2BJOA

Crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
b'ALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
publication title Structure of the Bacillus Subtilis Ohrb Hydroperoxide-Resistance Protein in a Fully Oxidized State.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 34
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2bjoA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bjoA02
2JA6I 4JV5C 4JI2C 1RO4A 4A3EI 2E8CA 3S1QI 2DE5A 4BBSI 2EGTA 1YUAA 1N33C 4A3DI 3U50C 1PFTA 2YU9I 3R9XA 3AF6A 2DYJA 1TWHI 3HOVI 2P3YA 3S14I 5C3EI 4BXXI 1WW9A 4JI5C 2VUMI 1I94C 3S2HI 2NVYI 3S1RI 1I50I 3HOYI 4Y7NI 2ASBA 4NBBA 3OTOC 3GTQI 4MH4A 4DCSA 3VB9A 3I07A 2E2HI 2F4VC 2JA7I 2R7ZI 3J80D 1Y1VS 4A3BI 4JI1C 3S1NI 4Y52I 4DUZC 4BBRI 2E8EA 1R9TI 3GTMI 1I6HI 4X66C 3ESWA 4QTUA 2VQFC 4NBHA 3IEVA 4B3MC 1PA4A 2NVXI 2UUBC 1ML8A 3GTKI 1K83I 4YY3C 4DCVA 3GTOI 1N2FA 5C4JI 1IBLC 1XNQC 4DR2C 4DV7C 4JI7C 1KKGA 2PN2A 3M3YI 1L1OC 4X65C 4A3II 1ZB8A 1HNWC 2D7VA 3M4OI 3S15I 3PO3S 4DV6C 1XNRC 4NBEA 3GTPI 3AF5A 5C44I 1N32C 1HH2P 4NXNC 1USPA 4DV2C 3I4MI 2PK7A 5C4XI 1TWGI 2ONFA 2JA5I 2HHHC 4DV3C 4BY1I 1MKYA 3RZDI 3IEUA 2NVQI 2HJGA 4A3FI 4DCUA 4LFBC 1HNZC 2E2JI 3EERA 2XR1A 2E5LC 5IT9D 1USPB 4BSZA 4JI8C 2QL8A 3D6WA 4GKJC 1WH9A 4XX2A 1Y1WI 3H0GI 1L2FA 5IP9I 3VMHA 4AQYC 2E7GA 4LF5C 3GKUA 4DV5C 5CM2M 4BY7I 4DR7C 4K0KC 4JI6C 2RBLA 4NBFA 2UXDC 2JR6A 1HNXC 3GCFA 4B3RC 3GTGI 3J81D 5FLXD 3GTLI 1TWAI 5LMUC 3R9WA 2JMPA 3Q87A 1TWFI 1TFIA 1EGAA 4LFCC 3S2DI 1SFOI 1I3QI 4JYAC 2JA8I 1RLYA 2K5RA 2UUCC 1LQLA 3HOWI 3VMGA 4DV4C 2B63I 1NYEA 2DE7A 2F4MA 3VMIA 3LUSA 2JNYA 3S1MI 4A3CI 4LF6C 4KHPC 4DUYC 2YCBA 2NVTI 1K0RA 2E2II 1WF3A 1X3WA 3S17I 1XMOC 4DR3C 2KZFA 1JOSA 1IBMC 4NBDA 4DR4C 1IBKC 3K7AI 1NUIA 3PO2I 2BJOA 4NB8A 4A3KI 1N34C 1DL6A 2CY1A 5FLMI 2ATWA 2R92I 1WCMI 5IP7I 4JI0C 1QYPA 4NOZA 3JAMD 4JI3C 2UXBC 3HOUI 4DR1C 3RZOI 1QWIA 2JS4A 5LMNC 2UUAC 3FKII 1Y1VI 2OPLB 3HOZI 3CJEA 2F4OA 3I4NI 3T1YC 4X6AI 2J6AA 4B3TC 4B3SC 2VQEC 2UXCC 4LFAC 1N36C 3GTJI 2HF1A 4A3JI 4A93I 4GKKC 4X64C 1VLAA 3S16I 1UKKA 5A2QD 4X62C 4JI4C 4YHHC 4LF9C 1X3ZA 4MTNA 3HOXI 4LF7C 2AKLA 1TWCI 4A3GI 4A3LI 3PO3I 1ZB9A 4LF4C 1XMQC 3CQZI 2E8FA 5IWAC 4A3MI 3H3VJ 2PT7G 2UU9C 2R93I 2DE6A 4NXMC 4DR5C 3GTMS 2CXCA 3GKQA 5BR8C 1HR0C 1FJGC 1J5EC 4DR6C 4DCTA 4OX9C 4NBCA 2ZM6C 4NB9A 4DV1C 4NBAA 2KPIA 4DV0C 4QTTA 2OPLA 3T1HC 4NBGA 4LF8C
chains in the Genus database with same CATH superfamily
4PROC 2JA6I 3NYRA 4JV5C 2Y27A 4JI2C 4IR7A 1RO4A 3I561 4D4GA 5DV9A 4A3EI 4E33A 1VQ4Z 2E8CA 4KTTA 4CL1A 3S1QI 2DE5A 4BCAA 5A2Qf 4BBSI 2EGTA 2D1RA 1YUAA 1VQ61 1YI2Z 4MD8A 1KQSY 1N33C 2P20A 3TE5B 3E7XA 4A3DI 4GS5A 1AA6A 3A9VA 1VQ71 3U50C 1X0TA 4I9GA 1PFTA 2YU9I 3NYQA 3R9XA 3AF6A 2P2BA 2V3VA 2Y4NA 2V8IA 1XRCA 5BSUA 3CQ3A 2RT9A 3CC21 2DYJA 4PHTA 5KYTA 2D1TA 2OTJZ 1K732 1K9M1 1WIIA 3CCVZ 1TWHI 3HOVI 1MXBA 2P3YA 4RV9A 3S14I 1VQOZ 4PUGA 3O2EA 3JAMb 5GTDA 2OTLZ 2YWBA 3G4S1 5C3EI 4BXXI 3KIFA 2D27A 1JWHC 1XRBA 3A25A 5BSVA 1WW9A 3CCQ1 4JI5C 3PBKA 2VUMI 1I94C 3S2HI 2NVYI 2GTIA 3TDHB 3MZKB 3I56Z 3S1RI 2Z51A 5D1OA 3B7WA 3E7WA 2BH1X 2HU9A 2JIQA 1AMUA 2WAQA 1I50I 3HOYI 4Y7NI 5T6BA 3J7A4 4WS9A 2ASBA 4NBBA 3OTOC 3GTQI 2QR1B 4MH4A 4DCSA 1M901 3H2TA 4RMNA 3VB9A 3I07A 3CCS1 2E2HI 2F4VC 2QVZX 4E30A 2JA7I 2R7ZI 1VQ7Z 2Y4OA 2IV2X 1Q7Y1 3VNSA 4MONA 1WJ2A 3J80D 4RS4A 4E2WA 3TR3A 4E2XA 1Y1VS 4PUHA 2LIYA 1O93A 4A3BI 4RLQA 4RVHA 3I551 3CC2Z 3GR0A 4JI1C 3S1NI 1Q861 1V26A 1Z01A 5A2Qb 4Y52I 4BC7A 4DUZC 4BBRI 2E8EA 2QRCB 1JJ2Z 1YIT1 1R9TI 3GTMI 1I6HI 4X66C 3ESWA 4DQYB 1Z02A 3G4SZ 4QTUA 1IB8A 5E7QA 1MXCA 2VQFC 4NBHA 3IEVA 2WP0C 3AY0A 4B3MC 3CCQZ 3CCR1 1M6XA 1VQK1 1PA4A 3A9UA 2NVXI 2UUBC 1ML8A 3P5JB 3GTKI 5D1OB 5AE1A 1VQL1 1K83I 2PROA 4YY3C 3GTOI 4DCVA 5BUSA 3S82A 1N2FA 5C4JI 2KZ0A 1FLOA 1IBLC 2YX1A 3UOWA 1XNQC 5LL6f 3BG1B 4DR2C 3IX0A 2V45A 4DV7C 2RIQA 1S721 4RVDA 4KTVA 1JJ2Y 2D1QA 5BSWA 2D1SA 5BSRA 1YHQ1 4JI7C 1KKGA 2WD9A 2PN2A 1FUGA 3M3YI 1L1OC 4E2YA 3C5EA 1Q821 4X65C 1NP6A 1ZB8A 4A3II 3CCSZ 5KYVA 1HNWC 2D7VA 3M4OI 3S15I 5IT9f 3PO3S 4MRIA 4NDNA 4DV6C 5K8FA 3CPWY 1XNRC 2OOYB 4NBEA 1KD11 2JIOA 3MONA 3GTPI 1MDBA 3CQ2A 5A1GA 5ADZA 2QA41 3AF5A 4DK1A 5C44I 1HH2P 4NXNC 1RO2A 3I55Z 1N32C 4AYBA 1USPA 1YJ91 5LCIA 1Q812 4L7IA 1RO0A 4DV2C 3I4MI 4WV3A 4LF8C 1YITZ 2PK7A 4NFRA 3UEBA 5BURA 5C4XI 3N54B 1TWGI 2OOXB 2ONFA 2JA5I 2HHHC 2V8KA 3L95X 1XRAA 1RY2A 1VQM1 2E0GA 3CCRZ 1VQKZ 1MDFA 1P4EA 1VQ81 4TNUA 3G711 4DV3C 2VSQA 4D4IA 1VQLZ 3J80f 3DAYA 4BY1I 1MKYA 3FQMA 4BBYA 3RZDI 5CZVA 4OXIA 3IEUA 3N2QA 2NVQI 5T8SA 4RLFA 2HJGA 2Q51A 1LCIA 1QVFZ 3CXCZ 4A3FI 1S72Z 3NPDA 4DCUA 3DHVA 1YHQZ 4LFBC 2O4HA 3G6EZ 3UX3A 1HNZC 3KIHA 4L2ZA 2E2JI 3EERA 2XR1A 3CCE1 3IF8A 1VEHA 2E5LC 1K8A1 4ISBA 1K731 5IT9D 3CCM1 4G36A 2Q4ZA 2E7ZA 1USPB 2VPWA 2QA4Z 1W2BZ 4G1IA 2KI7B 3BG0B 4BSZA 4JI8C 1YJ9Z 4DG9A 5K85A 3NDIA 2QL8A 3CXCY 3D6WA 4GKJC 2K3RA 3NFZA 1WH9A 2MM9A 3HKZA 4MXUA 4XX2A 2RHBA 2P02A 3ETOA 3LNOA 1Y1WI 3H0GI 4E32A 1VQMZ 5BSMA 1M1K1 5IT9b 1VQ8Z 1L2FA 5IP9I 3G71Z 2JIMA 2WB1A 3VMHA 2JMOA 4G37A 2D28C 3FCEA 2ZZMA 1NJI1 2JIRA 3TQIA 1GPMA 4RVNA 3NDJA 3IMLA 4AQYC 4ZJZA 2E7GA 1WZNA 3D9XA 4LF5C 2LFUA 3GKUA 4DV5C 1QF8A 1O90A 3SO4A 5CM2M 4BY7I 2VF1A 4LE5A 1MD9A 5H9UA 3FQQA 4DR7C 4K0KC 1YJW1 3L8CA 4JI6C 3CCEZ 2QRDB 3IPLA 1Z03A 2RBLA 3CCL1 2ZAEB 4NBFA 1N8R1 2M5OA 4MD7A 1NY8A 2UXDC 2JR6A 1HNXC 1P9NA 3J80b 3GCFA 3EQ6A 3CCMZ 3CCJ1 4B3RC 1VQP1 1KRLA 4E2ZA 3GTGI 4U5YD 2MMAB 3J81D 4E31A 2H85A 5FLXD 2QLVB 3GTLI 1TWAI 3I08A 5LMUC 3NI2A 4K0BA 1KC81 3R9WA 1P7LA 2VUGA 1VQ51 2JMPA 1FDOA 3IFUA 1VQ91 4RVOA 3Q87A 1TWFI 1TFIA 3TDEA 4OYCA 1QVGZ 1EGAA 4LFCC 3PESA 5IFIA 3UX2A 4HH4A 3ETCA 1QXFA 3S2DI 3G6E1 1SFOI 4TPSB 1I3QI 2V8JA 4JYAC 2IZ4A 2JA8I 1RLYA 2K5RA 2PM9A 2UUCC 4L4QA 1LQLA 3HOWI 3VMGA 4NH1C 4GXRA 4D57A 1RQFA 4DV4C 3OW2Z 2B63I 2YWCA 1NYEA 1YJN1 2DE7A 2OZKA 1Q822 1Y8CA 2F4MA 2MCQA 3DLPX 3VMIA 4FUTA 4S1TA 3LUSA 2JNYA 2VPZA 3S1MI 2GU2A 3NH5A 3CD61 1ZH1A 1KD12 1MXAA 3UZ0A 4A3CI 3F3PC 3CC71 1YJWZ 4LF6C 4KHPC 1PU1A 4DUYC 2YCBA 3CCLZ 2NVTI 2E2II 1K0RA 1KQSZ 2QREB 1WF3A 4JM1A 1M6XC 1Q811 1X3WA 3S17I 3CCU1 1XMOC 5CZXA 5T64A 3CCJZ 4DR3C 1VQPZ 1S7MA 2KZFA 1JOSA 3LNVA 2QW0X 1IBMC 4NBDA 1V25A 2V7BA 4DR4C 1VQN1 1IBKC 3K7AI 4BC9A 1NUIA 3CC41 1VQ5Z 1VQ9Z 2JNVA 1FDIA 2P28A 1UWDA 3PO2I 5A1IA 1YJ7A 2BJOA 4MD9A 1RG9A 2G2KA 4NB8A 4RVGA 3FCCA 3G7SA 2AYDA 4A3KI 4ZLPA 1N34C 1DL6A 2RPRA 5JRHA 4HPVA 2CY1A 5FLMI 2ATWA 2R6MA 2R92I 4DGLA 1WCMI 5IP7I 4JI0C 1QYPA 4NOZA 3JAMD 4JI3C 2UXBC 2GTHA 5AN9F 1YJNZ 3J81f 1K9M2 3HOUI 1O9TA 3RG2A 4R0MA 5FLXf 3MZLB 2P2FA 5KEIA 4DR1C 4HGZA 3RZOI 3T4NB 1QWIA 2JUBA 2JS4A 5LMNC 2UUAC 2PMZA 2M5HA 3TUFA 2I3CA 1TH5A 1K8A2 2W03A 1BA3A 3CD6Z 1QVFY 1SIWA 2W04A 3FKII 2P2MA 3LGXA 3CQ1A 3CC7Z 3A4IA 1Y1VI 2M48A 1P4EC 4HGYA 2OPLB 3CW9A 1V60A 3HOZI 3CJEA 1RNIA 2F4OA 3CMAZ 3I4NI 3CCUZ 4X6AI 2DPLA 3PROC 3RV2A 3T1YC 1T5DX 2J6AA 2LEXA 1ULTA 2YADA 4B3TC 3VNQA 3KXWA 2P2QA 4B3SC 2VQEC 1VQNZ 2UXCC 1W2BY 4LFAC 5D1PA 1N36C 3GTJI 1M1K2 3CME1 2HF1A 3CC4Z 4A3JI 1YIJ1 1M902 4A93I 4GKKC 2E9HA 3F3FC 4X64C 4R1LA 2Y0SA 1VLAA 3S16I 2DHMA 2JIPA 1Q7Y2 1NJI2 1UKKA 4GXQA 1VQ6Z 5A2QD 3D2LA 2QEX1 4X62C 2CU6A 2VZEA 4RM3A 3A26A 4ODJA 4JI4C 1Q862 4YHHC 4LF9C 1X3ZA 5BUQA 2NAPA 1Q16A 3NH8A 4MTNA 2VPXA 3HOXI 4LF7C 2P2JA 3R44A 2AKLA 1YUKA 1N8R2 1TWCI 3GPCA 4A3GI 4A3LI 3VNRA 3PO3I 1ZB9A 5AE3A 4LF4C 5BSTA 1VQ41 1XMQC 2KDNA 1XS3A 3CQZI 2E8FA 2ZZNA 4I9FA 5IWAC 3QWUA 2VPYA 4D56A 4A3MI 3H3VJ 1PG4A 2PT7G 1KC82 1YI21 3JAMf 2UU9C 1QM4A 4IZ6A 3J81b 2OBVA 3CPWZ 5FLXb 2QKDA 2R93I 3VTNA 5T67A 4PZPA 2DE6A 4FUQA 4NXMC 4EWCA 5T8TA 3K6RA 4DR5C 3GTMS 3CMEZ 3IR7A 2CXCA 3GKQA 1YIJZ 3NH4A 2OO4A 5BR8C 1HR0C 1WCJA 3GR1A 1FJGC 1PG3A 4R1MA 1J5EC 4RVFA 4DG8A 4DR6C 2IZ3A 2NCLA 3EEDA 4DCTA 2M6NA 4FTFA 3LAXA 4OX9C 4EATA 4NBCA 1T5HX 2ZM6C 2OTJ1 2QEXZ 3CCV1 4NB9A 1QVGY 4DV1C 4NBAA 1VQO1 5AE2A 1O92A 2OTL1 2KPIA 4DV0C 4QTTA 1XHJA 4PUIA 2AYAA 3CMA1 3CW8X 2OPLA 2QVYX 3T1HC 4NBGA 4RM2A 3OW2Y 2QVXX 5A19A 2O53A
chains in the Genus database with same CATH topology
4PROC 2JA6I 3NYRA 4JV5C 2Y27A 4JI2C 4IR7A 1RO4A 3I561 4D4GA 5DV9A 4A3EI 4E33A 1VQ4Z 2E8CA 4KTTA 4CL1A 3S1QI 2DE5A 4BCAA 5A2Qf 4BBSI 2EGTA 2D1RA 1YUAA 1VQ61 1YI2Z 4MD8A 1KQSY 1N33C 2P20A 3TE5B 3E7XA 4A3DI 4GS5A 3A9VA 1VQ71 3U50C 1X0TA 4I9GA 1PFTA 2YU9I 3NYQA 3R9XA 3AF6A 2P2BA 2Y4NA 2V8IA 1XRCA 5BSUA 2RT9A 3CC21 2DYJA 4PHTA 5KYTA 2D1TA 2OTJZ 1K732 1K9M1 1WIIA 3CCVZ 1TWHI 3HOVI 1MXBA 2P3YA 4RV9A 3S14I 1VQOZ 3JAMb 5GTDA 2OTLZ 2YWBA 3G4S1 5C3EI 4BXXI 3KIFA 2D27A 1JWHC 1XRBA 5BSVA 1WW9A 3CCQ1 4JI5C 3PBKA 2VUMI 1I94C 3S2HI 2NVYI 2GTIA 3TDHB 3MZKB 3I56Z 3S1RI 5D1OA 3B7WA 3E7WA 2BH1X 2HU9A 1AMUA 2WAQA 1I50I 3HOYI 4Y7NI 5T6BA 3J7A4 4WS9A 2ASBA 4NBBA 3OTOC 3GTQI 2QR1B 4MH4A 4DCSA 1M901 3H2TA 4RMNA 3VB9A 3I07A 3CCS1 2E2HI 2F4VC 2QVZX 4E30A 2JA7I 2R7ZI 1VQ7Z 2Y4OA 1Q7Y1 3VNSA 4MONA 3J80D 4RS4A 4E2WA 4E2XA 1Y1VS 2LIYA 1O93A 4A3BI 4RLQA 4RVHA 3I551 3CC2Z 3GR0A 4JI1C 3S1NI 1Q861 1V26A 1Z01A 5A2Qb 4Y52I 4BC7A 4DUZC 4BBRI 2E8EA 2QRCB 1JJ2Z 1YIT1 1R9TI 3GTMI 1I6HI 4X66C 3ESWA 4DQYB 1Z02A 3G4SZ 4QTUA 5E7QA 1MXCA 2VQFC 4NBHA 3IEVA 2WP0C 4B3MC 3CCQZ 3CCR1 1VQK1 1PA4A 3A9UA 2NVXI 2UUBC 1ML8A 3P5JB 3GTKI 5D1OB 5AE1A 1VQL1 1K83I 2PROA 4YY3C 3GTOI 4DCVA 5BUSA 3S82A 1N2FA 5C4JI 1IBLC 1XNQC 3UOWA 5LL6f 3BG1B 4DR2C 3IX0A 4DV7C 2RIQA 1S721 4RVDA 4KTVA 1JJ2Y 2D1QA 5BSWA 2D1SA 5BSRA 1YHQ1 4JI7C 1KKGA 2WD9A 2PN2A 1FUGA 3M3YI 1L1OC 4E2YA 3C5EA 1Q821 4X65C 1NP6A 1ZB8A 4A3II 3CCSZ 5KYVA 1HNWC 2D7VA 3M4OI 3S15I 5IT9f 3PO3S 4MRIA 4NDNA 4DV6C 5K8FA 3CPWY 1XNRC 2OOYB 4NBEA 1KD11 3GTPI 3MONA 5A1GA 1MDBA 5ADZA 2QA41 3AF5A 4DK1A 5C44I 1HH2P 4NXNC 1RO2A 3I55Z 1N32C 4AYBA 1USPA 1YJ91 1Q812 4L7IA 1RO0A 4DV2C 3I4MI 4WV3A 4LF8C 1YITZ 2PK7A 4NFRA 5BURA 5C4XI 3N54B 1TWGI 2OOXB 2ONFA 2JA5I 2HHHC 2V8KA 3L95X 1XRAA 1RY2A 1VQM1 2E0GA 3CCRZ 1VQKZ 1MDFA 1VQ81 4TNUA 3G711 4DV3C 2VSQA 4D4IA 1VQLZ 3J80f 3DAYA 4BY1I 1MKYA 3FQMA 4BBYA 3RZDI 5CZVA 4OXIA 3IEUA 3N2QA 2NVQI 5T8SA 4RLFA 2HJGA 2Q51A 1LCIA 1QVFZ 3CXCZ 4A3FI 1S72Z 3NPDA 4DCUA 3DHVA 1YHQZ 4LFBC 2O4HA 3G6EZ 1HNZC 3KIHA 4L2ZA 2E2JI 3EERA 2XR1A 3CCE1 3IF8A 2E5LC 1K8A1 4ISBA 1K731 5IT9D 3CCM1 4G36A 2Q4ZA 1USPB 2QA4Z 4G1IA 1W2BZ 2KI7B 3BG0B 4BSZA 4JI8C 1YJ9Z 4DG9A 5K85A 3NDIA 2QL8A 3CXCY 3D6WA 4GKJC 2K3RA 3NFZA 1WH9A 3HKZA 4MXUA 4XX2A 2RHBA 2P02A 3ETOA 1Y1WI 3H0GI 4E32A 1VQMZ 5BSMA 1M1K1 5IT9b 1VQ8Z 1L2FA 5IP9I 3G71Z 2WB1A 3VMHA 2JMOA 4G37A 2D28C 3FCEA 1NJI1 3TQIA 1GPMA 4RVNA 3NDJA 3IMLA 4AQYC 4ZJZA 2E7GA 3D9XA 4LF5C 2LFUA 3GKUA 4DV5C 1QF8A 1O90A 3SO4A 5CM2M 4BY7I 2VF1A 4LE5A 1MD9A 5H9UA 3FQQA 4DR7C 4K0KC 1YJW1 3L8CA 4JI6C 3CCEZ 2QRDB 3IPLA 1Z03A 2RBLA 3CCL1 2ZAEB 4NBFA 1N8R1 4MD7A 2UXDC 2JR6A 1HNXC 1P9NA 3J80b 3GCFA 3EQ6A 3CCMZ 3CCJ1 4B3RC 1VQP1 1KRLA 4E2ZA 3GTGI 4U5YD 3J81D 4E31A 2H85A 5FLXD 2QLVB 3GTLI 1TWAI 3I08A 5LMUC 3NI2A 4K0BA 1KC81 3R9WA 1P7LA 2VUGA 1VQ51 2JMPA 4RVOA 3IFUA 1VQ91 3Q87A 1TWFI 1TFIA 3TDEA 4OYCA 1QVGZ 1EGAA 4LFCC 3PESA 5IFIA 4HH4A 3ETCA 3S2DI 3G6E1 1SFOI 4TPSB 1I3QI 2V8JA 4JYAC 2IZ4A 2JA8I 1RLYA 2K5RA 2PM9A 2UUCC 4L4QA 1LQLA 3HOWI 3VMGA 4NH1C 4GXRA 4D57A 1RQFA 4DV4C 3OW2Z 2B63I 2YWCA 1NYEA 1YJN1 2DE7A 2OZKA 1Q822 2F4MA 3DLPX 3VMIA 4FUTA 4S1TA 3LUSA 2JNYA 3S1MI 2GU2A 3NH5A 3CD61 1ZH1A 1KD12 1MXAA 3UZ0A 4A3CI 3F3PC 3CC71 1YJWZ 4LF6C 4KHPC 4DUYC 2YCBA 3CCLZ 2NVTI 2E2II 1K0RA 1KQSZ 2QREB 1WF3A 4JM1A 1Q811 1X3WA 3S17I 3CCU1 1XMOC 5CZXA 5T64A 3CCJZ 4DR3C 1VQPZ 1S7MA 2KZFA 1JOSA 3LNVA 2QW0X 1IBMC 4NBDA 1V25A 2V7BA 4DR4C 1VQN1 1IBKC 3K7AI 4BC9A 1NUIA 3CC41 1VQ5Z 1VQ9Z 2P28A 5A1IA 3PO2I 1YJ7A 2BJOA 4MD9A 1RG9A 2G2KA 4NB8A 4RVGA 3FCCA 3G7SA 4A3KI 4ZLPA 1N34C 1DL6A 2RPRA 5JRHA 4HPVA 2CY1A 5FLMI 2ATWA 2R6MA 2R92I 4DGLA 1WCMI 5IP7I 4JI0C 1QYPA 4NOZA 3JAMD 4JI3C 2UXBC 2GTHA 5AN9F 1YJNZ 3J81f 1K9M2 3HOUI 1O9TA 3RG2A 4R0MA 5FLXf 3MZLB 2P2FA 5KEIA 4DR1C 4HGZA 3RZOI 3T4NB 1QWIA 2JUBA 2JS4A 5LMNC 2UUAC 2PMZA 3TUFA 2I3CA 1K8A2 2W03A 1BA3A 3CD6Z 1QVFY 2W04A 3FKII 2P2MA 3LGXA 3CC7Z 3A4IA 1Y1VI 2M48A 4HGYA 2OPLB 3CW9A 3HOZI 3CJEA 1RNIA 2F4OA 3CMAZ 3I4NI 3CCUZ 4X6AI 2DPLA 3PROC 3RV2A 3T1YC 1T5DX 2J6AA 1ULTA 2YADA 4B3TC 3VNQA 3KXWA 2P2QA 4B3SC 2VQEC 1VQNZ 2UXCC 1W2BY 4LFAC 5D1PA 1N36C 3GTJI 1M1K2 3CME1 2HF1A 3CC4Z 4A3JI 1YIJ1 1M902 4A93I 4GKKC 2E9HA 3F3FC 4X64C 4R1LA 2Y0SA 1VLAA 3S16I 1Q7Y2 1UKKA 1NJI2 4GXQA 1VQ6Z 5A2QD 4X62C 2QEX1 2VZEA 4RM3A 4ODJA 4JI4C 1Q862 4YHHC 4LF9C 1X3ZA 5BUQA 3NH8A 4MTNA 3HOXI 4LF7C 2P2JA 3R44A 2AKLA 1YUKA 1N8R2 1TWCI 3GPCA 4A3GI 4A3LI 3VNRA 3PO3I 1ZB9A 5AE3A 4LF4C 5BSTA 1VQ41 1XMQC 3CQZI 2E8FA 4I9FA 5IWAC 3QWUA 4D56A 4A3MI 3H3VJ 1PG4A 2PT7G 1KC82 1YI21 3JAMf 2UU9C 1QM4A 4IZ6A 3J81b 2OBVA 3CPWZ 5FLXb 2QKDA 2R93I 3VTNA 5T67A 4PZPA 2DE6A 4FUQA 4NXMC 4EWCA 5T8TA 4DR5C 3GTMS 3CMEZ 2CXCA 3GKQA 1YIJZ 3NH4A 2OO4A 5BR8C 1HR0C 3GR1A 1FJGC 1PG3A 4R1MA 1J5EC 4RVFA 4DG8A 4DR6C 2IZ3A 3EEDA 4DCTA 2M6NA 4FTFA 3LAXA 4OX9C 4EATA 4NBCA 1T5HX 2ZM6C 2OTJ1 2QEXZ 3CCV1 4NB9A 1QVGY 4DV1C 4NBAA 1VQO1 5AE2A 1O92A 2OTL1 2KPIA 4DV0C 4QTTA 2AYAA 3CMA1 3CW8X 2OPLA 2QVYX 3T1HC 4NBGA 4RM2A 3OW2Y 2QVXX 5A19A 2O53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 I;  4JV5 C;  4JI2 C;  1RO4 A;  4A3E I;  2E8C A;  3S1Q I;  2DE5 A;  4BBS I;  2EGT A;  1YUA A;  1N33 C;  4A3D I;  3U50 C;  1PFT A;  2YU9 I;  3R9X A;  3AF6 A;  2DYJ A;  1TWH I;  3HOV I;  2P3Y A;  3S14 I;  5C3E I;  4BXX I;  1WW9 A;  4JI5 C;  2VUM I;  1I94 C;  3S2H I;  2NVY I;  3S1R I;  1I50 I;  3HOY I;  4Y7N I;  2ASB A;  4NBB A;  3OTO C;  3GTQ I;  4MH4 A;  4DCS A;  3VB9 A;  3I07 A;  2E2H I;  2F4V C;  2JA7 I;  2R7Z I;  3J80 D;  1Y1V S;  4A3B I;  4JI1 C;  3S1N I;  4Y52 I;  4DUZ C;  4BBR I;  2E8E A;  1R9T I;  3GTM I;  1I6H I;  4X66 C;  3ESW A;  4QTU A;  2VQF C;  4NBH A;  3IEV A;  4B3M C;  1PA4 A;  2NVX I;  2UUB C;  1ML8 A;  3GTK I;  1K83 I;  4YY3 C;  4DCV A;  3GTO I;  1N2F A;  5C4J I;  1IBL C;  1XNQ C;  4DR2 C;  4DV7 C;  4JI7 C;  1KKG A;  2PN2 A;  3M3Y I;  1L1O C;  4X65 C;  4A3I I;  1ZB8 A;  1HNW C;  2D7V A;  3M4O I;  3S15 I;  3PO3 S;  4DV6 C;  1XNR C;  4NBE A;  3GTP I;  3AF5 A;  5C44 I;  1N32 C;  1HH2 P;  4NXN C;  1USP A;  4DV2 C;  3I4M I;  2PK7 A;  5C4X I;  1TWG I;  2ONF A;  2JA5 I;  2HHH C;  4DV3 C;  4BY1 I;  1MKY A;  3RZD I;  3IEU A;  2NVQ I;  2HJG A;  4A3F I;  4DCU A;  4LFB C;  1HNZ C;  2E2J I;  3EER A;  2XR1 A;  2E5L C;  5IT9 D;  1USP B;  4BSZ A;  4JI8 C;  2QL8 A;  3D6W A;  4GKJ C;  1WH9 A;  4XX2 A;  1Y1W I;  3H0G I;  1L2F A;  5IP9 I;  3VMH A;  4AQY C;  2E7G A;  4LF5 C;  3GKU A;  4DV5 C;  5CM2 M;  4BY7 I;  4DR7 C;  4K0K C;  4JI6 C;  2RBL A;  4NBF A;  2UXD C;  2JR6 A;  1HNX C;  3GCF A;  4B3R C;  3GTG I;  3J81 D;  5FLX D;  3GTL I;  1TWA I;  5LMU C;  3R9W A;  2JMP A;  3Q87 A;  1TWF I;  1TFI A;  1EGA A;  4LFC C;  3S2D I;  1SFO I;  1I3Q I;  4JYA C;  2JA8 I;  1RLY A;  2K5R A;  2UUC C;  1LQL A;  3HOW I;  3VMG A;  4DV4 C;  2B63 I;  1NYE A;  2DE7 A;  2F4M A;  3VMI A;  3LUS A;  2JNY A;  3S1M I;  4A3C I;  4LF6 C;  4KHP C;  4DUY C;  2YCB A;  2NVT I;  1K0R A;  2E2I I;  1WF3 A;  1X3W A;  3S17 I;  1XMO C;  4DR3 C;  2KZF A;  1JOS A;  1IBM C;  4NBD A;  4DR4 C;  1IBK C;  3K7A I;  1NUI A;  3PO2 I;  2BJO A;  4NB8 A;  4A3K I;  1N34 C;  1DL6 A;  2CY1 A;  5FLM I;  2ATW A;  2R92 I;  1WCM I;  5IP7 I;  4JI0 C;  1QYP A;  4NOZ A;  3JAM D;  4JI3 C;  2UXB C;  3HOU I;  4DR1 C;  3RZO I;  1QWI A;  2JS4 A;  5LMN C;  2UUA C;  3FKI I;  1Y1V I;  2OPL B;  3HOZ I;  3CJE A;  2F4O A;  3I4N I;  3T1Y C;  4X6A I;  2J6A A;  4B3T C;  4B3S C;  2VQE C;  2UXC C;  4LFA C;  1N36 C;  3GTJ I;  2HF1 A;  4A3J I;  4A93 I;  4GKK C;  4X64 C;  1VLA A;  3S16 I;  1UKK A;  5A2Q D;  4X62 C;  4JI4 C;  4YHH C;  4LF9 C;  1X3Z A;  4MTN A;  3HOX I;  4LF7 C;  2AKL A;  1TWC I;  4A3G I;  4A3L I;  3PO3 I;  1ZB9 A;  4LF4 C;  1XMQ C;  3CQZ I;  2E8F A;  5IWA C;  4A3M I;  3H3V J;  2PT7 G;  2UU9 C;  2R93 I;  2DE6 A;  4NXM C;  4DR5 C;  3GTM S;  2CXC A;  3GKQ A;  5BR8 C;  1HR0 C;  1FJG C;  1J5E C;  4DR6 C;  4DCT A;  4OX9 C;  4NBC A;  2ZM6 C;  4NB9 A;  4DV1 C;  4NBA A;  2KPI A;  4DV0 C;  4QTT A;  2OPL A;  3T1H C;  4NBG A;  4LF8 C; 
#chains in the Genus database with same CATH topology
 4PRO C;  2JA6 I;  3NYR A;  4JV5 C;  2Y27 A;  4JI2 C;  4IR7 A;  1RO4 A;  3I56 1;  4D4G A;  5DV9 A;  4A3E I;  4E33 A;  1VQ4 Z;  2E8C A;  4KTT A;  4CL1 A;  3S1Q I;  2DE5 A;  4BCA A;  5A2Q f;  4BBS I;  2EGT A;  2D1R A;  1YUA A;  1VQ6 1;  1YI2 Z;  4MD8 A;  1KQS Y;  1N33 C;  2P20 A;  3TE5 B;  3E7X A;  4A3D I;  4GS5 A;  1AA6 A;  3A9V A;  1VQ7 1;  3U50 C;  1X0T A;  4I9G A;  1PFT A;  2YU9 I;  3NYQ A;  3R9X A;  3AF6 A;  2P2B A;  2V3V A;  2Y4N A;  2V8I A;  1XRC A;  5BSU A;  3CQ3 A;  2RT9 A;  3CC2 1;  2DYJ A;  4PHT A;  5KYT A;  2D1T A;  2OTJ Z;  1K73 2;  1K9M 1;  1WII A;  3CCV Z;  1TWH I;  3HOV I;  1MXB A;  2P3Y A;  4RV9 A;  3S14 I;  1VQO Z;  4PUG A;  3O2E A;  3JAM b;  5GTD A;  2OTL Z;  2YWB A;  3G4S 1;  5C3E I;  4BXX I;  3KIF A;  2D27 A;  1JWH C;  1XRB A;  3A25 A;  5BSV A;  1WW9 A;  3CCQ 1;  4JI5 C;  3PBK A;  2VUM I;  1I94 C;  3S2H I;  2NVY I;  2GTI A;  3TDH B;  3MZK B;  3I56 Z;  3S1R I;  2Z51 A;  5D1O A;  3B7W A;  3E7W A;  2BH1 X;  2HU9 A;  2JIQ A;  1AMU A;  2WAQ A;  1I50 I;  3HOY I;  4Y7N I;  5T6B A;  3J7A 4;  4WS9 A;  2ASB A;  4NBB A;  3OTO C;  3GTQ I;  2QR1 B;  4MH4 A;  4DCS A;  1M90 1;  3H2T A;  4RMN A;  3VB9 A;  3I07 A;  3CCS 1;  2E2H I;  2F4V C;  2QVZ X;  4E30 A;  2JA7 I;  2R7Z I;  1VQ7 Z;  2Y4O A;  2IV2 X;  1Q7Y 1;  3VNS A;  4MON A;  1WJ2 A;  3J80 D;  4RS4 A;  4E2W A;  3TR3 A;  4E2X A;  1Y1V S;  4PUH A;  2LIY A;  1O93 A;  4A3B I;  4RLQ A;  4RVH A;  3I55 1;  3CC2 Z;  3GR0 A;  4JI1 C;  3S1N I;  1Q86 1;  1V26 A;  1Z01 A;  5A2Q b;  4Y52 I;  4BC7 A;  4DUZ C;  4BBR I;  2E8E A;  2QRC B;  1JJ2 Z;  1YIT 1;  1R9T I;  3GTM I;  1I6H I;  4X66 C;  3ESW A;  4DQY B;  1Z02 A;  3G4S Z;  4QTU A;  1IB8 A;  5E7Q A;  1MXC A;  2VQF C;  4NBH A;  3IEV A;  2WP0 C;  3AY0 A;  4B3M C;  3CCQ Z;  3CCR 1;  1M6X A;  1VQK 1;  1PA4 A;  3A9U A;  2NVX I;  2UUB C;  1ML8 A;  3P5J B;  3GTK I;  5D1O B;  5AE1 A;  1VQL 1;  1K83 I;  2PRO A;  4YY3 C;  3GTO I;  4DCV A;  5BUS A;  3S82 A;  1N2F A;  5C4J I;  2KZ0 A;  1FLO A;  1IBL C;  2YX1 A;  3UOW A;  1XNQ C;  5LL6 f;  3BG1 B;  4DR2 C;  3IX0 A;  2V45 A;  4DV7 C;  2RIQ A;  1S72 1;  4RVD A;  4KTV A;  1JJ2 Y;  2D1Q A;  5BSW A;  2D1S A;  5BSR A;  1YHQ 1;  4JI7 C;  1KKG A;  2WD9 A;  2PN2 A;  1FUG A;  3M3Y I;  1L1O C;  4E2Y A;  3C5E A;  1Q82 1;  4X65 C;  1NP6 A;  1ZB8 A;  4A3I I;  3CCS Z;  5KYV A;  1HNW C;  2D7V A;  3M4O I;  3S15 I;  5IT9 f;  3PO3 S;  4MRI A;  4NDN A;  4DV6 C;  5K8F A;  3CPW Y;  1XNR C;  2OOY B;  4NBE A;  1KD1 1;  2JIO A;  3MON A;  3GTP I;  1MDB A;  3CQ2 A;  5A1G A;  5ADZ A;  2QA4 1;  3AF5 A;  4DK1 A;  5C44 I;  1HH2 P;  4NXN C;  1RO2 A;  3I55 Z;  1N32 C;  4AYB A;  1USP A;  1YJ9 1;  5LCI A;  1Q81 2;  4L7I A;  1RO0 A;  4DV2 C;  3I4M I;  4WV3 A;  4LF8 C;  1YIT Z;  2PK7 A;  4NFR A;  3UEB A;  5BUR A;  5C4X I;  3N54 B;  1TWG I;  2OOX B;  2ONF A;  2JA5 I;  2HHH C;  2V8K A;  3L95 X;  1XRA A;  1RY2 A;  1VQM 1;  2E0G A;  3CCR Z;  1VQK Z;  1MDF A;  1P4E A;  1VQ8 1;  4TNU A;  3G71 1;  4DV3 C;  2VSQ A;  4D4I A;  1VQL Z;  3J80 f;  3DAY A;  4BY1 I;  1MKY A;  3FQM A;  4BBY A;  3RZD I;  5CZV A;  4OXI A;  3IEU A;  3N2Q A;  2NVQ I;  5T8S A;  4RLF A;  2HJG A;  2Q51 A;  1LCI A;  1QVF Z;  3CXC Z;  4A3F I;  1S72 Z;  3NPD A;  4DCU A;  3DHV A;  1YHQ Z;  4LFB C;  2O4H A;  3G6E Z;  3UX3 A;  1HNZ C;  3KIH A;  4L2Z A;  2E2J I;  3EER A;  2XR1 A;  3CCE 1;  3IF8 A;  1VEH A;  2E5L C;  1K8A 1;  4ISB A;  1K73 1;  5IT9 D;  3CCM 1;  4G36 A;  2Q4Z A;  2E7Z A;  1USP B;  2VPW A;  2QA4 Z;  1W2B Z;  4G1I A;  2KI7 B;  3BG0 B;  4BSZ A;  4JI8 C;  1YJ9 Z;  4DG9 A;  5K85 A;  3NDI A;  2QL8 A;  3CXC Y;  3D6W A;  4GKJ C;  2K3R A;  3NFZ A;  1WH9 A;  2MM9 A;  3HKZ A;  4MXU A;  4XX2 A;  2RHB A;  2P02 A;  3ETO A;  3LNO A;  1Y1W I;  3H0G I;  4E32 A;  1VQM Z;  5BSM A;  1M1K 1;  5IT9 b;  1VQ8 Z;  1L2F A;  5IP9 I;  3G71 Z;  2JIM A;  2WB1 A;  3VMH A;  2JMO A;  4G37 A;  2D28 C;  3FCE A;  2ZZM A;  1NJI 1;  2JIR A;  3TQI A;  1GPM A;  4RVN A;  3NDJ A;  3IML A;  4AQY C;  4ZJZ A;  2E7G A;  1WZN A;  3D9X A;  4LF5 C;  2LFU A;  3GKU A;  4DV5 C;  1QF8 A;  1O90 A;  3SO4 A;  5CM2 M;  4BY7 I;  2VF1 A;  4LE5 A;  1MD9 A;  5H9U A;  3FQQ A;  4DR7 C;  4K0K C;  1YJW 1;  3L8C A;  4JI6 C;  3CCE Z;  2QRD B;  3IPL A;  1Z03 A;  2RBL A;  3CCL 1;  2ZAE B;  4NBF A;  1N8R 1;  2M5O A;  4MD7 A;  1NY8 A;  2UXD C;  2JR6 A;  1HNX C;  1P9N A;  3J80 b;  3GCF A;  3EQ6 A;  3CCM Z;  3CCJ 1;  4B3R C;  1VQP 1;  1KRL A;  4E2Z A;  3GTG I;  4U5Y D;  2MMA B;  3J81 D;  4E31 A;  2H85 A;  5FLX D;  2QLV B;  3GTL I;  1TWA I;  3I08 A;  5LMU C;  3NI2 A;  4K0B A;  1KC8 1;  3R9W A;  1P7L A;  2VUG A;  1VQ5 1;  2JMP A;  1FDO A;  3IFU A;  1VQ9 1;  4RVO A;  3Q87 A;  1TWF I;  1TFI A;  3TDE A;  4OYC A;  1QVG Z;  1EGA A;  4LFC C;  3PES A;  5IFI A;  3UX2 A;  4HH4 A;  3ETC A;  1QXF A;  3S2D I;  3G6E 1;  1SFO I;  4TPS B;  1I3Q I;  2V8J A;  4JYA C;  2IZ4 A;  2JA8 I;  1RLY A;  2K5R A;  2PM9 A;  2UUC C;  4L4Q A;  1LQL A;  3HOW I;  3VMG A;  4NH1 C;  4GXR A;  4D57 A;  1RQF A;  4DV4 C;  3OW2 Z;  2B63 I;  2YWC A;  1NYE A;  1YJN 1;  2DE7 A;  2OZK A;  1Q82 2;  1Y8C A;  2F4M A;  2MCQ A;  3DLP X;  3VMI A;  4FUT A;  4S1T A;  3LUS A;  2JNY A;  2VPZ A;  3S1M I;  2GU2 A;  3NH5 A;  3CD6 1;  1ZH1 A;  1KD1 2;  1MXA A;  3UZ0 A;  4A3C I;  3F3P C;  3CC7 1;  1YJW Z;  4LF6 C;  4KHP C;  1PU1 A;  4DUY C;  2YCB A;  3CCL Z;  2NVT I;  2E2I I;  1K0R A;  1KQS Z;  2QRE B;  1WF3 A;  4JM1 A;  1M6X C;  1Q81 1;  1X3W A;  3S17 I;  3CCU 1;  1XMO C;  5CZX A;  5T64 A;  3CCJ Z;  4DR3 C;  1VQP Z;  1S7M A;  2KZF A;  1JOS A;  3LNV A;  2QW0 X;  1IBM C;  4NBD A;  1V25 A;  2V7B A;  4DR4 C;  1VQN 1;  1IBK C;  3K7A I;  4BC9 A;  1NUI A;  3CC4 1;  1VQ5 Z;  1VQ9 Z;  2JNV A;  1FDI A;  2P28 A;  1UWD A;  3PO2 I;  5A1I A;  1YJ7 A;  2BJO A;  4MD9 A;  1RG9 A;  2G2K A;  4NB8 A;  4RVG A;  3FCC A;  3G7S A;  2AYD A;  4A3K I;  4ZLP A;  1N34 C;  1DL6 A;  2RPR A;  5JRH A;  4HPV A;  2CY1 A;  5FLM I;  2ATW A;  2R6M A;  2R92 I;  4DGL A;  1WCM I;  5IP7 I;  4JI0 C;  1QYP A;  4NOZ A;  3JAM D;  4JI3 C;  2UXB C;  2GTH A;  5AN9 F;  1YJN Z;  3J81 f;  1K9M 2;  3HOU I;  1O9T A;  3RG2 A;  4R0M A;  5FLX f;  3MZL B;  2P2F A;  5KEI A;  4DR1 C;  4HGZ A;  3RZO I;  3T4N B;  1QWI A;  2JUB A;  2JS4 A;  5LMN C;  2UUA C;  2PMZ A;  2M5H A;  3TUF A;  2I3C A;  1TH5 A;  1K8A 2;  2W03 A;  1BA3 A;  3CD6 Z;  1QVF Y;  1SIW A;  2W04 A;  3FKI I;  2P2M A;  3LGX A;  3CQ1 A;  3CC7 Z;  3A4I A;  1Y1V I;  2M48 A;  1P4E C;  4HGY A;  2OPL B;  3CW9 A;  1V60 A;  3HOZ I;  3CJE A;  1RNI A;  2F4O A;  3CMA Z;  3I4N I;  3CCU Z;  4X6A I;  2DPL A;  3PRO C;  3RV2 A;  3T1Y C;  1T5D X;  2J6A A;  2LEX A;  1ULT A;  2YAD A;  4B3T C;  3VNQ A;  3KXW A;  2P2Q A;  4B3S C;  2VQE C;  1VQN Z;  2UXC C;  1W2B Y;  4LFA C;  5D1P A;  1N36 C;  3GTJ I;  1M1K 2;  3CME 1;  2HF1 A;  3CC4 Z;  4A3J I;  1YIJ 1;  1M90 2;  4A93 I;  4GKK C;  2E9H A;  3F3F C;  4X64 C;  4R1L A;  2Y0S A;  1VLA A;  3S16 I;  2DHM A;  2JIP A;  1Q7Y 2;  1NJI 2;  1UKK A;  4GXQ A;  1VQ6 Z;  5A2Q D;  3D2L A;  2QEX 1;  4X62 C;  2CU6 A;  2VZE A;  4RM3 A;  3A26 A;  4ODJ A;  4JI4 C;  1Q86 2;  4YHH C;  4LF9 C;  1X3Z A;  5BUQ A;  2NAP A;  1Q16 A;  3NH8 A;  4MTN A;  2VPX A;  3HOX I;  4LF7 C;  2P2J A;  3R44 A;  2AKL A;  1YUK A;  1N8R 2;  1TWC I;  3GPC A;  4A3G I;  4A3L I;  3VNR A;  3PO3 I;  1ZB9 A;  5AE3 A;  4LF4 C;  5BST A;  1VQ4 1;  1XMQ C;  2KDN A;  1XS3 A;  3CQZ I;  2E8F A;  2ZZN A;  4I9F A;  5IWA C;  3QWU A;  2VPY A;  4D56 A;  4A3M I;  3H3V J;  1PG4 A;  2PT7 G;  1KC8 2;  1YI2 1;  3JAM f;  2UU9 C;  1QM4 A;  4IZ6 A;  3J81 b;  2OBV A;  3CPW Z;  5FLX b;  2QKD A;  2R93 I;  3VTN A;  5T67 A;  4PZP A;  2DE6 A;  4FUQ A;  4NXM C;  4EWC A;  5T8T A;  3K6R A;  4DR5 C;  3GTM S;  3CME Z;  3IR7 A;  2CXC A;  3GKQ A;  1YIJ Z;  3NH4 A;  2OO4 A;  5BR8 C;  1HR0 C;  1WCJ A;  3GR1 A;  1FJG C;  1PG3 A;  4R1M A;  1J5E C;  4RVF A;  4DG8 A;  4DR6 C;  2IZ3 A;  2NCL A;  3EED A;  4DCT A;  2M6N A;  4FTF A;  3LAX A;  4OX9 C;  4EAT A;  4NBC A;  1T5H X;  2ZM6 C;  2OTJ 1;  2QEX Z;  3CCV 1;  4NB9 A;  1QVG Y;  4DV1 C;  4NBA A;  1VQO 1;  5AE2 A;  1O92 A;  2OTL 1;  2KPI A;  4DV0 C;  4QTT A;  1XHJ A;  4PUI A;  2AYA A;  3CMA 1;  3CW8 X;  2OPL A;  2QVY X;  3T1H C;  4NBG A;  4RM2 A;  3OW2 Y;  2QVX X;  5A19 A;  2O53 A; 
#chains in the Genus database with same CATH homology
 4PRO C;  2JA6 I;  3NYR A;  4JV5 C;  2Y27 A;  4JI2 C;  4IR7 A;  1RO4 A;  3I56 1;  4D4G A;  5DV9 A;  4A3E I;  4E33 A;  1VQ4 Z;  2E8C A;  4KTT A;  4CL1 A;  3S1Q I;  2DE5 A;  4BCA A;  5A2Q f;  4BBS I;  2EGT A;  2D1R A;  1YUA A;  1VQ6 1;  1YI2 Z;  4MD8 A;  1KQS Y;  1N33 C;  2P20 A;  3TE5 B;  3E7X A;  4A3D I;  4GS5 A;  3A9V A;  1VQ7 1;  3U50 C;  1X0T A;  4I9G A;  1PFT A;  2YU9 I;  3NYQ A;  3R9X A;  3AF6 A;  2P2B A;  2Y4N A;  2V8I A;  1XRC A;  5BSU A;  2RT9 A;  3CC2 1;  2DYJ A;  4PHT A;  5KYT A;  2D1T A;  2OTJ Z;  1K73 2;  1K9M 1;  1WII A;  3CCV Z;  1TWH I;  3HOV I;  1MXB A;  2P3Y A;  4RV9 A;  3S14 I;  1VQO Z;  3JAM b;  5GTD A;  2OTL Z;  2YWB A;  3G4S 1;  5C3E I;  4BXX I;  3KIF A;  2D27 A;  1JWH C;  1XRB A;  5BSV A;  1WW9 A;  3CCQ 1;  4JI5 C;  3PBK A;  2VUM I;  1I94 C;  3S2H I;  2NVY I;  2GTI A;  3TDH B;  3MZK B;  3I56 Z;  3S1R I;  5D1O A;  3B7W A;  3E7W A;  2BH1 X;  2HU9 A;  1AMU A;  2WAQ A;  1I50 I;  3HOY I;  4Y7N I;  5T6B A;  3J7A 4;  4WS9 A;  2ASB A;  4NBB A;  3OTO C;  3GTQ I;  2QR1 B;  4MH4 A;  4DCS A;  1M90 1;  3H2T A;  4RMN A;  3VB9 A;  3I07 A;  3CCS 1;  2E2H I;  2F4V C;  2QVZ X;  4E30 A;  2JA7 I;  2R7Z I;  1VQ7 Z;  2Y4O A;  1Q7Y 1;  3VNS A;  4MON A;  3J80 D;  4RS4 A;  4E2W A;  4E2X A;  1Y1V S;  2LIY A;  1O93 A;  4A3B I;  4RLQ A;  4RVH A;  3I55 1;  3CC2 Z;  3GR0 A;  4JI1 C;  3S1N I;  1Q86 1;  1V26 A;  1Z01 A;  5A2Q b;  4Y52 I;  4BC7 A;  4DUZ C;  4BBR I;  2E8E A;  2QRC B;  1JJ2 Z;  1YIT 1;  1R9T I;  3GTM I;  1I6H I;  4X66 C;  3ESW A;  4DQY B;  1Z02 A;  3G4S Z;  4QTU A;  5E7Q A;  1MXC A;  2VQF C;  4NBH A;  3IEV A;  2WP0 C;  4B3M C;  3CCQ Z;  3CCR 1;  1VQK 1;  1PA4 A;  3A9U A;  2NVX I;  2UUB C;  1ML8 A;  3P5J B;  3GTK I;  5D1O B;  5AE1 A;  1VQL 1;  1K83 I;  2PRO A;  4YY3 C;  3GTO I;  4DCV A;  5BUS A;  3S82 A;  1N2F A;  5C4J I;  1IBL C;  1XNQ C;  3UOW A;  5LL6 f;  3BG1 B;  4DR2 C;  3IX0 A;  4DV7 C;  2RIQ A;  1S72 1;  4RVD A;  4KTV A;  1JJ2 Y;  2D1Q A;  5BSW A;  2D1S A;  5BSR A;  1YHQ 1;  4JI7 C;  1KKG A;  2WD9 A;  2PN2 A;  1FUG A;  3M3Y I;  1L1O C;  4E2Y A;  3C5E A;  1Q82 1;  4X65 C;  1NP6 A;  1ZB8 A;  4A3I I;  3CCS Z;  5KYV A;  1HNW C;  2D7V A;  3M4O I;  3S15 I;  5IT9 f;  3PO3 S;  4MRI A;  4NDN A;  4DV6 C;  5K8F A;  3CPW Y;  1XNR C;  2OOY B;  4NBE A;  1KD1 1;  3GTP I;  3MON A;  5A1G A;  1MDB A;  5ADZ A;  2QA4 1;  3AF5 A;  4DK1 A;  5C44 I;  1HH2 P;  4NXN C;  1RO2 A;  3I55 Z;  1N32 C;  4AYB A;  1USP A;  1YJ9 1;  1Q81 2;  4L7I A;  1RO0 A;  4DV2 C;  3I4M I;  4WV3 A;  4LF8 C;  1YIT Z;  2PK7 A;  4NFR A;  5BUR A;  5C4X I;  3N54 B;  1TWG I;  2OOX B;  2ONF A;  2JA5 I;  2HHH C;  2V8K A;  3L95 X;  1XRA A;  1RY2 A;  1VQM 1;  2E0G A;  3CCR Z;  1VQK Z;  1MDF A;  1VQ8 1;  4TNU A;  3G71 1;  4DV3 C;  2VSQ A;  4D4I A;  1VQL Z;  3J80 f;  3DAY A;  4BY1 I;  1MKY A;  3FQM A;  4BBY A;  3RZD I;  5CZV A;  4OXI A;  3IEU A;  3N2Q A;  2NVQ I;  5T8S A;  4RLF A;  2HJG A;  2Q51 A;  1LCI A;  1QVF Z;  3CXC Z;  4A3F I;  1S72 Z;  3NPD A;  4DCU A;  3DHV A;  1YHQ Z;  4LFB C;  2O4H A;  3G6E Z;  1HNZ C;  3KIH A;  4L2Z A;  2E2J I;  3EER A;  2XR1 A;  3CCE 1;  3IF8 A;  2E5L C;  1K8A 1;  4ISB A;  1K73 1;  5IT9 D;  3CCM 1;  4G36 A;  2Q4Z A;  1USP B;  2QA4 Z;  4G1I A;  1W2B Z;  2KI7 B;  3BG0 B;  4BSZ A;  4JI8 C;  1YJ9 Z;  4DG9 A;  5K85 A;  3NDI A;  2QL8 A;  3CXC Y;  3D6W A;  4GKJ C;  2K3R A;  3NFZ A;  1WH9 A;  3HKZ A;  4MXU A;  4XX2 A;  2RHB A;  2P02 A;  3ETO A;  1Y1W I;  3H0G I;  4E32 A;  1VQM Z;  5BSM A;  1M1K 1;  5IT9 b;  1VQ8 Z;  1L2F A;  5IP9 I;  3G71 Z;  2WB1 A;  3VMH A;  2JMO A;  4G37 A;  2D28 C;  3FCE A;  1NJI 1;  3TQI A;  1GPM A;  4RVN A;  3NDJ A;  3IML A;  4AQY C;  4ZJZ A;  2E7G A;  3D9X A;  4LF5 C;  2LFU A;  3GKU A;  4DV5 C;  1QF8 A;  1O90 A;  3SO4 A;  5CM2 M;  4BY7 I;  2VF1 A;  4LE5 A;  1MD9 A;  5H9U A;  3FQQ A;  4DR7 C;  4K0K C;  1YJW 1;  3L8C A;  4JI6 C;  3CCE Z;  2QRD B;  3IPL A;  1Z03 A;  2RBL A;  3CCL 1;  2ZAE B;  4NBF A;  1N8R 1;  4MD7 A;  2UXD C;  2JR6 A;  1HNX C;  1P9N A;  3J80 b;  3GCF A;  3EQ6 A;  3CCM Z;  3CCJ 1;  4B3R C;  1VQP 1;  1KRL A;  4E2Z A;  3GTG I;  4U5Y D;  3J81 D;  4E31 A;  2H85 A;  5FLX D;  2QLV B;  3GTL I;  1TWA I;  3I08 A;  5LMU C;  3NI2 A;  4K0B A;  1KC8 1;  3R9W A;  1P7L A;  2VUG A;  1VQ5 1;  2JMP A;  4RVO A;  3IFU A;  1VQ9 1;  3Q87 A;  1TWF I;  1TFI A;  3TDE A;  4OYC A;  1QVG Z;  1EGA A;  4LFC C;  3PES A;  5IFI A;  4HH4 A;  3ETC A;  3S2D I;  3G6E 1;  1SFO I;  4TPS B;  1I3Q I;  2V8J A;  4JYA C;  2IZ4 A;  2JA8 I;  1RLY A;  2K5R A;  2PM9 A;  2UUC C;  4L4Q A;  1LQL A;  3HOW I;  3VMG A;  4NH1 C;  4GXR A;  4D57 A;  1RQF A;  4DV4 C;  3OW2 Z;  2B63 I;  2YWC A;  1NYE A;  1YJN 1;  2DE7 A;  2OZK A;  1Q82 2;  2F4M A;  3DLP X;  3VMI A;  4FUT A;  4S1T A;  3LUS A;  2JNY A;  3S1M I;  2GU2 A;  3NH5 A;  3CD6 1;  1ZH1 A;  1KD1 2;  1MXA A;  3UZ0 A;  4A3C I;  3F3P C;  3CC7 1;  1YJW Z;  4LF6 C;  4KHP C;  4DUY C;  2YCB A;  3CCL Z;  2NVT I;  2E2I I;  1K0R A;  1KQS Z;  2QRE B;  1WF3 A;  4JM1 A;  1Q81 1;  1X3W A;  3S17 I;  3CCU 1;  1XMO C;  5CZX A;  5T64 A;  3CCJ Z;  4DR3 C;  1VQP Z;  1S7M A;  2KZF A;  1JOS A;  3LNV A;  2QW0 X;  1IBM C;  4NBD A;  1V25 A;  2V7B A;  4DR4 C;  1VQN 1;  1IBK C;  3K7A I;  4BC9 A;  1NUI A;  3CC4 1;  1VQ5 Z;  1VQ9 Z;  2P28 A;  5A1I A;  3PO2 I;  1YJ7 A;  2BJO A;  4MD9 A;  1RG9 A;  2G2K A;  4NB8 A;  4RVG A;  3FCC A;  3G7S A;  4A3K I;  4ZLP A;  1N34 C;  1DL6 A;  2RPR A;  5JRH A;  4HPV A;  2CY1 A;  5FLM I;  2ATW A;  2R6M A;  2R92 I;  4DGL A;  1WCM I;  5IP7 I;  4JI0 C;  1QYP A;  4NOZ A;  3JAM D;  4JI3 C;  2UXB C;  2GTH A;  5AN9 F;  1YJN Z;  3J81 f;  1K9M 2;  3HOU I;  1O9T A;  3RG2 A;  4R0M A;  5FLX f;  3MZL B;  2P2F A;  5KEI A;  4DR1 C;  4HGZ A;  3RZO I;  3T4N B;  1QWI A;  2JUB A;  2JS4 A;  5LMN C;  2UUA C;  2PMZ A;  3TUF A;  2I3C A;  1K8A 2;  2W03 A;  1BA3 A;  3CD6 Z;  1QVF Y;  2W04 A;  3FKI I;  2P2M A;  3LGX A;  3CC7 Z;  3A4I A;  1Y1V I;  2M48 A;  4HGY A;  2OPL B;  3CW9 A;  3HOZ I;  3CJE A;  1RNI A;  2F4O A;  3CMA Z;  3I4N I;  3CCU Z;  4X6A I;  2DPL A;  3PRO C;  3RV2 A;  3T1Y C;  1T5D X;  2J6A A;  1ULT A;  2YAD A;  4B3T C;  3VNQ A;  3KXW A;  2P2Q A;  4B3S C;  2VQE C;  1VQN Z;  2UXC C;  1W2B Y;  4LFA C;  5D1P A;  1N36 C;  3GTJ I;  1M1K 2;  3CME 1;  2HF1 A;  3CC4 Z;  4A3J I;  1YIJ 1;  1M90 2;  4A93 I;  4GKK C;  2E9H A;  3F3F C;  4X64 C;  4R1L A;  2Y0S A;  1VLA A;  3S16 I;  1Q7Y 2;  1UKK A;  1NJI 2;  4GXQ A;  1VQ6 Z;  5A2Q D;  4X62 C;  2QEX 1;  2VZE A;  4RM3 A;  4ODJ A;  4JI4 C;  1Q86 2;  4YHH C;  4LF9 C;  1X3Z A;  5BUQ A;  3NH8 A;  4MTN A;  3HOX I;  4LF7 C;  2P2J A;  3R44 A;  2AKL A;  1YUK A;  1N8R 2;  1TWC I;  3GPC A;  4A3G I;  4A3L I;  3VNR A;  3PO3 I;  1ZB9 A;  5AE3 A;  4LF4 C;  5BST A;  1VQ4 1;  1XMQ C;  3CQZ I;  2E8F A;  4I9F A;  5IWA C;  3QWU A;  4D56 A;  4A3M I;  3H3V J;  1PG4 A;  2PT7 G;  1KC8 2;  1YI2 1;  3JAM f;  2UU9 C;  1QM4 A;  4IZ6 A;  3J81 b;  2OBV A;  3CPW Z;  5FLX b;  2QKD A;  2R93 I;  3VTN A;  5T67 A;  4PZP A;  2DE6 A;  4FUQ A;  4NXM C;  4EWC A;  5T8T A;  4DR5 C;  3GTM S;  3CME Z;  2CXC A;  3GKQ A;  1YIJ Z;  3NH4 A;  2OO4 A;  5BR8 C;  1HR0 C;  3GR1 A;  1FJG C;  1PG3 A;  4R1M A;  1J5E C;  4RVF A;  4DG8 A;  4DR6 C;  2IZ3 A;  3EED A;  4DCT A;  2M6N A;  4FTF A;  3LAX A;  4OX9 C;  4EAT A;  4NBC A;  1T5H X;  2ZM6 C;  2OTJ 1;  2QEX Z;  3CCV 1;  4NB9 A;  1QVG Y;  4DV1 C;  4NBA A;  1VQO 1;  5AE2 A;  1O92 A;  2OTL 1;  2KPI A;  4DV0 C;  4QTT A;  2AYA A;  3CMA 1;  3CW8 X;  2OPL A;  2QVY X;  3T1H C;  4NBG A;  4RM2 A;  3OW2 Y;  2QVX X;  5A19 A;  2O53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...