2BJOA

Crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
ALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
publication title Structure of the Bacillus Subtilis Ohrb Hydroperoxide-Resistance Protein in a Fully Oxidized State.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 34
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2bjoA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bjoA02
4JI8C 2RBLA 4QTTA 3VMGA 2UU9C 5BR8C 1HH2P 4JI5C 2JA7I 2JA8I 2CXCA 4NBFA 4DV0C 4NB9A 1RLYA 4LFCC 2JR6A 3U50C 3GTPI 4LF4C 1TWCI 3I4MI 4A3MI 4DR4C 4B3RC 4YHHC 5IWAC 1TWAI 2UUAC 4NBEA 1XNQC 1ML8A 2ASBA 3ESWA 4NBCA 2R7ZI 5LMUC 2YCBA 3S2HI 3R9WA 4DCVA 3S1RI 3GTGI 3HOXI 3T1YC 5C4JI 5C3EI 4LFAC 4JI4C 2UUCC 3VMHA 4A3GI 1LQLA 4DV6C 1TWGI 5A2QD 4DV3C 4A3KI 3HOUI 3M4OI 3GTQI 3GTLI 4JI7C 5IP7I 1IBLC 4DV2C 4B3TC 2DYJA 2UXDC 1YUAA 3HOYI 3CJEA 1PA4A 1TFIA 4JI6C 4DUYC 2EGTA 4DR5C 2F4MA 1HNZC 4DUZC 4DV7C 4LFBC 2VQFC 3HOWI 3GTOI 2YU9I 1N34C 4B3SC 1NUIA 4A3JI 1K0RA 4LF8C 4GKJC 4DV4C 3R9XA 2UXBC 4BY1I 1IBKC 2DE6A 4JI1C 4X65C 4DV1C 5LMNC 4NBBA 3GTKI 3HOZI 5C44I 3S15I 2ZM6C 4JV5C 2VQEC 2PN2A 3GTJI 2E2JI 1EGAA 1RO4A 2KZFA 4JI0C 4JI3C 3S2DI 2R93I 2UUBC 2P3YA 4A3BI 3RZDI 3GCFA 1IBMC 3RZOI 1TWFI 4DV5C 2JA5I 5CM2M 4GKKC 2DE7A 4LF6C 1MKYA 4NBHA 1FJGC 3CQZI 1WW9A 4Y52I 1QYPA 3J81D 2CY1A 4NB8A 2KPIA 4DR3C 4MTNA 1X3ZA 1I94C 2ATWA 3GTMS 3S16I 2JS4A 4DR7C 3GTMI 2VUMI 3EERA 3GKQA 4QTUA 3S1NI 2JNYA 2UXCC 4A3CI 4KHPC 3PO3S 3M3YI 1K83I 1QWIA 4NBGA 1XNRC 2QL8A 3PO3I 2NVXI 2JA6I 3VMIA 4BY7I 1WH9A 2B63I 4MH4A 1N36C 1N32C 4X66C 4Y7NI 2J6AA 3T1HC 1I6HI 3I4NI 2JMPA 1Y1VS 1L1OC 5C4XI 2R92I 2OPLA 4OX9C 1SFOI 4DR1C 3J80D 1R9TI 3LUSA 1VLAA 4K0KC 2PT7G 2DE5A 4NOZA 4BXXI 3AF5A 4JYAC 4NXNC 2F4VC 4B3MC 3GKUA 4X6AI 2AKLA 3S17I 4YY3C 2E7GA 4NBDA 4BBRI 3IEUA 2BJOA 5IP9I 1WCMI 3VB9A 4AQYC 2K5RA 1ZB8A 4X62C 1USPA 4A3DI 4DCTA 1USPB 3S14I 2E8CA 1HNWC 4JI2C 2HJGA 3Q87A 3JAMD 4DR6C 4BBSI 3OTOC 2E5LC 3H0GI 5FLXD 3D6WA 1HR0C 4A3LI 3H3VJ 4LF5C 2NVYI 2NVTI 1KKGA 3IEVA 1DL6A 1JOSA 2PK7A 1L2FA 3AF6A 2NVQI 2E2II 4A3II 2F4OA 5IT9D 2E2HI 4A3EI 4NXMC 3PO2I 1Y1WI 4NBAA 3I07A 4XX2A 1XMOC 1J5EC 2E8EA 1N33C 1NYEA 3FKII 2HF1A 1X3WA 1WF3A 4BSZA 4DR2C 4LF9C 5FLMI 1UKKA 2HHHC 2XR1A 1I50I 4DCUA 1TWHI 4X64C 2ONFA 1PFTA 4DCSA 3HOVI 3S1MI 4A3FI 1XMQC 2E8FA 3K7AI 1Y1VI 2D7VA 1HNXC 1ZB9A 1I3QI 1N2FA 3S1QI 4A93I 2OPLB 4LF7C
chains in the Genus database with same CATH superfamily
5KYTA 4JI8C 2RBLA 2M5HA 4QTTA 3VMGA 3UEBA 2UU9C 1VQOZ 1K9M2 2WD9A 3DAYA 1Q16A 1BA3A 2V8IA 2P2BA 5BSTA 5BR8C 4AYBA 1YJW1 1HH2P 2V8JA 1Z01A 4JI5C 1YJN1 2JA7I 2D27A 2OOXB 2JA8I 2CXCA 2Y0SA 4NBFA 4DV0C 1TH5A 3NI2A 2E0GA 3R44A 4NB9A 3A9VA 1Z03A 1WCJA 1QVGY 1RO0A 1YITZ 1MDFA 3GR1A 4D57A 1RLYA 2NCLA 4LFCC 2JR6A 3CC71 3U50C 3D2LA 1YI21 2P2QA 4G36A 4E2ZA 3GTPI 4LF4C 3CW9A 3F3PC 1VQ8Z 1UWDA 1TWCI 2CU6A 1V60A 3I4MI 3I561 1YI2Z 5BUQA 3UX2A 5KEIA 5DV9A 2QLVB 1V26A 4GS5A 2M48A 4A3MI 5JRHA 3J7A4 1VQLZ 2D1QA 4WV3A 4U5YD 3A9UA 4DR4C 2QREB 4B3RC 2GTIA 1ULTA 2JUBA 4RVDA 4YHHC 4D56A 3MONA 3CQ2A 1RO2A 4D4IA 4JM1A 5IWAC 1TWAI 4HH4A 2UUAC 4NBEA 5E7QA 2PMZA 1XNQC 1ML8A 3J81b 3TR3A 1Q821 2ASBA 1NJI1 3ESWA 4NBCA 2R7ZI 3G7SA 5LMUC 1K8A2 2YCBA 2YX1A 3S2HI 3R9WA 2GTHA 1VQ51 4DCVA 2QR1B 1JJ2Y 3S1RI 3GTGI 3HOXI 1X0TA 5BSUA 4DQYB 3T1YC 3CCSZ 2P2FA 5C4JI 5C3EI 2WP0C 1VQ5Z 4LFAC 2YADA 3PBKA 2QW0X 3O2EA 2K3RA 1M1K1 1WJ2A 4JI4C 3VNRA 2UUCC 2ZZNA 2QVYX 3VMHA 4A3GI 3ETCA 3FCEA 2MCQA 1SIWA 2JMOA 1LQLA 1S72Z 3I08A 2O53A 4DV6C 1TWGI 5A2QD 5ADZA 1MXAA 4DV3C 4A3KI 3HOUI 1VQP1 2OTL1 3M4OI 1PG3A 3ETOA 3GTQI 3CW8X 3GTLI 1RNIA 2E9HA 3NH8A 2Y4NA 4IZ6A 3CQ1A 5GTDA 4JI7C 1MXBA 2VPZA 5IP7I 1IBLC 1VQPZ 1Y8CA 2OTLZ 3NDJA 4DV2C 4B3TC 2DYJA 2UXDC 1FDIA 1YUAA 5T64A 3HOYI 3CJEA 2NAPA 4DK1A 1FUGA 1TFIA 1PA4A 2QA4Z 2QVXX 3NH4A 3VNQA 4DUYC 4JI6C 2EGTA 5FLXf 4DR5C 4IR7A 3LGXA 1M6XA 3CCV1 3T4NB 2KI7B 2F4MA 2AYAA 1HNZC 4DUZC 4DG8A 4DV7C 4K0BA 2VQFC 4LFBC 3CXCZ 3CC21 3HOWI 3GTOI 2YU9I 1YHQ1 2JNVA 5BSVA 2RHBA 2W03A 1N34C 4B3SC 1NUIA 4A3JI 1K0RA 1RG9A 4LF8C 4GKJC 1O93A 4D4GA 4DV4C 3R9XA 5A2Qf 1VQ71 5IT9f 2Q51A 4BY1I 3LNOA 2DE6A 4RM2A 1IBKC 2UXBC 1P4EA 1YIJ1 4JI1C 2OTJZ 2DHMA 4X65C 3CQ3A 2PM9A 4DV1C 1VQO1 5LMNC 4NBBA 3G71Z 2RT9A 3CC4Z 2P20A 2QVZX 2RPRA 2JIOA 1YIJZ 3GTKI 4PZPA 2OO4A 4RLQA 3IFUA 1T5DX 2QRDB 4G1IA 4PUGA 3C5EA 3HOZI 1QVGZ 1VQ4Z 3G4SZ 1KC81 4RVFA 4E32A 2VPYA 1P9NA 4RVGA 5C44I 1W2BY 3S15I 2ZM6C 2Y4OA 1YIT1 4JV5C 3FQMA 3J80b 3CPWZ 2VQEC 4HGYA 4E2WA 1K9M1 4RM3A 2PN2A 4RMNA 3GTJI 2E2JI 4MD9A 2D28C 1EGAA 1KQSY 2P28A 1RO4A 1VQ81 2KZFA 4JI0C 4E30A 4I9GA 4JI3C 1O92A 3S2DI 1KRLA 2R93I 1VQN1 2LEXA 4GXQA 2UUBC 1XS3A 2G2KA 5K85A 2P3YA 4RVNA 1VQL1 4A3BI 5KYVA 3A25A 1VEHA 1VQNZ 3BG1B 3RZDI 4RS4A 1IB8A 1Q862 1NY8A 3GCFA 4BCAA 4E2YA 2D1RA 2P2MA 1IBMC 3RZOI 1VQ91 3IF8A 3NYRA 3SO4A 2V3VA 1AMUA 3EQ6A 1TWFI 4DV5C 3TDEA 2JA5I 4RVOA 4OYCA 5CM2M 2PROA 4GKKC 1JJ2Z 1VQ9Z 2DE7A 3FCCA 1K732 3LNVA 4LF6C 1MKYA 4NBHA 1FJGC 5AN9F 4EWCA 3CQZI 3PESA 3EEDA 3BG0B 2VZEA 1WW9A 4Y52I 3CCS1 1QYPA 3CCRZ 2BH1X 3J81D 4NFRA 4TNUA 4E2XA 1RQFA 2CY1A 3GR0A 5BURA 1M6XC 4MONA 3JAMb 3F3FC 3TQIA 1S721 4NB8A 1VQK1 2KPIA 2IV2X 4FUTA 3UX3A 4MTNA 4DR3C 1K8A1 3MZKB 1X3ZA 3CCEZ 1I94C 2ATWA 3GTMS 2IZ3A 3S16I 1VQMZ 1VQKZ 1LCIA 1YJ7A 5AE3A 2JS4A 3CCQZ 2JIMA 4DR7C 3OW2Z 4RLFA 3GTMI 2P2JA 2D1SA 2VUMI 1P4EC 4ISBA 1S7MA 3EERA 2VPWA 4HGZA 3E7XA 4LE5A 5D1OA 2QA41 3GKQA 3CD6Z 2OBVA 3KXWA 1M902 4QTUA 2LIYA 1QVFZ 2W04A 4E31A 5IT9b 3IMLA 2V7BA 2ZAEB 4MXUA 4BC9A 1PU1A 2OZKA 3RV2A 3IR7A 5A1GA 1N8R2 3J81f 4FUQA 3S1NI 2LFUA 5CZXA 2O4HA 2JNYA 1O9TA 2UXCC 1Q812 4A3CI 4KHPC 3PO3S 3M3YI 2I3CA 1KD12 3N2QA 1K83I 5A1IA 4OXIA 3VTNA 1QWIA 4NBGA 1XNRC 5T8SA 2QL8A 3PO3I 2OTJ1 4PUIA 2NVXI 5BSWA 3G711 2MMAB 3NDIA 3CC41 4L7IA 3CCUZ 4I9FA 1FLOA 2JA6I 1XRAA 3VMIA 4BY7I 2KZ0A 5H9UA 1W2BZ 1WH9A 5T8TA 1NP6A 2B63I 3S82A 2V8KA 4MH4A 1AA6A 1N36C 2JIRA 3CCM1 1N32C 1VQ41 3G4S1 4X66C 4Y7NI 3D9XA 3H2TA 2J6AA 5T6BA 2E7ZA 3T1HC 4S1TA 4CL1A 1I6HI 3A4IA 3A26A 3I4NI 1YUKA 3CCMZ 4PROC 3QWUA 2JMPA 1KQSZ 1Y1VS 3CCLZ 3B7WA 3K6RA 1L1OC 2YWCA 5C4XI 4ZLPA 2R92I 4DG9A 1ZH1A 3NPDA 4R1LA 5LL6f 1MXCA 2OPLA 1RY2A 1QM4A 2WAQA 4OX9C 3CME1 4BC7A 2YWBA 1SFOI 4L2ZA 1VQ6Z 1QF8A 4DR1C 3IX0A 1R9TI 3NFZA 3J80D 3LUSA 3KIFA 1VLAA 4K0KC 3CMEZ 1YJ9Z 3CCJZ 3IPLA 2PT7G 1MD9A 3HKZA 2MM9A 2JIPA 4ODJA 2DE5A 4NOZA 4BXXI 2QRCB 2V45A 3AF5A 2VUGA 1XHJA 4NXNC 4JYAC 4GXRA 1YJWZ 5BSMA 2F4VC 4B3MC 3GKUA 4X6AI 2P02A 2AKLA 3S17I 1YJNZ 4YY3C 2E7GA 4NBDA 4BBRI 3IEUA 2BJOA 5IP9I 1WCMI 3VB9A 4AQYC 3P5JB 5BSRA 1Q861 2K5RA 1ZB8A 5T67A 1PG4A 4PUHA 3CPWY 4X62C 3CCR1 3E7WA 1USPA 2QEX1 3G6E1 3CC7Z 4A3DI 2D1TA 4DCTA 4PHTA 3N54B 3TDHB 4MD7A 3J80f 1MDBA 1USPB 2M6NA 3I56Z 2QEXZ 3G6EZ 2RIQA 1Q822 1K731 1NJI2 3S14I 1T5HX 2E8CA 3MZLB 1HNWC 3NH5A 5AE1A 2Y27A 1Q7Y2 3CCE1 3RG2A 4JI2C 2HJGA 3Q87A 1VQM1 3DHVA 3L95X 3JAMD 3CCQ1 4DR6C 4BBSI 3LAXA 2DPLA 4BBYA 1WZNA 3OTOC 5FLXb 4RV9A 5AE2A 4R1MA 2E5LC 2IZ4A 1Q7Y1 1M1K2 3H0GI 1QXFA 3CMA1 2JIQA 5FLXD 3D6WA 3CD61 4A3LI 1HR0C 3I551 3H3VJ 4LF5C 2NVYI 3TE5B 2NVTI 4KTTA 4DGLA 1FDOA 2WB1A 1P7LA 1KKGA 3IEVA 3CMAZ 5A19A 4HPVA 5D1PA 4MRIA 3I55Z 2PK7A 2VPXA 4NH1C 1DL6A 1JOSA 1L2FA 3UZ0A 3AF6A 2GU2A 5A2Qb 4EATA 2NVQI 1V25A 5D1OB 2E2II 4A3II 2F4OA 5IT9D 2M5OA 2E2HI 2VSQA 4R0MA 4A3EI 4NXMC 3PO2I 2AYDA 1Y1WI 2H85A 2QKDA 2Z51A 4NBAA 1M901 3I07A 4XX2A 1XMOC 1XRCA 5LCIA 3TUFA 3CCU1 2HU9A 3NYQA 1J5EC 3JAMf 4NDNA 2E8EA 4L4QA 1N8R1 4RVHA 1N33C 1NYEA 3FKII 3AY0A 1GPMA 2HF1A 2KDNA 1X3WA 3OW2Y 2R6MA 1Q811 1WF3A 4FTFA 1WIIA 4TPSB 4BSZA 4DR2C 1KD11 4LF9C 5FLMI 3VNSA 3L8CA 1UKKA 2HHHC 2XR1A 1I50I 4WS9A 3CCL1 1TWHI 4DCUA 4X64C 2ONFA 5IFIA 1JWHC 1PFTA 2Q4ZA 4DCSA 3KIHA 3DLPX 4ZJZA 1QVFY 3GPCA 3CCVZ 3HOVI 3S1MI 3FQQA 4G37A 2ZZMA 4A3FI 3CC2Z 2VF1A 2E8FA 1Z02A 1XMQC 1VQ61 1YHQZ 5CZVA 3K7AI 1Y1VI 5K8FA 3PROC 2D7VA 1KC82 1HNXC 1ZB9A 4E33A 2OOYB 1I3QI 1N2FA 3CXCY 3CCJ1 1YJ91 4MD8A 3S1QI 1O90A 1XRBA 3UOWA 1VQ7Z 4KTVA 4A93I 5BUSA 2OPLB 4LF7C
chains in the Genus database with same CATH topology
5KYTA 4JI8C 2RBLA 4QTTA 3VMGA 2UU9C 1VQOZ 1K9M2 2WD9A 3DAYA 1BA3A 2V8IA 2P2BA 5BSTA 5BR8C 4AYBA 1YJW1 1HH2P 2V8JA 1Z01A 4JI5C 1YJN1 2JA7I 2D27A 2OOXB 2JA8I 2CXCA 2Y0SA 4NBFA 4DV0C 3NI2A 2E0GA 3R44A 4NB9A 3A9VA 1Z03A 1QVGY 1RO0A 1YITZ 1MDFA 3GR1A 4D57A 1RLYA 4LFCC 2JR6A 3CC71 3U50C 1YI21 2P2QA 4G36A 4E2ZA 3GTPI 4LF4C 3CW9A 3F3PC 1VQ8Z 1TWCI 3I4MI 3I561 1YI2Z 5BUQA 5KEIA 5DV9A 2QLVB 1V26A 4GS5A 2M48A 4A3MI 5JRHA 3J7A4 1VQLZ 2D1QA 4WV3A 4U5YD 3A9UA 4DR4C 2QREB 4B3RC 2GTIA 1ULTA 2JUBA 4RVDA 4YHHC 4D56A 3MONA 1RO2A 4D4IA 4JM1A 5IWAC 1TWAI 4HH4A 2UUAC 4NBEA 5E7QA 2PMZA 1XNQC 1ML8A 3J81b 1Q821 2ASBA 1NJI1 3ESWA 4NBCA 2R7ZI 3G7SA 5LMUC 1K8A2 2YCBA 3S2HI 3R9WA 1VQ51 2GTHA 4DCVA 2QR1B 1JJ2Y 3S1RI 3GTGI 3HOXI 1X0TA 5BSUA 4DQYB 3T1YC 3CCSZ 2P2FA 5C4JI 5C3EI 2WP0C 1VQ5Z 4LFAC 2YADA 3PBKA 2QW0X 2K3RA 1M1K1 4JI4C 3VNRA 2UUCC 2QVYX 3VMHA 4A3GI 3ETCA 3FCEA 2JMOA 1LQLA 1S72Z 3I08A 2O53A 4DV6C 1TWGI 5A2QD 5ADZA 1MXAA 4DV3C 4A3KI 3HOUI 1VQP1 2OTL1 3M4OI 1PG3A 3ETOA 3GTQI 3CW8X 3GTLI 1RNIA 2E9HA 3NH8A 2Y4NA 4IZ6A 4JI7C 5GTDA 1MXBA 5IP7I 1IBLC 1VQPZ 2OTLZ 3NDJA 4DV2C 4B3TC 2DYJA 2UXDC 1YUAA 5T64A 3HOYI 3CJEA 1FUGA 4DK1A 1PA4A 1TFIA 2QA4Z 2QVXX 3NH4A 3VNQA 4DUYC 4JI6C 2EGTA 5FLXf 4DR5C 4IR7A 3LGXA 3CCV1 3T4NB 2KI7B 2F4MA 2AYAA 1HNZC 4DUZC 4DG8A 4DV7C 4K0BA 2VQFC 4LFBC 3CXCZ 3CC21 3HOWI 3GTOI 2YU9I 1YHQ1 5BSVA 2RHBA 2W03A 1N34C 4B3SC 1NUIA 4A3JI 1K0RA 1RG9A 4LF8C 4GKJC 1O93A 4D4GA 4DV4C 3R9XA 5A2Qf 1VQ71 5IT9f 2Q51A 4BY1I 1IBKC 2DE6A 4RM2A 2UXBC 1YIJ1 4JI1C 2OTJZ 4X65C 2PM9A 4DV1C 1VQO1 5LMNC 4NBBA 3G71Z 2RT9A 3CC4Z 2P20A 2QVZX 2RPRA 1YIJZ 3GTKI 4PZPA 2OO4A 4RLQA 3IFUA 1T5DX 2QRDB 4G1IA 3C5EA 3HOZI 1QVGZ 1VQ4Z 3G4SZ 1KC81 4RVFA 4E32A 1P9NA 4RVGA 5C44I 1W2BY 3S15I 2ZM6C 2Y4OA 1YIT1 4JV5C 3FQMA 3J80b 3CPWZ 2VQEC 4HGYA 4E2WA 1K9M1 4RM3A 2PN2A 4RMNA 3GTJI 2E2JI 4MD9A 2D28C 1EGAA 1KQSY 2P28A 1RO4A 1VQ81 2KZFA 4JI0C 4E30A 4I9GA 4JI3C 1O92A 3S2DI 1KRLA 2R93I 1VQN1 2UUBC 4GXQA 2G2KA 5K85A 2P3YA 4RVNA 1VQL1 4A3BI 5KYVA 1VQNZ 3BG1B 3RZDI 4RS4A 1Q862 3GCFA 4BCAA 4E2YA 2D1RA 2P2MA 1IBMC 3RZOI 1VQ91 3IF8A 3NYRA 3SO4A 1AMUA 3EQ6A 1TWFI 4DV5C 3TDEA 2JA5I 4RVOA 4OYCA 5CM2M 2PROA 4GKKC 1JJ2Z 1VQ9Z 2DE7A 3FCCA 1K732 3LNVA 4LF6C 1MKYA 4NBHA 1FJGC 5AN9F 4EWCA 3CQZI 3PESA 3EEDA 3BG0B 2VZEA 1WW9A 4Y52I 3CCS1 1QYPA 3CCRZ 2BH1X 3J81D 4NFRA 4TNUA 4E2XA 1RQFA 2CY1A 3GR0A 5BURA 4MONA 3JAMb 3F3FC 3TQIA 1S721 4NB8A 1VQK1 2KPIA 4FUTA 4DR3C 4MTNA 1K8A1 3MZKB 1X3ZA 3CCEZ 1I94C 2ATWA 3GTMS 2IZ3A 3S16I 1VQMZ 1VQKZ 1LCIA 1YJ7A 5AE3A 2JS4A 3CCQZ 4DR7C 3OW2Z 4RLFA 3GTMI 2P2JA 2D1SA 2VUMI 4ISBA 1S7MA 3EERA 4HGZA 3E7XA 4LE5A 5D1OA 2QA41 3GKQA 3CD6Z 2OBVA 3KXWA 1M902 4QTUA 2LIYA 1QVFZ 2W04A 4E31A 5IT9b 3IMLA 2V7BA 2ZAEB 4MXUA 4BC9A 2OZKA 3RV2A 5A1GA 1N8R2 3J81f 4FUQA 3S1NI 2LFUA 5CZXA 2O4HA 2JNYA 1O9TA 2UXCC 1Q812 4A3CI 4KHPC 3PO3S 3M3YI 2I3CA 1KD12 3N2QA 1K83I 5A1IA 4OXIA 3VTNA 1QWIA 4NBGA 1XNRC 5T8SA 2QL8A 3PO3I 2OTJ1 2NVXI 5BSWA 3G711 3NDIA 3CC41 4L7IA 3CCUZ 4I9FA 2JA6I 1XRAA 3VMIA 4BY7I 5H9UA 1W2BZ 1WH9A 5T8TA 1NP6A 2B63I 3S82A 2V8KA 4MH4A 1N36C 3CCM1 1N32C 1VQ41 3G4S1 4X66C 4Y7NI 3D9XA 3H2TA 2J6AA 5T6BA 3T1HC 4S1TA 4CL1A 1I6HI 3A4IA 3I4NI 1YUKA 3CCMZ 4PROC 3QWUA 2JMPA 1KQSZ 1Y1VS 3CCLZ 3B7WA 1L1OC 2YWCA 5C4XI 4ZLPA 2R92I 4DG9A 1ZH1A 3NPDA 4R1LA 5LL6f 1MXCA 2OPLA 1RY2A 1QM4A 2WAQA 4OX9C 3CME1 4BC7A 2YWBA 1SFOI 4L2ZA 1VQ6Z 1QF8A 4DR1C 3IX0A 1R9TI 3NFZA 3J80D 3LUSA 3KIFA 1VLAA 4K0KC 3CMEZ 1YJ9Z 3CCJZ 3IPLA 2PT7G 1MD9A 3HKZA 4ODJA 2DE5A 4NOZA 4BXXI 2QRCB 3AF5A 2VUGA 4JYAC 4NXNC 4GXRA 1YJWZ 5BSMA 2F4VC 4B3MC 3GKUA 4X6AI 2P02A 2AKLA 3S17I 1YJNZ 4YY3C 2E7GA 4NBDA 4BBRI 3IEUA 2BJOA 5IP9I 1WCMI 3VB9A 4AQYC 3P5JB 5BSRA 1Q861 2K5RA 1ZB8A 5T67A 1PG4A 4X62C 3CPWY 3CCR1 3E7WA 1USPA 2QEX1 3G6E1 3CC7Z 4A3DI 2D1TA 4DCTA 4PHTA 3N54B 3TDHB 4MD7A 3J80f 1MDBA 1USPB 2M6NA 3I56Z 2QEXZ 3G6EZ 2RIQA 1Q822 1K731 1NJI2 3S14I 1T5HX 2E8CA 3MZLB 1HNWC 3NH5A 5AE1A 2Y27A 1Q7Y2 3CCE1 3RG2A 4JI2C 2HJGA 3Q87A 1VQM1 3DHVA 3L95X 3JAMD 3CCQ1 4DR6C 4BBSI 3LAXA 2DPLA 4BBYA 3OTOC 5FLXb 4RV9A 5AE2A 4R1MA 2E5LC 2IZ4A 1Q7Y1 1M1K2 3H0GI 3CMA1 5FLXD 3D6WA 3CD61 4A3LI 1HR0C 3I551 3H3VJ 4LF5C 2NVYI 3TE5B 2NVTI 4KTTA 4DGLA 2WB1A 1P7LA 1KKGA 3IEVA 3CMAZ 5A19A 4HPVA 5D1PA 4MRIA 3I55Z 2PK7A 4NH1C 1DL6A 1JOSA 1L2FA 3UZ0A 3AF6A 2GU2A 5A2Qb 4EATA 2NVQI 1V25A 5D1OB 2E2II 4A3II 2F4OA 5IT9D 2VSQA 2E2HI 4R0MA 4A3EI 4NXMC 3PO2I 1Y1WI 2H85A 2QKDA 4NBAA 1M901 3I07A 4XX2A 1XMOC 1XRCA 3TUFA 3CCU1 2HU9A 3NYQA 1J5EC 3JAMf 4NDNA 2E8EA 4L4QA 1N8R1 4RVHA 1N33C 1NYEA 3FKII 1GPMA 2HF1A 1X3WA 3OW2Y 2R6MA 1Q811 1WF3A 4FTFA 1WIIA 4TPSB 4BSZA 4DR2C 1KD11 4LF9C 5FLMI 3VNSA 3L8CA 1UKKA 2HHHC 2XR1A 1I50I 4WS9A 3CCL1 1TWHI 4DCUA 4X64C 2ONFA 5IFIA 1JWHC 1PFTA 2Q4ZA 4DCSA 3KIHA 3DLPX 4ZJZA 1QVFY 3GPCA 3CCVZ 3HOVI 3S1MI 3FQQA 4G37A 4A3FI 3CC2Z 2VF1A 2E8FA 1Z02A 1XMQC 1VQ61 1YHQZ 5CZVA 3K7AI 1Y1VI 5K8FA 3PROC 2D7VA 1KC82 1HNXC 1ZB9A 4E33A 2OOYB 1I3QI 1N2FA 3CXCY 3CCJ1 1YJ91 4MD8A 3S1QI 1O90A 1XRBA 3UOWA 1VQ7Z 4KTVA 4A93I 5BUSA 2OPLB 4LF7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 C;  2RBL A;  4QTT A;  3VMG A;  2UU9 C;  5BR8 C;  1HH2 P;  4JI5 C;  2JA7 I;  2JA8 I;  2CXC A;  4NBF A;  4DV0 C;  4NB9 A;  1RLY A;  4LFC C;  2JR6 A;  3U50 C;  3GTP I;  4LF4 C;  1TWC I;  3I4M I;  4A3M I;  4DR4 C;  4B3R C;  4YHH C;  5IWA C;  1TWA I;  2UUA C;  4NBE A;  1XNQ C;  1ML8 A;  2ASB A;  3ESW A;  4NBC A;  2R7Z I;  5LMU C;  2YCB A;  3S2H I;  3R9W A;  4DCV A;  3S1R I;  3GTG I;  3HOX I;  3T1Y C;  5C4J I;  5C3E I;  4LFA C;  4JI4 C;  2UUC C;  3VMH A;  4A3G I;  1LQL A;  4DV6 C;  1TWG I;  5A2Q D;  4DV3 C;  4A3K I;  3HOU I;  3M4O I;  3GTQ I;  3GTL I;  4JI7 C;  5IP7 I;  1IBL C;  4DV2 C;  4B3T C;  2DYJ A;  2UXD C;  1YUA A;  3HOY I;  3CJE A;  1PA4 A;  1TFI A;  4JI6 C;  4DUY C;  2EGT A;  4DR5 C;  2F4M A;  1HNZ C;  4DUZ C;  4DV7 C;  4LFB C;  2VQF C;  3HOW I;  3GTO I;  2YU9 I;  1N34 C;  4B3S C;  1NUI A;  4A3J I;  1K0R A;  4LF8 C;  4GKJ C;  4DV4 C;  3R9X A;  2UXB C;  4BY1 I;  1IBK C;  2DE6 A;  4JI1 C;  4X65 C;  4DV1 C;  5LMN C;  4NBB A;  3GTK I;  3HOZ I;  5C44 I;  3S15 I;  2ZM6 C;  4JV5 C;  2VQE C;  2PN2 A;  3GTJ I;  2E2J I;  1EGA A;  1RO4 A;  2KZF A;  4JI0 C;  4JI3 C;  3S2D I;  2R93 I;  2UUB C;  2P3Y A;  4A3B I;  3RZD I;  3GCF A;  1IBM C;  3RZO I;  1TWF I;  4DV5 C;  2JA5 I;  5CM2 M;  4GKK C;  2DE7 A;  4LF6 C;  1MKY A;  4NBH A;  1FJG C;  3CQZ I;  1WW9 A;  4Y52 I;  1QYP A;  3J81 D;  2CY1 A;  4NB8 A;  2KPI A;  4DR3 C;  4MTN A;  1X3Z A;  1I94 C;  2ATW A;  3GTM S;  3S16 I;  2JS4 A;  4DR7 C;  3GTM I;  2VUM I;  3EER A;  3GKQ A;  4QTU A;  3S1N I;  2JNY A;  2UXC C;  4A3C I;  4KHP C;  3PO3 S;  3M3Y I;  1K83 I;  1QWI A;  4NBG A;  1XNR C;  2QL8 A;  3PO3 I;  2NVX I;  2JA6 I;  3VMI A;  4BY7 I;  1WH9 A;  2B63 I;  4MH4 A;  1N36 C;  1N32 C;  4X66 C;  4Y7N I;  2J6A A;  3T1H C;  1I6H I;  3I4N I;  2JMP A;  1Y1V S;  1L1O C;  5C4X I;  2R92 I;  2OPL A;  4OX9 C;  1SFO I;  4DR1 C;  3J80 D;  1R9T I;  3LUS A;  1VLA A;  4K0K C;  2PT7 G;  2DE5 A;  4NOZ A;  4BXX I;  3AF5 A;  4JYA C;  4NXN C;  2F4V C;  4B3M C;  3GKU A;  4X6A I;  2AKL A;  3S17 I;  4YY3 C;  2E7G A;  4NBD A;  4BBR I;  3IEU A;  2BJO A;  5IP9 I;  1WCM I;  3VB9 A;  4AQY C;  2K5R A;  1ZB8 A;  4X62 C;  1USP A;  4A3D I;  4DCT A;  1USP B;  3S14 I;  2E8C A;  1HNW C;  4JI2 C;  2HJG A;  3Q87 A;  3JAM D;  4DR6 C;  4BBS I;  3OTO C;  2E5L C;  3H0G I;  5FLX D;  3D6W A;  1HR0 C;  4A3L I;  3H3V J;  4LF5 C;  2NVY I;  2NVT I;  1KKG A;  3IEV A;  1DL6 A;  1JOS A;  2PK7 A;  1L2F A;  3AF6 A;  2NVQ I;  2E2I I;  4A3I I;  2F4O A;  5IT9 D;  2E2H I;  4A3E I;  4NXM C;  3PO2 I;  1Y1W I;  4NBA A;  3I07 A;  4XX2 A;  1XMO C;  1J5E C;  2E8E A;  1N33 C;  1NYE A;  3FKI I;  2HF1 A;  1X3W A;  1WF3 A;  4BSZ A;  4DR2 C;  4LF9 C;  5FLM I;  1UKK A;  2HHH C;  2XR1 A;  1I50 I;  4DCU A;  1TWH I;  4X64 C;  2ONF A;  1PFT A;  4DCS A;  3HOV I;  3S1M I;  4A3F I;  1XMQ C;  2E8F A;  3K7A I;  1Y1V I;  2D7V A;  1HNX C;  1ZB9 A;  1I3Q I;  1N2F A;  3S1Q I;  4A93 I;  2OPL B;  4LF7 C; 
#chains in the Genus database with same CATH topology
 5KYT A;  4JI8 C;  2RBL A;  2M5H A;  4QTT A;  3VMG A;  3UEB A;  2UU9 C;  1VQO Z;  1K9M 2;  2WD9 A;  3DAY A;  1Q16 A;  1BA3 A;  2V8I A;  2P2B A;  5BST A;  5BR8 C;  4AYB A;  1YJW 1;  1HH2 P;  2V8J A;  1Z01 A;  4JI5 C;  1YJN 1;  2JA7 I;  2D27 A;  2OOX B;  2JA8 I;  2CXC A;  2Y0S A;  4NBF A;  4DV0 C;  1TH5 A;  3NI2 A;  2E0G A;  3R44 A;  4NB9 A;  3A9V A;  1Z03 A;  1WCJ A;  1QVG Y;  1RO0 A;  1YIT Z;  1MDF A;  3GR1 A;  4D57 A;  1RLY A;  2NCL A;  4LFC C;  2JR6 A;  3CC7 1;  3U50 C;  3D2L A;  1YI2 1;  2P2Q A;  4G36 A;  4E2Z A;  3GTP I;  4LF4 C;  3CW9 A;  3F3P C;  1VQ8 Z;  1UWD A;  1TWC I;  2CU6 A;  1V60 A;  3I4M I;  3I56 1;  1YI2 Z;  5BUQ A;  3UX2 A;  5KEI A;  5DV9 A;  2QLV B;  1V26 A;  4GS5 A;  2M48 A;  4A3M I;  5JRH A;  3J7A 4;  1VQL Z;  2D1Q A;  4WV3 A;  4U5Y D;  3A9U A;  4DR4 C;  2QRE B;  4B3R C;  2GTI A;  1ULT A;  2JUB A;  4RVD A;  4YHH C;  4D56 A;  3MON A;  3CQ2 A;  1RO2 A;  4D4I A;  4JM1 A;  5IWA C;  1TWA I;  4HH4 A;  2UUA C;  4NBE A;  5E7Q A;  2PMZ A;  1XNQ C;  1ML8 A;  3J81 b;  3TR3 A;  1Q82 1;  2ASB A;  1NJI 1;  3ESW A;  4NBC A;  2R7Z I;  3G7S A;  5LMU C;  1K8A 2;  2YCB A;  2YX1 A;  3S2H I;  3R9W A;  2GTH A;  1VQ5 1;  4DCV A;  2QR1 B;  1JJ2 Y;  3S1R I;  3GTG I;  3HOX I;  1X0T A;  5BSU A;  4DQY B;  3T1Y C;  3CCS Z;  2P2F A;  5C4J I;  5C3E I;  2WP0 C;  1VQ5 Z;  4LFA C;  2YAD A;  3PBK A;  2QW0 X;  3O2E A;  2K3R A;  1M1K 1;  1WJ2 A;  4JI4 C;  3VNR A;  2UUC C;  2ZZN A;  2QVY X;  3VMH A;  4A3G I;  3ETC A;  3FCE A;  2MCQ A;  1SIW A;  2JMO A;  1LQL A;  1S72 Z;  3I08 A;  2O53 A;  4DV6 C;  1TWG I;  5A2Q D;  5ADZ A;  1MXA A;  4DV3 C;  4A3K I;  3HOU I;  1VQP 1;  2OTL 1;  3M4O I;  1PG3 A;  3ETO A;  3GTQ I;  3CW8 X;  3GTL I;  1RNI A;  2E9H A;  3NH8 A;  2Y4N A;  4IZ6 A;  3CQ1 A;  5GTD A;  4JI7 C;  1MXB A;  2VPZ A;  5IP7 I;  1IBL C;  1VQP Z;  1Y8C A;  2OTL Z;  3NDJ A;  4DV2 C;  4B3T C;  2DYJ A;  2UXD C;  1FDI A;  1YUA A;  5T64 A;  3HOY I;  3CJE A;  2NAP A;  4DK1 A;  1FUG A;  1TFI A;  1PA4 A;  2QA4 Z;  2QVX X;  3NH4 A;  3VNQ A;  4DUY C;  4JI6 C;  2EGT A;  5FLX f;  4DR5 C;  4IR7 A;  3LGX A;  1M6X A;  3CCV 1;  3T4N B;  2KI7 B;  2F4M A;  2AYA A;  1HNZ C;  4DUZ C;  4DG8 A;  4DV7 C;  4K0B A;  2VQF C;  4LFB C;  3CXC Z;  3CC2 1;  3HOW I;  3GTO I;  2YU9 I;  1YHQ 1;  2JNV A;  5BSV A;  2RHB A;  2W03 A;  1N34 C;  4B3S C;  1NUI A;  4A3J I;  1K0R A;  1RG9 A;  4LF8 C;  4GKJ C;  1O93 A;  4D4G A;  4DV4 C;  3R9X A;  5A2Q f;  1VQ7 1;  5IT9 f;  2Q51 A;  4BY1 I;  3LNO A;  2DE6 A;  4RM2 A;  1IBK C;  2UXB C;  1P4E A;  1YIJ 1;  4JI1 C;  2OTJ Z;  2DHM A;  4X65 C;  3CQ3 A;  2PM9 A;  4DV1 C;  1VQO 1;  5LMN C;  4NBB A;  3G71 Z;  2RT9 A;  3CC4 Z;  2P20 A;  2QVZ X;  2RPR A;  2JIO A;  1YIJ Z;  3GTK I;  4PZP A;  2OO4 A;  4RLQ A;  3IFU A;  1T5D X;  2QRD B;  4G1I A;  4PUG A;  3C5E A;  3HOZ I;  1QVG Z;  1VQ4 Z;  3G4S Z;  1KC8 1;  4RVF A;  4E32 A;  2VPY A;  1P9N A;  4RVG A;  5C44 I;  1W2B Y;  3S15 I;  2ZM6 C;  2Y4O A;  1YIT 1;  4JV5 C;  3FQM A;  3J80 b;  3CPW Z;  2VQE C;  4HGY A;  4E2W A;  1K9M 1;  4RM3 A;  2PN2 A;  4RMN A;  3GTJ I;  2E2J I;  4MD9 A;  2D28 C;  1EGA A;  1KQS Y;  2P28 A;  1RO4 A;  1VQ8 1;  2KZF A;  4JI0 C;  4E30 A;  4I9G A;  4JI3 C;  1O92 A;  3S2D I;  1KRL A;  2R93 I;  1VQN 1;  2LEX A;  4GXQ A;  2UUB C;  1XS3 A;  2G2K A;  5K85 A;  2P3Y A;  4RVN A;  1VQL 1;  4A3B I;  5KYV A;  3A25 A;  1VEH A;  1VQN Z;  3BG1 B;  3RZD I;  4RS4 A;  1IB8 A;  1Q86 2;  1NY8 A;  3GCF A;  4BCA A;  4E2Y A;  2D1R A;  2P2M A;  1IBM C;  3RZO I;  1VQ9 1;  3IF8 A;  3NYR A;  3SO4 A;  2V3V A;  1AMU A;  3EQ6 A;  1TWF I;  4DV5 C;  3TDE A;  2JA5 I;  4RVO A;  4OYC A;  5CM2 M;  2PRO A;  4GKK C;  1JJ2 Z;  1VQ9 Z;  2DE7 A;  3FCC A;  1K73 2;  3LNV A;  4LF6 C;  1MKY A;  4NBH A;  1FJG C;  5AN9 F;  4EWC A;  3CQZ I;  3PES A;  3EED A;  3BG0 B;  2VZE A;  1WW9 A;  4Y52 I;  3CCS 1;  1QYP A;  3CCR Z;  2BH1 X;  3J81 D;  4NFR A;  4TNU A;  4E2X A;  1RQF A;  2CY1 A;  3GR0 A;  5BUR A;  1M6X C;  4MON A;  3JAM b;  3F3F C;  3TQI A;  1S72 1;  4NB8 A;  1VQK 1;  2KPI A;  2IV2 X;  4FUT A;  3UX3 A;  4MTN A;  4DR3 C;  1K8A 1;  3MZK B;  1X3Z A;  3CCE Z;  1I94 C;  2ATW A;  3GTM S;  2IZ3 A;  3S16 I;  1VQM Z;  1VQK Z;  1LCI A;  1YJ7 A;  5AE3 A;  2JS4 A;  3CCQ Z;  2JIM A;  4DR7 C;  3OW2 Z;  4RLF A;  3GTM I;  2P2J A;  2D1S A;  2VUM I;  1P4E C;  4ISB A;  1S7M A;  3EER A;  2VPW A;  4HGZ A;  3E7X A;  4LE5 A;  5D1O A;  2QA4 1;  3GKQ A;  3CD6 Z;  2OBV A;  3KXW A;  1M90 2;  4QTU A;  2LIY A;  1QVF Z;  2W04 A;  4E31 A;  5IT9 b;  3IML A;  2V7B A;  2ZAE B;  4MXU A;  4BC9 A;  1PU1 A;  2OZK A;  3RV2 A;  3IR7 A;  5A1G A;  1N8R 2;  3J81 f;  4FUQ A;  3S1N I;  2LFU A;  5CZX A;  2O4H A;  2JNY A;  1O9T A;  2UXC C;  1Q81 2;  4A3C I;  4KHP C;  3PO3 S;  3M3Y I;  2I3C A;  1KD1 2;  3N2Q A;  1K83 I;  5A1I A;  4OXI A;  3VTN A;  1QWI A;  4NBG A;  1XNR C;  5T8S A;  2QL8 A;  3PO3 I;  2OTJ 1;  4PUI A;  2NVX I;  5BSW A;  3G71 1;  2MMA B;  3NDI A;  3CC4 1;  4L7I A;  3CCU Z;  4I9F A;  1FLO A;  2JA6 I;  1XRA A;  3VMI A;  4BY7 I;  2KZ0 A;  5H9U A;  1W2B Z;  1WH9 A;  5T8T A;  1NP6 A;  2B63 I;  3S82 A;  2V8K A;  4MH4 A;  1AA6 A;  1N36 C;  2JIR A;  3CCM 1;  1N32 C;  1VQ4 1;  3G4S 1;  4X66 C;  4Y7N I;  3D9X A;  3H2T A;  2J6A A;  5T6B A;  2E7Z A;  3T1H C;  4S1T A;  4CL1 A;  1I6H I;  3A4I A;  3A26 A;  3I4N I;  1YUK A;  3CCM Z;  4PRO C;  3QWU A;  2JMP A;  1KQS Z;  1Y1V S;  3CCL Z;  3B7W A;  3K6R A;  1L1O C;  2YWC A;  5C4X I;  4ZLP A;  2R92 I;  4DG9 A;  1ZH1 A;  3NPD A;  4R1L A;  5LL6 f;  1MXC A;  2OPL A;  1RY2 A;  1QM4 A;  2WAQ A;  4OX9 C;  3CME 1;  4BC7 A;  2YWB A;  1SFO I;  4L2Z A;  1VQ6 Z;  1QF8 A;  4DR1 C;  3IX0 A;  1R9T I;  3NFZ A;  3J80 D;  3LUS A;  3KIF A;  1VLA A;  4K0K C;  3CME Z;  1YJ9 Z;  3CCJ Z;  3IPL A;  2PT7 G;  1MD9 A;  3HKZ A;  2MM9 A;  2JIP A;  4ODJ A;  2DE5 A;  4NOZ A;  4BXX I;  2QRC B;  2V45 A;  3AF5 A;  2VUG A;  1XHJ A;  4NXN C;  4JYA C;  4GXR A;  1YJW Z;  5BSM A;  2F4V C;  4B3M C;  3GKU A;  4X6A I;  2P02 A;  2AKL A;  3S17 I;  1YJN Z;  4YY3 C;  2E7G A;  4NBD A;  4BBR I;  3IEU A;  2BJO A;  5IP9 I;  1WCM I;  3VB9 A;  4AQY C;  3P5J B;  5BSR A;  1Q86 1;  2K5R A;  1ZB8 A;  5T67 A;  1PG4 A;  4PUH A;  3CPW Y;  4X62 C;  3CCR 1;  3E7W A;  1USP A;  2QEX 1;  3G6E 1;  3CC7 Z;  4A3D I;  2D1T A;  4DCT A;  4PHT A;  3N54 B;  3TDH B;  4MD7 A;  3J80 f;  1MDB A;  1USP B;  2M6N A;  3I56 Z;  2QEX Z;  3G6E Z;  2RIQ A;  1Q82 2;  1K73 1;  1NJI 2;  3S14 I;  1T5H X;  2E8C A;  3MZL B;  1HNW C;  3NH5 A;  5AE1 A;  2Y27 A;  1Q7Y 2;  3CCE 1;  3RG2 A;  4JI2 C;  2HJG A;  3Q87 A;  1VQM 1;  3DHV A;  3L95 X;  3JAM D;  3CCQ 1;  4DR6 C;  4BBS I;  3LAX A;  2DPL A;  4BBY A;  1WZN A;  3OTO C;  5FLX b;  4RV9 A;  5AE2 A;  4R1M A;  2E5L C;  2IZ4 A;  1Q7Y 1;  1M1K 2;  3H0G I;  1QXF A;  3CMA 1;  2JIQ A;  5FLX D;  3D6W A;  3CD6 1;  4A3L I;  1HR0 C;  3I55 1;  3H3V J;  4LF5 C;  2NVY I;  3TE5 B;  2NVT I;  4KTT A;  4DGL A;  1FDO A;  2WB1 A;  1P7L A;  1KKG A;  3IEV A;  3CMA Z;  5A19 A;  4HPV A;  5D1P A;  4MRI A;  3I55 Z;  2PK7 A;  2VPX A;  4NH1 C;  1DL6 A;  1JOS A;  1L2F A;  3UZ0 A;  3AF6 A;  2GU2 A;  5A2Q b;  4EAT A;  2NVQ I;  1V25 A;  5D1O B;  2E2I I;  4A3I I;  2F4O A;  5IT9 D;  2M5O A;  2E2H I;  2VSQ A;  4R0M A;  4A3E I;  4NXM C;  3PO2 I;  2AYD A;  1Y1W I;  2H85 A;  2QKD A;  2Z51 A;  4NBA A;  1M90 1;  3I07 A;  4XX2 A;  1XMO C;  1XRC A;  5LCI A;  3TUF A;  3CCU 1;  2HU9 A;  3NYQ A;  1J5E C;  3JAM f;  4NDN A;  2E8E A;  4L4Q A;  1N8R 1;  4RVH A;  1N33 C;  1NYE A;  3FKI I;  3AY0 A;  1GPM A;  2HF1 A;  2KDN A;  1X3W A;  3OW2 Y;  2R6M A;  1Q81 1;  1WF3 A;  4FTF A;  1WII A;  4TPS B;  4BSZ A;  4DR2 C;  1KD1 1;  4LF9 C;  5FLM I;  3VNS A;  3L8C A;  1UKK A;  2HHH C;  2XR1 A;  1I50 I;  4WS9 A;  3CCL 1;  1TWH I;  4DCU A;  4X64 C;  2ONF A;  5IFI A;  1JWH C;  1PFT A;  2Q4Z A;  4DCS A;  3KIH A;  3DLP X;  4ZJZ A;  1QVF Y;  3GPC A;  3CCV Z;  3HOV I;  3S1M I;  3FQQ A;  4G37 A;  2ZZM A;  4A3F I;  3CC2 Z;  2VF1 A;  2E8F A;  1Z02 A;  1XMQ C;  1VQ6 1;  1YHQ Z;  5CZV A;  3K7A I;  1Y1V I;  5K8F A;  3PRO C;  2D7V A;  1KC8 2;  1HNX C;  1ZB9 A;  4E33 A;  2OOY B;  1I3Q I;  1N2F A;  3CXC Y;  3CCJ 1;  1YJ9 1;  4MD8 A;  3S1Q I;  1O90 A;  1XRB A;  3UOW A;  1VQ7 Z;  4KTV A;  4A93 I;  5BUS A;  2OPL B;  4LF7 C; 
#chains in the Genus database with same CATH homology
 5KYT A;  4JI8 C;  2RBL A;  4QTT A;  3VMG A;  2UU9 C;  1VQO Z;  1K9M 2;  2WD9 A;  3DAY A;  1BA3 A;  2V8I A;  2P2B A;  5BST A;  5BR8 C;  4AYB A;  1YJW 1;  1HH2 P;  2V8J A;  1Z01 A;  4JI5 C;  1YJN 1;  2JA7 I;  2D27 A;  2OOX B;  2JA8 I;  2CXC A;  2Y0S A;  4NBF A;  4DV0 C;  3NI2 A;  2E0G A;  3R44 A;  4NB9 A;  3A9V A;  1Z03 A;  1QVG Y;  1RO0 A;  1YIT Z;  1MDF A;  3GR1 A;  4D57 A;  1RLY A;  4LFC C;  2JR6 A;  3CC7 1;  3U50 C;  1YI2 1;  2P2Q A;  4G36 A;  4E2Z A;  3GTP I;  4LF4 C;  3CW9 A;  3F3P C;  1VQ8 Z;  1TWC I;  3I4M I;  3I56 1;  1YI2 Z;  5BUQ A;  5KEI A;  5DV9 A;  2QLV B;  1V26 A;  4GS5 A;  2M48 A;  4A3M I;  5JRH A;  3J7A 4;  1VQL Z;  2D1Q A;  4WV3 A;  4U5Y D;  3A9U A;  4DR4 C;  2QRE B;  4B3R C;  2GTI A;  1ULT A;  2JUB A;  4RVD A;  4YHH C;  4D56 A;  3MON A;  1RO2 A;  4D4I A;  4JM1 A;  5IWA C;  1TWA I;  4HH4 A;  2UUA C;  4NBE A;  5E7Q A;  2PMZ A;  1XNQ C;  1ML8 A;  3J81 b;  1Q82 1;  2ASB A;  1NJI 1;  3ESW A;  4NBC A;  2R7Z I;  3G7S A;  5LMU C;  1K8A 2;  2YCB A;  3S2H I;  3R9W A;  1VQ5 1;  2GTH A;  4DCV A;  2QR1 B;  1JJ2 Y;  3S1R I;  3GTG I;  3HOX I;  1X0T A;  5BSU A;  4DQY B;  3T1Y C;  3CCS Z;  2P2F A;  5C4J I;  5C3E I;  2WP0 C;  1VQ5 Z;  4LFA C;  2YAD A;  3PBK A;  2QW0 X;  2K3R A;  1M1K 1;  4JI4 C;  3VNR A;  2UUC C;  2QVY X;  3VMH A;  4A3G I;  3ETC A;  3FCE A;  2JMO A;  1LQL A;  1S72 Z;  3I08 A;  2O53 A;  4DV6 C;  1TWG I;  5A2Q D;  5ADZ A;  1MXA A;  4DV3 C;  4A3K I;  3HOU I;  1VQP 1;  2OTL 1;  3M4O I;  1PG3 A;  3ETO A;  3GTQ I;  3CW8 X;  3GTL I;  1RNI A;  2E9H A;  3NH8 A;  2Y4N A;  4IZ6 A;  4JI7 C;  5GTD A;  1MXB A;  5IP7 I;  1IBL C;  1VQP Z;  2OTL Z;  3NDJ A;  4DV2 C;  4B3T C;  2DYJ A;  2UXD C;  1YUA A;  5T64 A;  3HOY I;  3CJE A;  1FUG A;  4DK1 A;  1PA4 A;  1TFI A;  2QA4 Z;  2QVX X;  3NH4 A;  3VNQ A;  4DUY C;  4JI6 C;  2EGT A;  5FLX f;  4DR5 C;  4IR7 A;  3LGX A;  3CCV 1;  3T4N B;  2KI7 B;  2F4M A;  2AYA A;  1HNZ C;  4DUZ C;  4DG8 A;  4DV7 C;  4K0B A;  2VQF C;  4LFB C;  3CXC Z;  3CC2 1;  3HOW I;  3GTO I;  2YU9 I;  1YHQ 1;  5BSV A;  2RHB A;  2W03 A;  1N34 C;  4B3S C;  1NUI A;  4A3J I;  1K0R A;  1RG9 A;  4LF8 C;  4GKJ C;  1O93 A;  4D4G A;  4DV4 C;  3R9X A;  5A2Q f;  1VQ7 1;  5IT9 f;  2Q51 A;  4BY1 I;  1IBK C;  2DE6 A;  4RM2 A;  2UXB C;  1YIJ 1;  4JI1 C;  2OTJ Z;  4X65 C;  2PM9 A;  4DV1 C;  1VQO 1;  5LMN C;  4NBB A;  3G71 Z;  2RT9 A;  3CC4 Z;  2P20 A;  2QVZ X;  2RPR A;  1YIJ Z;  3GTK I;  4PZP A;  2OO4 A;  4RLQ A;  3IFU A;  1T5D X;  2QRD B;  4G1I A;  3C5E A;  3HOZ I;  1QVG Z;  1VQ4 Z;  3G4S Z;  1KC8 1;  4RVF A;  4E32 A;  1P9N A;  4RVG A;  5C44 I;  1W2B Y;  3S15 I;  2ZM6 C;  2Y4O A;  1YIT 1;  4JV5 C;  3FQM A;  3J80 b;  3CPW Z;  2VQE C;  4HGY A;  4E2W A;  1K9M 1;  4RM3 A;  2PN2 A;  4RMN A;  3GTJ I;  2E2J I;  4MD9 A;  2D28 C;  1EGA A;  1KQS Y;  2P28 A;  1RO4 A;  1VQ8 1;  2KZF A;  4JI0 C;  4E30 A;  4I9G A;  4JI3 C;  1O92 A;  3S2D I;  1KRL A;  2R93 I;  1VQN 1;  2UUB C;  4GXQ A;  2G2K A;  5K85 A;  2P3Y A;  4RVN A;  1VQL 1;  4A3B I;  5KYV A;  1VQN Z;  3BG1 B;  3RZD I;  4RS4 A;  1Q86 2;  3GCF A;  4BCA A;  4E2Y A;  2D1R A;  2P2M A;  1IBM C;  3RZO I;  1VQ9 1;  3IF8 A;  3NYR A;  3SO4 A;  1AMU A;  3EQ6 A;  1TWF I;  4DV5 C;  3TDE A;  2JA5 I;  4RVO A;  4OYC A;  5CM2 M;  2PRO A;  4GKK C;  1JJ2 Z;  1VQ9 Z;  2DE7 A;  3FCC A;  1K73 2;  3LNV A;  4LF6 C;  1MKY A;  4NBH A;  1FJG C;  5AN9 F;  4EWC A;  3CQZ I;  3PES A;  3EED A;  3BG0 B;  2VZE A;  1WW9 A;  4Y52 I;  3CCS 1;  1QYP A;  3CCR Z;  2BH1 X;  3J81 D;  4NFR A;  4TNU A;  4E2X A;  1RQF A;  2CY1 A;  3GR0 A;  5BUR A;  4MON A;  3JAM b;  3F3F C;  3TQI A;  1S72 1;  4NB8 A;  1VQK 1;  2KPI A;  4FUT A;  4DR3 C;  4MTN A;  1K8A 1;  3MZK B;  1X3Z A;  3CCE Z;  1I94 C;  2ATW A;  3GTM S;  2IZ3 A;  3S16 I;  1VQM Z;  1VQK Z;  1LCI A;  1YJ7 A;  5AE3 A;  2JS4 A;  3CCQ Z;  4DR7 C;  3OW2 Z;  4RLF A;  3GTM I;  2P2J A;  2D1S A;  2VUM I;  4ISB A;  1S7M A;  3EER A;  4HGZ A;  3E7X A;  4LE5 A;  5D1O A;  2QA4 1;  3GKQ A;  3CD6 Z;  2OBV A;  3KXW A;  1M90 2;  4QTU A;  2LIY A;  1QVF Z;  2W04 A;  4E31 A;  5IT9 b;  3IML A;  2V7B A;  2ZAE B;  4MXU A;  4BC9 A;  2OZK A;  3RV2 A;  5A1G A;  1N8R 2;  3J81 f;  4FUQ A;  3S1N I;  2LFU A;  5CZX A;  2O4H A;  2JNY A;  1O9T A;  2UXC C;  1Q81 2;  4A3C I;  4KHP C;  3PO3 S;  3M3Y I;  2I3C A;  1KD1 2;  3N2Q A;  1K83 I;  5A1I A;  4OXI A;  3VTN A;  1QWI A;  4NBG A;  1XNR C;  5T8S A;  2QL8 A;  3PO3 I;  2OTJ 1;  2NVX I;  5BSW A;  3G71 1;  3NDI A;  3CC4 1;  4L7I A;  3CCU Z;  4I9F A;  2JA6 I;  1XRA A;  3VMI A;  4BY7 I;  5H9U A;  1W2B Z;  1WH9 A;  5T8T A;  1NP6 A;  2B63 I;  3S82 A;  2V8K A;  4MH4 A;  1N36 C;  3CCM 1;  1N32 C;  1VQ4 1;  3G4S 1;  4X66 C;  4Y7N I;  3D9X A;  3H2T A;  2J6A A;  5T6B A;  3T1H C;  4S1T A;  4CL1 A;  1I6H I;  3A4I A;  3I4N I;  1YUK A;  3CCM Z;  4PRO C;  3QWU A;  2JMP A;  1KQS Z;  1Y1V S;  3CCL Z;  3B7W A;  1L1O C;  2YWC A;  5C4X I;  4ZLP A;  2R92 I;  4DG9 A;  1ZH1 A;  3NPD A;  4R1L A;  5LL6 f;  1MXC A;  2OPL A;  1RY2 A;  1QM4 A;  2WAQ A;  4OX9 C;  3CME 1;  4BC7 A;  2YWB A;  1SFO I;  4L2Z A;  1VQ6 Z;  1QF8 A;  4DR1 C;  3IX0 A;  1R9T I;  3NFZ A;  3J80 D;  3LUS A;  3KIF A;  1VLA A;  4K0K C;  3CME Z;  1YJ9 Z;  3CCJ Z;  3IPL A;  2PT7 G;  1MD9 A;  3HKZ A;  4ODJ A;  2DE5 A;  4NOZ A;  4BXX I;  2QRC B;  3AF5 A;  2VUG A;  4JYA C;  4NXN C;  4GXR A;  1YJW Z;  5BSM A;  2F4V C;  4B3M C;  3GKU A;  4X6A I;  2P02 A;  2AKL A;  3S17 I;  1YJN Z;  4YY3 C;  2E7G A;  4NBD A;  4BBR I;  3IEU A;  2BJO A;  5IP9 I;  1WCM I;  3VB9 A;  4AQY C;  3P5J B;  5BSR A;  1Q86 1;  2K5R A;  1ZB8 A;  5T67 A;  1PG4 A;  4X62 C;  3CPW Y;  3CCR 1;  3E7W A;  1USP A;  2QEX 1;  3G6E 1;  3CC7 Z;  4A3D I;  2D1T A;  4DCT A;  4PHT A;  3N54 B;  3TDH B;  4MD7 A;  3J80 f;  1MDB A;  1USP B;  2M6N A;  3I56 Z;  2QEX Z;  3G6E Z;  2RIQ A;  1Q82 2;  1K73 1;  1NJI 2;  3S14 I;  1T5H X;  2E8C A;  3MZL B;  1HNW C;  3NH5 A;  5AE1 A;  2Y27 A;  1Q7Y 2;  3CCE 1;  3RG2 A;  4JI2 C;  2HJG A;  3Q87 A;  1VQM 1;  3DHV A;  3L95 X;  3JAM D;  3CCQ 1;  4DR6 C;  4BBS I;  3LAX A;  2DPL A;  4BBY A;  3OTO C;  5FLX b;  4RV9 A;  5AE2 A;  4R1M A;  2E5L C;  2IZ4 A;  1Q7Y 1;  1M1K 2;  3H0G I;  3CMA 1;  5FLX D;  3D6W A;  3CD6 1;  4A3L I;  1HR0 C;  3I55 1;  3H3V J;  4LF5 C;  2NVY I;  3TE5 B;  2NVT I;  4KTT A;  4DGL A;  2WB1 A;  1P7L A;  1KKG A;  3IEV A;  3CMA Z;  5A19 A;  4HPV A;  5D1P A;  4MRI A;  3I55 Z;  2PK7 A;  4NH1 C;  1DL6 A;  1JOS A;  1L2F A;  3UZ0 A;  3AF6 A;  2GU2 A;  5A2Q b;  4EAT A;  2NVQ I;  1V25 A;  5D1O B;  2E2I I;  4A3I I;  2F4O A;  5IT9 D;  2VSQ A;  2E2H I;  4R0M A;  4A3E I;  4NXM C;  3PO2 I;  1Y1W I;  2H85 A;  2QKD A;  4NBA A;  1M90 1;  3I07 A;  4XX2 A;  1XMO C;  1XRC A;  3TUF A;  3CCU 1;  2HU9 A;  3NYQ A;  1J5E C;  3JAM f;  4NDN A;  2E8E A;  4L4Q A;  1N8R 1;  4RVH A;  1N33 C;  1NYE A;  3FKI I;  1GPM A;  2HF1 A;  1X3W A;  3OW2 Y;  2R6M A;  1Q81 1;  1WF3 A;  4FTF A;  1WII A;  4TPS B;  4BSZ A;  4DR2 C;  1KD1 1;  4LF9 C;  5FLM I;  3VNS A;  3L8C A;  1UKK A;  2HHH C;  2XR1 A;  1I50 I;  4WS9 A;  3CCL 1;  1TWH I;  4DCU A;  4X64 C;  2ONF A;  5IFI A;  1JWH C;  1PFT A;  2Q4Z A;  4DCS A;  3KIH A;  3DLP X;  4ZJZ A;  1QVF Y;  3GPC A;  3CCV Z;  3HOV I;  3S1M I;  3FQQ A;  4G37 A;  4A3F I;  3CC2 Z;  2VF1 A;  2E8F A;  1Z02 A;  1XMQ C;  1VQ6 1;  1YHQ Z;  5CZV A;  3K7A I;  1Y1V I;  5K8F A;  3PRO C;  2D7V A;  1KC8 2;  1HNX C;  1ZB9 A;  4E33 A;  2OOY B;  1I3Q I;  1N2F A;  3CXC Y;  3CCJ 1;  1YJ9 1;  4MD8 A;  3S1Q I;  1O90 A;  1XRB A;  3UOW A;  1VQ7 Z;  4KTV A;  4A93 I;  5BUS A;  2OPL B;  4LF7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...