3S16 I;  4BY7 I;  4DCT A;  5IP7 I;  2JS4 A;  4A3M I;  2PN2 A;  2P3Y A;  4GKJ C;  3S15 I;  1ML8 A;  3Q87 A;  4QTU A;  4BXX I;  4DUZ C;  1TWG I;  4DV0 C;  4DR3 C;  2E2J I;  1IBK C;  1XMO C;  2JNY A;  4X62 C;  2DE6 A;  2J6A A;  2VQE C;  3RZD I;  3PO2 I;  2OPL A;  3AF5 A;  1K0R A;  2HHH C;  3CJE A;  4BBR I;  3EER A;  4JI6 C;  4NBE A;  3PO3 S;  3HOU I;  1L1O C;  1PFT A;  3D6W A;  3GTJ I;  3HOY I;  1NUI A;  4BY1 I;  3HOZ I;  4DCS A;  3K7A I;  2DE7 A;  3ESW A;  4NB8 A;  2UUC C;  3JAM D;  4JI8 C;  4JI2 C;  1HH2 P;  2UXC C;  4LF8 C;  4XX2 A;  1LQL A;  4A3I I;  1WH9 A;  4LF6 C;  5IP9 I;  4OX9 C;  5A2Q D;  5IWA C;  5CM2 M;  4DV4 C;  3T1Y C;  1QYP A;  2K5R A;  4DR1 C;  1TFI A;  4A3D I;  2R93 I;  2YCB A;  2VUM I;  1WW9 A;  2UU9 C;  4NXM C;  1Y1V S;  1I50 I;  1RO4 A;  1WCM I;  3GCF A;  2E8E A;  3CQZ I;  4DR2 C;  2NVT I;  2JA5 I;  4NB9 A;  2NVY I;  3PO3 I;  2CY1 A;  4Y52 I;  2EGT A;  4YHH C;  3S2D I;  1HNW C;  4AQY C;  1N33 C;  5C44 I;  3S14 I;  4NBH A;  1IBL C;  4JI7 C;  3VMH A;  4B3R C;  4JV5 C;  4A3G I;  4DCU A;  2UUA C;  2BJO A;  2UXB C;  4KHP C;  1TWF I;  4X65 C;  4X64 C;  1HR0 C;  3RZO I;  1HNZ C;  4JI0 C;  3GTQ I;  4MTN A;  2VQF C;  3R9X A;  3HOV I;  2CXC A;  3IEU A;  2NVX I;  1UKK A;  4JI5 C;  2R7Z I;  5FLM I;  1L2F A;  1J5E C;  3HOW I;  1EGA A;  3M4O I;  3R9W A;  1Y1W I;  2E8F A;  2ASB A;  4LF9 C;  3J80 D;  3HOX I;  5LMU C;  2F4M A;  3OTO C;  3I07 A;  1X3W A;  4NBC A;  5LMN C;  5IT9 D;  3GKQ A;  2YU9 I;  2AKL A;  4NBA A;  3AF6 A;  4DR4 C;  4NBD A;  3GTM S;  3S17 I;  3H3V J;  4DV5 C;  2E8C A;  3GKU A;  1R9T I;  2KPI A;  2PT7 G;  4JYA C;  2E2I I;  4DV1 C;  1WF3 A;  1USP B;  1N2F A;  3GTL I;  1JOS A;  3GTG I;  2KZF A;  3S1N I;  3U50 C;  4A3J I;  1QWI A;  4X6A I;  4NOZ A;  2D7V A;  1HNX C;  1TWA I;  2ONF A;  4DV2 C;  4DR5 C;  1N36 C;  2E2H I;  2E7G A;  4BSZ A;  1RLY A;  4NBF A;  2R92 I;  1DL6 A;  3IEV A;  1PA4 A;  4A3E I;  2UUB C;  3VMI A;  4NBG A;  2E5L C;  3VB9 A;  4A3B I;  3GTM I;  4LF5 C;  4LF4 C;  1USP A;  1KKG A;  3LUS A;  1N34 C;  4K0K C;  4JI1 C;  1FJG C;  3T1H C;  2JR6 A;  1Y1V I;  5BR8 C;  1I3Q I;  3S1R I;  3J81 D;  4A3F I;  3I4M I;  2JA6 I;  2B63 I;  4JI3 C;  3S1Q I;  4MH4 A;  4LFC C;  4NBB A;  4DCV A;  2UXD C;  4B3M C;  2PK7 A;  4LFA C;  1YUA A;  4A3L I;  5C4X I;  2QL8 A;  4Y7N I;  4DV7 C;  4B3T C;  1MKY A;  2DYJ A;  4JI4 C; 
#chains in the Genus database with same CATH topology
 1X3Z A;  1SFO I;  3NPD A;  1XRB A;  2F4O A;  4DUY C;  3S2H I;  4A93 I;  1KD1 2;  2F4V C;  2LIY A;  3IF8 A;  2YWC A;  2DE5 A;  4E2X A;  4GKK C;  4BBS I;  4R1L A;  1S72 Z;  3FQM A;  4QTT A;  2D27 A;  3GTK I;  5AN9 F;  1I94 C;  4G1I A;  4DV6 C;  1QVG Z;  1QXF A;  2JA8 I;  1KQS Z;  2XR1 A;  2JIP A;  5FLX b;  3FKI I;  3CCE 1;  3FQQ A;  4E2Z A;  3GTP I;  3H0G I;  4MD9 A;  4B3S C;  4LF7 C;  4LFB C;  3GTO I;  1NP6 A;  4RVD A;  1PG3 A;  1MDB A;  1VQM Z;  5C4J I;  5FLX D;  2VPX A;  4A3C I;  3CC2 Z;  2JUB A;  3E7W A;  5ADZ A;  3G6E Z;  1YJW 1;  2NVQ I;  1TWH I;  4JM1 A;  4DV3 C;  1PU1 A;  1XS3 A;  2JA7 I;  5A1G A;  4A3K I;  2HJG A;  1N32 C;  1VQ5 1;  1XMQ C;  4DR6 C;  1VLA A;  1X0T A;  3MZK B;  1NJI 2;  4L2Z A;  2I3C A;  2OBV A;  2ATW A;  1VQN 1;  1XNQ C;  2WP0 C;  4GXQ A;  2YAD A;  2OPL B;  5C3E I;  3G7S A;  1I6H I;  2P02 A;  1KRL A;  3CXC Y;  5T8S A;  1ZB8 A;  4BC9 A;  4RVF A;  1ZB9 A;  4DR7 C;  3VMG A;  1K8A 2;  2M5O A;  4RVN A;  2RBL A;  1JJ2 Y;  2HF1 A;  2P2F A;  3S1M I;  2ZM6 C;  1M1K 2;  3M3Y I;  3CCL Z;  1K83 I;  3TDE A;  4YY3 C;  4NXN C;  1Q81 1;  5K85 A;  1M6X A;  3NYR A;  1NY8 A;  3TQI A;  1NYE A;  3CCJ 1;  3EQ6 A;  3UZ0 A;  1IBM C;  1T5D X;  4ZLP A;  3PRO C;  3I4N I;  4X66 C;  4L4Q A;  4OXI A;  1TWC I;  1Q86 1;  2JMP A;  2AYA A;  4RVG A;  4RVH A;  3CC7 1;  4E30 A;  2QEX Z;  1XNR C;  1Q7Y 1;  3S16 I;  2QVZ X;  1Z03 A;  4E33 A;  5BSU A;  3VTN A;  3CCR Z;  4BY7 I;  4DCT A;  5IP7 I;  2JS4 A;  3AY0 A;  1S72 1;  4DQY B;  4A3M I;  4E31 A;  2PN2 A;  2P3Y A;  4S1T A;  1V60 A;  3S15 I;  2RHB A;  2OO4 A;  5T8T A;  4GKJ C;  3G4S Z;  2HU9 A;  1ML8 A;  1Q16 A;  5AE3 A;  3Q87 A;  4QTU A;  1RO2 A;  2GTI A;  1YIJ 1;  4BXX I;  3CPW Y;  1FDI A;  3TE5 B;  1RY2 A;  4DUZ C;  1TWG I;  4DV0 C;  2DPL A;  2P28 A;  4TPS B;  3E7X A;  1VQM 1;  1MXC A;  3H2T A;  1XRA A;  3I08 A;  2JIO A;  3UX2 A;  1K73 2;  2Y4O A;  4DR3 C;  4MD8 A;  2QRC B;  2QRE B;  2RPR A;  3CC2 1;  2E2J I;  1IBK C;  1XMO C;  2JNY A;  4X62 C;  2DE6 A;  1TH5 A;  4R1M A;  4DG8 A;  3J80 f;  2J6A A;  5AE2 A;  1KQS Y;  2Y27 A;  4PUI A;  2VQE C;  3NYQ A;  3NDJ A;  3RZD I;  3PO2 I;  2OPL A;  1K9M 1;  3AF5 A;  1K0R A;  2HHH C;  3CJE A;  4BBR I;  3EER A;  4JI6 C;  3LGX A;  3CQ2 A;  4NBE A;  3A9V A;  3PO3 S;  5BSW A;  5IT9 f;  1L1O C;  1PFT A;  3HOU I;  3GR0 A;  1Z02 A;  3D6W A;  3S82 A;  3DHV A;  2PM9 A;  1RO0 A;  4G37 A;  3GTJ I;  1V25 A;  5H9U A;  3G71 Z;  2OOY B;  3HOY I;  1QF8 A;  2BH1 X;  1MXB A;  4DG9 A;  5BSV A;  1NUI A;  2QVX X;  4BY1 I;  1LCI A;  3O2E A;  3CCL 1;  1VQ4 1;  3CD6 1;  2WB1 A;  3HOZ I;  4DCS A;  3K7A I;  1P9N A;  4NDN A;  2DE7 A;  3JAM b;  3ESW A;  3CME Z;  4NB8 A;  5BUR A;  3D2L A;  4NFR A;  1RQF A;  4D57 A;  4TNU A;  4K0B A;  1N8R 1;  5IT9 b;  2V7B A;  5BST A;  4D56 A;  1Q82 1;  3CCM 1;  5D1O B;  2UUC C;  3JAM D;  4GS5 A;  3RV2 A;  4WS9 A;  4JI8 C;  4RV9 A;  4JI2 C;  2QA4 Z;  1HH2 P;  1YIT Z;  2UXC C;  1W2B Z;  2E0G A;  4PHT A;  5A2Q b;  4XX2 A;  4LF8 C;  3CCR 1;  1VQ8 Z;  1LQL A;  1VQ9 1;  1YJ9 Z;  4WV3 A;  3VNQ A;  4A3I I;  5A1I A;  1WH9 A;  3BG0 B;  4LF6 C;  2OTL Z;  3G4S 1;  1SIW A;  3KIH A;  2V8I A;  3MON A;  5IP9 I;  5A2Q D;  4OX9 C;  5IWA C;  5CM2 M;  4DV4 C;  3T1Y C;  1QYP A;  1UWD A;  3IFU A;  4PRO C;  2K5R A;  3A9U A;  4DR1 C;  4FUT A;  1TFI A;  4HGZ A;  4A3D I;  1KD1 1;  2R93 I;  3NFZ A;  2D28 C;  2YCB A;  2Z51 A;  2VSQ A;  2VUM I;  1T5H X;  3N54 B;  1YJN Z;  5KEI A;  5LL6 f;  1WW9 A;  2NAP A;  2VPW A;  3CCV 1;  1ZH1 A;  2W03 A;  2JIM A;  4E2Y A;  1YI2 Z;  4NXM C;  2UU9 C;  1Y1V S;  1I50 I;  1RO4 A;  1V26 A;  1BA3 A;  2MM9 A;  3UX3 A;  1WCM I;  3PES A;  3IEV A;  3GCF A;  1WCJ A;  2QR1 B;  2E8E A;  5BSR A;  3CQZ I;  1P4E C;  4DR2 C;  2NVT I;  3OW2 Y;  2JA5 I;  4RLF A;  3CCQ Z;  3G71 1;  3D9X A;  3I56 Z;  4NB9 A;  2RIQ A;  2NVY I;  3PO3 I;  4L7I A;  4MD7 A;  4I9F A;  2CY1 A;  4Y52 I;  2EGT A;  1Q81 2;  4YHH C;  4LE5 A;  1VQL 1;  4HH4 A;  1VQ7 Z;  3S2D I;  2P20 A;  2VPZ A;  1HNW C;  5D1O A;  3IPL A;  3IX0 A;  4AQY C;  1N33 C;  5C44 I;  3S14 I;  2ZZN A;  3TDH B;  1WJ2 A;  4NBH A;  1IBL C;  2P2Q A;  3NH4 A;  4MON A;  2QW0 X;  4ISB A;  1XHJ A;  2IZ4 A;  3L95 X;  1QVF Z;  4JI7 C;  2QA4 1;  1ULT A;  3GPC A;  3NH5 A;  1YIT 1;  4U5Y D;  3VMH A;  4RLQ A;  3NH8 A;  4B3R C;  1VQK Z;  4JV5 C;  4E2W A;  1YJ9 1;  5LCI A;  4A3G I;  4DCU A;  2M6N A;  3UEB A;  2OTL 1;  2PRO A;  3LNO A;  1YHQ Z;  2JIQ A;  2VUG A;  2UUA C;  2G2K A;  2BJO A;  2UXB C;  4KHP C;  1Y8C A;  2QRD B;  3J81 f;  1TWF I;  2JMO A;  4X65 C;  1MD9 A;  3CW9 A;  3ETC A;  3CW8 X;  4X64 C;  1GPM A;  4I9G A;  1HR0 C;  3RZO I;  3G6E 1;  1HNZ C;  1M90 1;  4JI0 C;  1QVG Y;  4KTV A;  3R44 A;  1JWH C;  3GTQ I;  4MTN A;  3RG2 A;  5KYT A;  1YI2 1;  2VQF C;  2QKD A;  3CCE Z;  1KC8 2;  3R9X A;  4RM3 A;  3HOV I;  2D1Q A;  5KYV A;  2CXC A;  1K73 1;  3I55 Z;  3IEU A;  2NVX I;  1FLO A;  1UKK A;  4JI5 C;  5CZX A;  2R7Z I;  3PBK A;  3CQ3 A;  5FLM I;  1L2F A;  2M5H A;  2NCL A;  2GU2 A;  1YJW Z;  4MXU A;  3J80 b;  1J5E C;  2P2J A;  3HOW I;  4CL1 A;  3CCS Z;  1EGA A;  4HGY A;  2O53 A;  3M4O I;  2YX1 A;  3R9W A;  2OOX B;  1Y1W I;  1XRC A;  1VQ5 Z;  2E8F A;  3C5E A;  4RMN A;  2ASB A;  3UOW A;  1YUK A;  1VQO Z;  1VQ7 1;  1Z01 A;  1VQN Z;  4LF9 C;  3A26 A;  3J80 D;  3HOX I;  4G36 A;  5LMU C;  2F4M A;  1VQP Z;  2RT9 A;  3OTO C;  2MCQ A;  2V45 A;  3I07 A;  3KIF A;  1X3W A;  3IR7 A;  4MRI A;  4E32 A;  1RG9 A;  4NBC A;  2QEX 1;  3LNV A;  1VEH A;  3KXW A;  5LMN C;  5IT9 D;  4HPV A;  1MXA A;  1VQK 1;  3CC4 Z;  3GKQ A;  2YU9 I;  2AKL A;  4NBA A;  3A4I A;  5FLX f;  1MDF A;  3VNS A;  1YHQ 1;  3L8C A;  2ZZM A;  3AF6 A;  3LAX A;  4DR4 C;  1QVF Y;  4NBD A;  3CPW Z;  4IR7 A;  1QM4 A;  2OTJ Z;  2IV2 X;  3CCU Z;  3CC7 Z;  3GTM S;  3S17 I;  2Q4Z A;  3H3V J;  4AYB A;  1VQ6 Z;  5T64 A;  4DV5 C;  2Y4N A;  3HKZ A;  2E8C A;  3DAY A;  3GKU A;  3MZL B;  1R9T I;  1RNI A;  1S7M A;  2KPI A;  3P5J B;  4PZP A;  3ETO A;  4ODJ A;  2PT7 G;  2WD9 A;  3F3P C;  4ZJZ A;  2E2I I;  4EAT A;  4JYA C;  4DV1 C;  2WAQ A;  1YIJ Z;  4NH1 C;  1AA6 A;  1WF3 A;  1FUG A;  1USP B;  4DK1 A;  3NI2 A;  2JNV A;  3I55 1;  1AMU A;  2IZ3 A;  4KTT A;  2P2M A;  1N2F A;  2ZAE B;  3F3F C;  3GTL I;  3K6R A;  1JOS A;  3T4N B;  3CCS 1;  5BSM A;  3B7W A;  4D4I A;  4RS4 A;  1NJI 1;  3GTG I;  2KZF A;  3S1N I;  2QVY X;  2E9H A;  1M6X C;  1VQO 1;  3U50 C;  3A25 A;  4A3J I;  3CME 1;  1VQP 1;  1QWI A;  4X6A I;  1P4E A;  4NOZ A;  3FCE A;  2M48 A;  2KZ0 A;  1FDO A;  1Q86 2;  2E7Z A;  1K8A 1;  4BCA A;  2D7V A;  2D1S A;  1O93 A;  1HNX C;  1M1K 1;  1TWA I;  1Q7Y 2;  1VQ4 Z;  1VQ8 1;  3CD6 Z;  2ONF A;  5E7Q A;  4DV2 C;  2H85 A;  3CC4 1;  4DR5 C;  5GTD A;  2GTH A;  3CMA Z;  3NDI A;  1N36 C;  2O4H A;  4RM2 A;  2E2H I;  2KI7 B;  4BBY A;  2E7G A;  3CCM Z;  4RVO A;  4BSZ A;  1RLY A;  4NBF A;  2R92 I;  1DL6 A;  5AE1 A;  2OTJ 1;  3QWU A;  1W2B Y;  3CCU 1;  2OZK A;  2VZE A;  2D1R A;  3FCC A;  1WZN A;  3N2Q A;  4BC7 A;  1PA4 A;  5BUS A;  1VQ6 1;  4A3E I;  4GXR A;  2UUB C;  3VMI A;  4NBG A;  4PUG A;  5BUQ A;  2Y0S A;  1M90 2;  1VQ9 Z;  4DGL A;  1YJN 1;  1WII A;  2E5L C;  3VB9 A;  4A3B I;  3GTM I;  2AYD A;  4LF5 C;  4EWC A;  4LF4 C;  1O9T A;  1USP A;  2VF1 A;  2W04 A;  2R6M A;  4OYC A;  4D4G A;  1K9M 2;  1KKG A;  2PMZ A;  3LUS A;  1N34 C;  4K0K C;  3J81 b;  2CU6 A;  3DLP X;  2LEX A;  5IFI A;  4JI1 C;  1FJG C;  1P7L A;  3J7A 4;  2V8K A;  2JR6 A;  3T1H C;  5A19 A;  3CQ1 A;  5CZV A;  3GR1 A;  5T67 A;  1O90 A;  3CCQ 1;  3VNR A;  2Q51 A;  1Y1V I;  3I56 1;  3CXC Z;  5BR8 C;  1I3Q I;  2V3V A;  2P2B A;  3S1R I;  3OW2 Z;  3J81 D;  4A3F I;  3I4M I;  3TUF A;  2JA6 I;  1O92 A;  1JJ2 Z;  2B63 I;  3TR3 A;  3CCV Z;  4R0M A;  1KC8 1;  5JRH A;  3JAM f;  4JI3 C;  5D1P A;  3S1Q I;  4MH4 A;  4FTF A;  4IZ6 A;  5K8F A;  4LFC C;  4NBB A;  5T6B A;  4DCV A;  2VPY A;  2MMA B;  1N8R 2;  2QLV B;  2K3R A;  1Q82 2;  2UXD C;  4FUQ A;  1IB8 A;  1YJ7 A;  4B3M C;  2PK7 A;  4LFA C;  2JIR A;  1YUA A;  5A2Q f;  4A3L I;  3SO4 A;  3IML A;  5C4X I;  4PUH A;  1VQL Z;  3CCJ Z;  3CMA 1;  2QL8 A;  2V8J A;  4Y7N I;  1PG4 A;  2DHM A;  4DV7 C;  4B3T C;  2LFU A;  1MKY A;  2YWB A;  2DYJ A;  2D1T A;  3BG1 B;  5DV9 A;  3EED A;  4JI4 C;  2KDN A; 
#chains in the Genus database with same CATH homology
 1X3Z A;  1SFO I;  3NPD A;  1XRB A;  2F4O A;  4DUY C;  3S2H I;  4A93 I;  1KD1 2;  2F4V C;  2LIY A;  3IF8 A;  2YWC A;  2DE5 A;  4E2X A;  4GKK C;  4BBS I;  4R1L A;  1S72 Z;  3FQM A;  4QTT A;  2D27 A;  3GTK I;  5AN9 F;  1I94 C;  4G1I A;  4DV6 C;  1QVG Z;  2JA8 I;  1KQS Z;  2XR1 A;  5FLX b;  3FKI I;  3CCE 1;  3FQQ A;  4E2Z A;  3GTP I;  3H0G I;  4MD9 A;  4B3S C;  4LF7 C;  4LFB C;  3GTO I;  1NP6 A;  4RVD A;  1PG3 A;  1MDB A;  1VQM Z;  5C4J I;  5FLX D;  4A3C I;  3CC2 Z;  2JUB A;  3E7W A;  5ADZ A;  3G6E Z;  1YJW 1;  2NVQ I;  1TWH I;  4JM1 A;  4DV3 C;  2JA7 I;  5A1G A;  4A3K I;  2HJG A;  1N32 C;  1VQ5 1;  1XMQ C;  4DR6 C;  1VLA A;  1X0T A;  3MZK B;  1NJI 2;  4L2Z A;  2I3C A;  2OBV A;  2ATW A;  1VQN 1;  1XNQ C;  2WP0 C;  4GXQ A;  2YAD A;  2OPL B;  5C3E I;  3G7S A;  1I6H I;  2P02 A;  1KRL A;  3CXC Y;  5T8S A;  1ZB8 A;  4BC9 A;  4RVF A;  1ZB9 A;  4DR7 C;  3VMG A;  1K8A 2;  4RVN A;  2RBL A;  1JJ2 Y;  2HF1 A;  2P2F A;  3S1M I;  2ZM6 C;  1M1K 2;  3M3Y I;  3CCL Z;  1K83 I;  3TDE A;  4YY3 C;  4NXN C;  1Q81 1;  5K85 A;  3NYR A;  3TQI A;  1NYE A;  3CCJ 1;  3EQ6 A;  3UZ0 A;  1IBM C;  1T5D X;  4ZLP A;  3PRO C;  3I4N I;  4X66 C;  4L4Q A;  4OXI A;  1TWC I;  1Q86 1;  2JMP A;  2AYA A;  4RVG A;  4RVH A;  3CC7 1;  4E30 A;  2QEX Z;  1XNR C;  1Q7Y 1;  3S16 I;  2QVZ X;  1Z03 A;  4E33 A;  5BSU A;  3VTN A;  3CCR Z;  4BY7 I;  4DCT A;  5IP7 I;  2JS4 A;  1S72 1;  4DQY B;  4A3M I;  4E31 A;  2PN2 A;  2P3Y A;  4S1T A;  2OO4 A;  3S15 I;  2RHB A;  5T8T A;  4GKJ C;  3G4S Z;  2HU9 A;  1ML8 A;  5AE3 A;  3Q87 A;  4QTU A;  1RO2 A;  2GTI A;  1YIJ 1;  4BXX I;  3CPW Y;  3TE5 B;  1RY2 A;  4DUZ C;  1TWG I;  4DV0 C;  2DPL A;  2P28 A;  4TPS B;  3E7X A;  1VQM 1;  1MXC A;  3H2T A;  1XRA A;  3I08 A;  1K73 2;  2Y4O A;  4DR3 C;  4MD8 A;  2QRC B;  2QRE B;  2RPR A;  3CC2 1;  2E2J I;  1IBK C;  1XMO C;  2JNY A;  4X62 C;  2DE6 A;  4R1M A;  4DG8 A;  3J80 f;  2J6A A;  5AE2 A;  1KQS Y;  2Y27 A;  2VQE C;  3NYQ A;  3NDJ A;  3RZD I;  3PO2 I;  2OPL A;  1K9M 1;  3AF5 A;  1K0R A;  2HHH C;  3CJE A;  4BBR I;  3EER A;  4JI6 C;  3LGX A;  4NBE A;  3A9V A;  3PO3 S;  5BSW A;  5IT9 f;  1L1O C;  1PFT A;  3HOU I;  3GR0 A;  1Z02 A;  3D6W A;  3S82 A;  3DHV A;  2PM9 A;  1RO0 A;  4G37 A;  3GTJ I;  1V25 A;  5H9U A;  3G71 Z;  2OOY B;  3HOY I;  1QF8 A;  2BH1 X;  1MXB A;  4DG9 A;  1NUI A;  2QVX X;  4BY1 I;  1LCI A;  3CCL 1;  1VQ4 1;  3CD6 1;  2WB1 A;  3HOZ I;  4DCS A;  3K7A I;  1P9N A;  4NDN A;  2DE7 A;  3JAM b;  3ESW A;  3CME Z;  4NB8 A;  5BUR A;  4NFR A;  1RQF A;  4D57 A;  4TNU A;  4K0B A;  1N8R 1;  5IT9 b;  2V7B A;  5BST A;  4D56 A;  1Q82 1;  3CCM 1;  5D1O B;  2UUC C;  3JAM D;  4GS5 A;  3RV2 A;  4WS9 A;  4JI8 C;  4RV9 A;  4JI2 C;  2QA4 Z;  1HH2 P;  1YIT Z;  2UXC C;  1W2B Z;  2E0G A;  4PHT A;  5A2Q b;  4XX2 A;  4LF8 C;  3CCR 1;  1VQ8 Z;  1LQL A;  1VQ9 1;  1YJ9 Z;  4WV3 A;  3VNQ A;  4A3I I;  5A1I A;  1WH9 A;  3BG0 B;  4LF6 C;  2OTL Z;  3G4S 1;  3KIH A;  2V8I A;  3MON A;  5IP9 I;  5A2Q D;  4OX9 C;  5IWA C;  5CM2 M;  4DV4 C;  3T1Y C;  1QYP A;  3IFU A;  4PRO C;  2K5R A;  3A9U A;  4DR1 C;  4FUT A;  1TFI A;  4HGZ A;  4A3D I;  1KD1 1;  2R93 I;  3NFZ A;  2D28 C;  2YCB A;  2VSQ A;  2VUM I;  1T5H X;  3N54 B;  1YJN Z;  5KEI A;  5LL6 f;  1WW9 A;  3CCV 1;  1ZH1 A;  2W03 A;  4E2Y A;  1YI2 Z;  4NXM C;  2UU9 C;  1Y1V S;  1I50 I;  1RO4 A;  1V26 A;  1BA3 A;  1WCM I;  3PES A;  3IEV A;  3GCF A;  2QR1 B;  2E8E A;  5BSR A;  3CQZ I;  4DR2 C;  2NVT I;  3OW2 Y;  2JA5 I;  4RLF A;  3CCQ Z;  3G71 1;  3D9X A;  3I56 Z;  4NB9 A;  2RIQ A;  2NVY I;  3PO3 I;  4L7I A;  4MD7 A;  4I9F A;  2CY1 A;  4Y52 I;  2EGT A;  1Q81 2;  4YHH C;  4LE5 A;  1VQL 1;  4HH4 A;  1VQ7 Z;  3S2D I;  2P20 A;  1HNW C;  5D1O A;  3IPL A;  3IX0 A;  4AQY C;  1N33 C;  5C44 I;  3S14 I;  3TDH B;  4NBH A;  1IBL C;  2P2Q A;  3NH4 A;  4MON A;  2QW0 X;  4ISB A;  2IZ4 A;  3L95 X;  1QVF Z;  4JI7 C;  2QA4 1;  1ULT A;  3GPC A;  3NH5 A;  1YIT 1;  4U5Y D;  3VMH A;  4RLQ A;  3NH8 A;  4B3R C;  1VQK Z;  4JV5 C;  4E2W A;  1YJ9 1;  4A3G I;  4DCU A;  2M6N A;  2OTL 1;  2PRO A;  1YHQ Z;  2UUA C;  2VUG A;  2G2K A;  2BJO A;  2UXB C;  4KHP C;  2QRD B;  3J81 f;  1TWF I;  2JMO A;  4X65 C;  1MD9 A;  3CW9 A;  3ETC A;  3CW8 X;  4X64 C;  1GPM A;  4I9G A;  1HR0 C;  3RZO I;  3G6E 1;  1HNZ C;  1M90 1;  4JI0 C;  1QVG Y;  4KTV A;  3R44 A;  1JWH C;  3GTQ I;  4MTN A;  3RG2 A;  5KYT A;  1YI2 1;  2VQF C;  2QKD A;  3CCE Z;  1KC8 2;  3R9X A;  4RM3 A;  3HOV I;  2D1Q A;  5KYV A;  2CXC A;  1K73 1;  3I55 Z;  3IEU A;  2NVX I;  1UKK A;  4JI5 C;  5CZX A;  2R7Z I;  3PBK A;  5FLM I;  1L2F A;  2GU2 A;  1YJW Z;  4MXU A;  3J80 b;  1J5E C;  2P2J A;  3HOW I;  4CL1 A;  3CCS Z;  1EGA A;  4HGY A;  2O53 A;  3M4O I;  3R9W A;  2OOX B;  1Y1W I;  1XRC A;  1VQ5 Z;  2E8F A;  3C5E A;  4RMN A;  2ASB A;  3UOW A;  1YUK A;  1VQO Z;  1VQ7 1;  1Z01 A;  1VQN Z;  4LF9 C;  3J80 D;  3HOX I;  4G36 A;  5LMU C;  2F4M A;  1VQP Z;  2RT9 A;  3OTO C;  4MRI A;  3I07 A;  3KIF A;  1X3W A;  4E32 A;  1RG9 A;  4NBC A;  2QEX 1;  3LNV A;  3KXW A;  5LMN C;  5IT9 D;  4HPV A;  1MXA A;  1VQK 1;  3CC4 Z;  3GKQ A;  2YU9 I;  2AKL A;  4NBA A;  3A4I A;  5FLX f;  1MDF A;  3VNS A;  1YHQ 1;  3L8C A;  3AF6 A;  3LAX A;  4DR4 C;  1QVF Y;  4NBD A;  3CPW Z;  4IR7 A;  1QM4 A;  2OTJ Z;  3CCU Z;  3CC7 Z;  3GTM S;  3S17 I;  2Q4Z A;  3H3V J;  4AYB A;  1VQ6 Z;  5T64 A;  4DV5 C;  2Y4N A;  3HKZ A;  2E8C A;  3DAY A;  3GKU A;  3MZL B;  1R9T I;  1RNI A;  1S7M A;  2KPI A;  3P5J B;  4PZP A;  3ETO A;  4ODJ A;  2PT7 G;  2WD9 A;  3F3P C;  4ZJZ A;  2E2I I;  4EAT A;  4JYA C;  4DV1 C;  2WAQ A;  1YIJ Z;  4NH1 C;  1WF3 A;  1FUG A;  1USP B;  4DK1 A;  3NI2 A;  3I55 1;  1AMU A;  2IZ3 A;  4KTT A;  2P2M A;  1N2F A;  2ZAE B;  3F3F C;  3GTL I;  1JOS A;  3T4N B;  3CCS 1;  5BSM A;  3B7W A;  4D4I A;  4RS4 A;  1NJI 1;  3GTG I;  2KZF A;  3S1N I;  2QVY X;  2E9H A;  1VQO 1;  3U50 C;  4A3J I;  3CME 1;  1VQP 1;  1QWI A;  4X6A I;  4NOZ A;  3FCE A;  2M48 A;  1Q86 2;  1K8A 1;  4BCA A;  2D7V A;  2D1S A;  1O93 A;  1HNX C;  1M1K 1;  1TWA I;  1Q7Y 2;  1VQ4 Z;  1VQ8 1;  3CD6 Z;  2ONF A;  5E7Q A;  4DV2 C;  2H85 A;  3CC4 1;  4DR5 C;  5GTD A;  2GTH A;  3CMA Z;  3NDI A;  1N36 C;  2O4H A;  4RM2 A;  2E2H I;  2KI7 B;  4BBY A;  2E7G A;  3CCM Z;  4RVO A;  4BSZ A;  1RLY A;  4NBF A;  2R92 I;  1DL6 A;  5AE1 A;  2OTJ 1;  3QWU A;  1W2B Y;  3CCU 1;  2OZK A;  2VZE A;  2D1R A;  3FCC A;  3N2Q A;  4BC7 A;  5BUS A;  1PA4 A;  1VQ6 1;  4A3E I;  4GXR A;  2UUB C;  3VMI A;  4NBG A;  5BUQ A;  2Y0S A;  1M90 2;  1VQ9 Z;  4DGL A;  1YJN 1;  1WII A;  2E5L C;  3VB9 A;  4A3B I;  3GTM I;  4LF5 C;  4EWC A;  4LF4 C;  1O9T A;  1USP A;  2VF1 A;  2W04 A;  2R6M A;  4OYC A;  4D4G A;  1K9M 2;  1KKG A;  2PMZ A;  3LUS A;  1N34 C;  4K0K C;  3J81 b;  3DLP X;  5IFI A;  4JI1 C;  1FJG C;  1P7L A;  3J7A 4;  2V8K A;  2JR6 A;  3T1H C;  5A19 A;  5CZV A;  3GR1 A;  5T67 A;  1O90 A;  3CCQ 1;  3VNR A;  2Q51 A;  1Y1V I;  3I56 1;  3CXC Z;  5BR8 C;  1I3Q I;  2P2B A;  3S1R I;  3OW2 Z;  3J81 D;  4A3F I;  3I4M I;  3TUF A;  2JA6 I;  1O92 A;  1JJ2 Z;  2B63 I;  3CCV Z;  4R0M A;  1KC8 1;  5JRH A;  3JAM f;  4JI3 C;  5D1P A;  3S1Q I;  4MH4 A;  4FTF A;  4IZ6 A;  5K8F A;  4LFC C;  4NBB A;  5T6B A;  4DCV A;  1N8R 2;  2QLV B;  2K3R A;  1Q82 2;  2UXD C;  4FUQ A;  1YJ7 A;  4B3M C;  2PK7 A;  4LFA C;  1YUA A;  5A2Q f;  4A3L I;  3SO4 A;  3IML A;  5C4X I;  1VQL Z;  3CCJ Z;  3CMA 1;  2QL8 A;  2V8J A;  4Y7N I;  1PG4 A;  4DV7 C;  4B3T C;  2LFU A;  1MKY A;  2YWB A;  2DYJ A;  2D1T A;  3BG1 B;  5DV9 A;  3EED A;  4JI4 C;  5BSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...