2BJOA

Crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
ALFTAKVTARGGRAGHITSDDGVLDFDIVMPNAAAAGQTGTNPEQLFAAGYAACFGGALEHVAKEQNIEIDSEIEGQVSLMKDESDGGFKIGVTLVVNTKDLDREKAQELVNAAHEFCPYSKATRGNVDVKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ORGANIC HYDROPEROXIDE RESISTANCE PROTEIN OHRB
publication title Structure of the Bacillus Subtilis Ohrb Hydroperoxide-Resistance Protein in a Fully Oxidized State.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 34
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2bjoA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bjoA02
4B3SC 1N36C 4JI0C 3AF6A 1QWIA 3D6WA 1XMOC 4A3FI 2QL8A 4Y7NI 5FLXD 4XX2A 3PO2I 4A3BI 3S15I 2F4VC 5IWAC 4LF8C 4LF5C 2JA7I 4LF9C 2E5LC 1K0RA 1XNRC 4JYAC 4BSZA 1MKYA 4DCUA 4DR4C 3PO3S 1WW9A 4JI5C 3R9XA 4A3CI 1USPB 2CXCA 1N32C 4JI6C 2E2II 4DR7C 2KZFA 4DV0C 2YU9I 3HOUI 4QTUA 4X62C 1TFIA 2UU9C 2F4OA 4DUZC 4DR2C 4LF4C 2PK7A 3HOVI 5C44I 3M3YI 4DUYC 3CQZI 1JOSA 4A3II 2ATWA 3HOXI 4DR3C 4B3MC 4LFAC 2NVQI 1ZB9A 2JA8I 4JV5C 1VLAA 5LMUC 3GTOI 1Y1WI 1TWHI 4JI7C 1TWAI 4A3MI 3H3VJ 2JNYA 4X65C 4KHPC 2JA5I 4Y52I 4LF6C 4DV1C 2UUCC 4DCVA 1Y1VS 4NBFA 1KKGA 1I3QI 3S1RI 4A93I 3GTKI 3J80D 1LQLA 1TWGI 3I07A 4NBHA 3HOZI 4NBDA 4NOZA 4DV2C 1L1OC 4QTTA 2JA6I 2E2HI 4B3TC 3VMHA 1N34C 1USPA 2PT7G 2D7VA 3HOYI 2NVXI 4BBRI 3VMGA 1RO4A 4GKJC 1FJGC 5BR8C 2UXCC 2OPLA 2ONFA 2DE5A 2K5RA 1HNZC 3GCFA 4BY7I 4A3GI 4X6AI 1HH2P 3S17I 1I6HI 4NBEA 3GTPI 4JI1C 5CM2M 1R9TI 2J6AA 2JMPA 1HNXC 3H0GI 2E7GA 1WCMI 2OPLB 3GTMI 4JI3C 2UUBC 3U50C 1YUAA 5C4XI 4NBCA 4OX9C 4DR6C 3ESWA 4DR5C 4X64C 2AKLA 1TWCI 1I94C 2DE6A 2DE7A 3I4MI 5LMNC 2ZM6C 2HF1A 5IT9D 2UXBC 4DCTA 2KPIA 3S16I 3AF5A 3T1YC 3PO3I 4A3JI 2HJGA 3GKQA 5C3EI 4A3LI 1X3WA 4JI8C 4NB8A 1HR0C 2JS4A 1DL6A 2CY1A 4LF7C 4DCSA 1TWFI 3GKUA 1X3ZA 4AQYC 2UUAC 3IEUA 2YCBA 1SFOI 2ASBA 1L2FA 4K0KC 3CJEA 4YHHC 1N33C 2E2JI 2NVTI 4NBAA 1I50I 2JR6A 4JI2C 1N2FA 1PFTA 4BXXI 3VMIA 3OTOC 1Y1VI 2R7ZI 2EGTA 3GTJI 2HHHC 4B3RC 3J81D 3I4NI 1WF3A 4DR1C 4NBGA 4X66C 3HOWI 3T1HC 4DV6C 1J5EC 4DV7C 4DV4C 4JI4C 2XR1A 1ZB8A 2PN2A 2R93I 1NUIA 3S1NI 4NXNC 1NYEA 4BBSI 1PA4A 4A3EI 3GTGI 3S2DI 4DV5C 5A2QD 1QYPA 4MH4A 3S14I 3EERA 2E8CA 2UXDC 3VB9A 4A3DI 2E8EA 2E8FA 1ML8A 3M4OI 2F4MA 1EGAA 1HNWC 2VQEC 4LFBC 5IP7I 1IBLC 2P3YA 4BY1I 2B63I 3FKII 3JAMD 3RZDI 4NBBA 3GTLI 2NVYI 4MTNA 1UKKA 4A3KI 5FLMI 3S1QI 3R9WA 3RZOI 4DV3C 3S2HI 3K7AI 2R92I 4NXMC 4NB9A 1XNQC 2VQFC 2BJOA 1K83I 2DYJA 5IP9I 1IBMC 3LUSA 3GTQI 3GTMS 3IEVA 3S1MI 2RBLA 3Q87A 1IBKC 2VUMI 4LFCC 4GKKC 4YY3C 1RLYA 1XMQC 1WH9A 5C4JI
chains in the Genus database with same CATH superfamily
1VQ8Z 4B3SC 3FQQA 1N36C 4JI0C 3AF6A 1QWIA 4L7IA 3D6WA 1VQL1 4A3FI 1S721 4Y7NI 2QL8A 3IMLA 4HPVA 5FLXD 1XMOC 3FQMA 4XX2A 1VQ61 5T8TA 3PO2I 4A3BI 3L95X 4I9GA 3S15I 3UEBA 2F4VC 5IWAC 4LF8C 1WZNA 3CPWZ 4E30A 3E7XA 4E32A 2D1SA 1P9NA 1AMUA 4LF5C 2JA7I 4LF9C 1NJI2 1YI21 2E5LC 1NP6A 1K9M1 2V45A 1K0RA 3LNOA 1VQ5Z 1XNRC 4JYAC 1VQ4Z 2Y0SA 2ZAEB 4MRIA 4BSZA 1MKYA 1V26A 3CCUZ 5IT9b 2LIYA 3GR1A 4DCUA 4DR4C 4CL1A 3TUFA 4HH4A 3PO3S 1WW9A 1VQ91 2QA41 4WV3A 1VQ71 4DG8A 4JI5C 1XHJA 3R9XA 1YJ9Z 4NH1C 4EWCA 4A3CI 3I55Z 1USPB 1YIT1 2Y4OA 1QVFZ 1QM4A 2QREB 2CXCA 1N32C 4JI6C 2E2II 4TPSB 4DR7C 2KZFA 1TH5A 3GR0A 2Q4ZA 4PROC 2YU9I 3HOUI 2K3RA 4L4QA 1N8R2 4EATA 4DV0C 4QTUA 1WIIA 3KXWA 4X62C 2I3CA 1TFIA 4ODJA 2UU9C 2F4OA 4FTFA 1NJI1 4DUZC 3LGXA 4DR2C 2H85A 2JNVA 4LF4C 2PK7A 1RQFA 3CCR1 5A1IA 3HOVI 1FUGA 5C44I 3M3YI 1VQPZ 3CCL1 4DUYC 3VTNA 1WCJA 3CQZI 1JOSA 1V60A 4A3II 2ATWA 2E0GA 3HOXI 2M6NA 1P4EA 1NY8A 3S82A 2D28C 4DR3C 3KIFA 4B3MC 4LFAC 2DPLA 2NVQI 1ZB9A 2WAQA 3D2LA 4DK1A 4E2ZA 1VEHA 2JA8I 4JV5C 4D4GA 1VLAA 5LMUC 1Y8CA 1Y1WI 3CC4Z 3GTOI 1N8R1 1TWHI 4JI7C 1TWAI 4A3MI 2PMZA 2M48A 3H3VJ 2JNYA 1YJW1 4PUIA 4PUGA 4LE5A 4X65C 2VPYA 1P7LA 4KHPC 3F3PC 3CMAZ 1M1K2 2JA5I 4Y52I 4U5YD 5A2Qf 3PROC 4OYCA 5CZVA 5T67A 4DGLA 3CCS1 4LF6C 4DV1C 4DCVA 2UUCC 3CCMZ 1Y1VS 4HGYA 4NBFA 3A4IA 1I3QI 1KKGA 1RO0A 3S1RI 2OOYB 4A93I 3NDJA 2O4HA 1Q7Y2 1RG9A 3GTKI 2QRDB 2JIPA 2VPWA 3J80D 1LQLA 1O92A 1TWGI 3I07A 2P2QA 4D57A 1ULTA 2QRCB 3L8CA 4NBHA 4E2XA 4NBDA 2O53A 3HOZI 2WP0C 3NH5A 3CC7Z 3IFUA 4BBYA 5BSVA 4NOZA 4DV2C 1QVFY 4TNUA 1KQSY 5CZXA 4MD9A 2CU6A 1L1OC 3I561 4RVFA 4RM3A 5LL6f 2RT9A 3G7SA 1KRLA 4OXIA 3JAMf 3UX3A 4QTTA 4RS4A 3G71Z 2MM9A 3QWUA 4I9FA 1YJ7A 1M1K1 1YHQZ 2M5HA 1VQNZ 2KI7B 2JA6I 2E2HI 3LAXA 4KTVA 5T8SA 5K8FA 2MMAB 4B3TC 3VMHA 1MD9A 3RV2A 1N34C 1USPA 3J80f 1VQ81 2PT7G 2P20A 1Q7Y1 4S1TA 5A2Qb 1JWHC 3DHVA 1MXCA 2D7VA 3NDIA 3HOYI 1FDIA 2NVXI 4RM2A 2GTIA 4E31A 3CW9A 5D1OB 1O9TA 2QLVB 5H9UA 2KDNA 4BBRI 3TQIA 3VMGA 2DHMA 2P2BA 5ADZA 3CCE1 1Q862 3NI2A 2IZ4A 1RO4A 2IZ3A 3TDEA 2D1QA 4GKJC 1FJGC 2ZZNA 1VQ51 2V8JA 2VPXA 3CMEZ 1VQ41 1QVGY 3CD6Z 1XRAA 1O93A 2W03A 3CXCY 5BR8C 3CCU1 2UXCC 4PHTA 2R6MA 3SO4A 1RO2A 2IV2X 1VQ6Z 2VF1A 2PROA 4HGZA 2OPLA 1M902 2DE5A 3JAMb 1YJ91 2ONFA 3IPLA 2K5RA 5BSWA 1HNZC 3I551 5FLXf 3GCFA 4BY7I 2OTJ1 4A3GI 5D1PA 1KQSZ 4X6AI 1HH2P 2M5OA 3A9VA 3NFZA 3S17I 2Z51A 3R44A 3G6E1 1I6HI 5K85A 4NBEA 3J80b 5BSMA 4IZ6A 4G37A 2E7ZA 3EQ6A 2QEXZ 3UZ0A 3G4SZ 5BUQA 1Z02A 3IX0A 3GTPI 2RHBA 4JI1C 1Q861 3C5EA 2Y4NA 4D56A 4MD8A 1YJN1 5CM2M 1VQ7Z 3CCV1 1R9TI 2JIMA 3GPCA 3A9UA 2J6AA 2JMPA 5T6BA 3K6RA 1VQP1 1O90A 1YIJ1 1HNXC 3OW2Y 3H0GI 2E7GA 2NCLA 2JIQA 1WCMI 3J7A4 1M901 1MDFA 4MXUA 2OPLB 1K732 3GTMI 4R1LA 1GPMA 4JI3C 1Q16A 3CC21 3P5JB 2UUBC 4NDNA 3U50C 1XRCA 1YUAA 1VQMZ 4GS5A 5C4XI 5AE2A 5BSRA 4NBCA 4OX9C 1LCIA 3ESWA 3DAYA 4DR6C 1FDOA 5FLXb 3ETOA 5IFIA 1QVGZ 3IR7A 4E2YA 4DR5C 4GXRA 3CXCZ 4RLFA 2ZZMA 3B7WA 1K8A2 4DG9A 4FUTA 2V8IA 5BSTA 2V8KA 3LNVA 3N2QA 2AKLA 4X64C 2VPZA 3CCM1 2P28A 1TWCI 2LFUA 2P02A 3TDHB 2LEXA 1I94C 2DE6A 1QXFA 2DE7A 3CQ2A 3TR3A 1W2BY 3DLPX 3I4MI 5LMNC 4RLQA 1M6XC 3CCJZ 2PM9A 2KZ0A 5D1OA 3CC71 2ZM6C 2HF1A 5IT9D 1K731 2JMOA 4DQYB 2UXBC 1V25A 1YJWZ 1MDBA 4DCTA 2KPIA 3S16I 3AF5A 1IB8A 2Y27A 1XRBA 1T5DX 2QVXX 3T1YC 3PO3I 1VQOZ 3VNSA 4A3JI 2HJGA 5AN9F 3OW2Z 3GKQA 3NPDA 1K8A1 1Z01A 2V3VA 5C3EI 4A3LI 1VQN1 1VQK1 1X3WA 2JUBA 4NB8A 2P2MA 1HR0C 2Q51A 2JS4A 4JI8C 1KD12 1DL6A 2W04A 4MD7A 2CY1A 4BC7A 4LF7C 4R0MA 3I08A 5KEIA 5BURA 3H2TA 4DCSA 1RNIA 4ZLPA 1TWFI 3RG2A 4FUQA 4KTTA 2OBVA 2JIRA 2YWCA 3GKUA 3O2EA 3MZLB 3CCQZ 1X3ZA 4AQYC 2UUAC 3IEUA 2OTLZ 2YCBA 4RVGA 3CME1 3CD61 2RPRA 1JJ2Z 1S7MA 5LCIA 1WJ2A 3VNQA 5GTDA 1SFOI 3BG1B 4ZJZA 4RV9A 1VQLZ 4G36A 1S72Z 1L2FA 2ASBA 4K0KC 3CJEA 1W2BZ 1BA3A 1RY2A 2QR1B 2QKDA 1KD11 2VZEA 4YHHC 5A1GA 3FCCA 1N33C 1MXBA 3TE5B 2E2JI 2NVTI 4NBAA 1I50I 3CCEZ 4RVDA 1SIWA 5DV9A 2JR6A 1YUKA 4JI2C 1N2FA 2MCQA 1PFTA 1YI2Z 5BUSA 5BSUA 1UWDA 4BXXI 3VMIA 1M6XA 3OTOC 1Y1VI 2QEX1 1Q822 3G4S1 2EGTA 4E33A 2WB1A 3GTJI 2VUGA 2R7ZI 4G1IA 4RMNA 2HHHC 4IR7A 3J81D 2RIQA 2GU2A 4NFRA 4B3RC 3I4NI 3MZKB 2D1TA 4RVNA 1WF3A 2OOXB 2QA4Z 1VQ9Z 4GXQA 3FCEA 1XS3A 4E2WA 1QF8A 4DR1C 4NBGA 4X66C 2QVYX 3HOWI 2OTJZ 4DV6C 3T1HC 1YITZ 1J5EC 3A26A 4RVHA 4DV7C 3CW8X 3NYQA 3G6EZ 1Q812 1PU1A 4DV4C 4JI4C 5KYVA 4AYBA 2XR1A 2D1RA 1ZB8A 1ZH1A 2PN2A 2R93I 1NUIA 3S1NI 4NXNC 3BG0B 1NYEA 5A19A 5AE1A 4BBSI 1PA4A 2E9HA 1VQM1 4A3EI 1YJNZ 3CCVZ 3GTGI 3UOWA 3S2DI 4DV5C 3F3FC 3CC41 3CCRZ 5A2QD 1QYPA 4MH4A 3S14I 3J81f 4ISBA 3HKZA 3EERA 1Q821 5KYTA 4K0BA 3CCLZ 1YIJZ 2E8CA 2YWBA 3NYRA 1X0TA 3CMA1 2UXDC 3VB9A 2JIOA 4A3DI 1T5HX 4JM1A 1MXAA 3KIHA 1KC82 2E8EA 2E8FA 1ML8A 3MONA 3NH4A 3M4OI 2F4MA 2HU9A 2YX1A 3CC2Z 1JJ2Y 3N54B 1EGAA 2WD9A 3CQ1A 1HNWC 2VQEC 2P2FA 4LFBC 5IP7I 1Q811 5E7QA 3CCJ1 2G2KA 3A25A 3PBKA 1IBLC 2P3YA 4BY1I 2B63I 3CPWY 2D27A 3FKII 3T4NB 3JAMD 2QW0X 3RZDI 5T64A 3VNRA 4NBBA 1VQO1 3GTLI 3CCSZ 2OZKA 2NVYI 4MTNA 2GTHA 1UKKA 4A3KI 3G711 4MONA 5FLMI 3IF8A 3S1QI 3R9WA 1Z03A 1YHQ1 3RZOI 4BCAA 5JRHA 4DV3C 3J81b 1KC81 3K7AI 2R92I 2YADA 3S2HI 4R1MA 4NXMC 4NB9A 3NH8A 1PG4A 4D4IA 3UX2A 1XNQC 2VQFC 2BJOA 4BC9A 1K83I 2NAPA 2DYJA 2AYDA 3CQ3A 3ETCA 1PG3A 2P2JA 5IP9I 5IT9f 2OO4A 4L2ZA 3I56Z 1K9M2 2BH1X 1IBMC 3LUSA 3GTQI 3GTMS 3IEVA 4PUHA 3S1MI 2RBLA 3EEDA 3Q87A 2VUMI 3AY0A 4RVOA 1IBKC 4LFCC 4YY3C 3E7WA 4GKKC 1AA6A 2V7BA 5AE3A 3CCQ1 2VSQA 1P4EC 1VQKZ 4PZPA 2AYAA 1RLYA 2QVZX 1FLOA 3PESA 4WS9A 2OTL1 1WH9A 1XMQC 5C4JI 3D9XA
chains in the Genus database with same CATH topology
1VQ8Z 4B3SC 3FQQA 1N36C 4JI0C 3AF6A 1QWIA 4L7IA 3D6WA 1VQL1 4A3FI 1S721 4Y7NI 2QL8A 3IMLA 4HPVA 5FLXD 1XMOC 3FQMA 4XX2A 1VQ61 5T8TA 3PO2I 4A3BI 3L95X 4I9GA 3S15I 2F4VC 5IWAC 4LF8C 3CPWZ 4E30A 3E7XA 4E32A 2D1SA 1P9NA 1AMUA 4LF5C 2JA7I 4LF9C 1NJI2 1YI21 2E5LC 1NP6A 1K9M1 1K0RA 1VQ5Z 1XNRC 4JYAC 1VQ4Z 2Y0SA 2ZAEB 4MRIA 4BSZA 1MKYA 1V26A 3CCUZ 5IT9b 2LIYA 3GR1A 4DCUA 4DR4C 4CL1A 3TUFA 4HH4A 3PO3S 1WW9A 1VQ91 2QA41 4WV3A 1VQ71 4DG8A 4JI5C 3R9XA 1YJ9Z 4NH1C 4EWCA 4A3CI 3I55Z 1USPB 1YIT1 2Y4OA 1QVFZ 1QM4A 2QREB 2CXCA 1N32C 4JI6C 2E2II 4TPSB 4DR7C 2KZFA 3GR0A 2Q4ZA 4PROC 2YU9I 3HOUI 2K3RA 4L4QA 1N8R2 4EATA 4DV0C 4QTUA 1WIIA 3KXWA 4X62C 2I3CA 1TFIA 4ODJA 2UU9C 2F4OA 4FTFA 1NJI1 4DUZC 3LGXA 4DR2C 2H85A 4LF4C 2PK7A 1RQFA 3CCR1 5A1IA 3HOVI 1FUGA 5C44I 3M3YI 1VQPZ 3CCL1 4DUYC 3VTNA 3CQZI 1JOSA 4A3II 2ATWA 2E0GA 3HOXI 2M6NA 3S82A 2D28C 4DR3C 3KIFA 4B3MC 4LFAC 2DPLA 2NVQI 1ZB9A 2WAQA 4DK1A 4E2ZA 2JA8I 4JV5C 4D4GA 1VLAA 5LMUC 3CC4Z 1Y1WI 3GTOI 1N8R1 1TWHI 4JI7C 1TWAI 4A3MI 2PMZA 2M48A 3H3VJ 2JNYA 1YJW1 4LE5A 4X65C 1P7LA 4KHPC 3F3PC 3CMAZ 1M1K2 2JA5I 4Y52I 4U5YD 5A2Qf 3PROC 4OYCA 5CZVA 5T67A 4DGLA 3CCS1 4LF6C 4DV1C 4DCVA 2UUCC 3CCMZ 1Y1VS 4HGYA 4NBFA 3A4IA 1I3QI 1KKGA 1RO0A 3S1RI 2OOYB 4A93I 3NDJA 2O4HA 1Q7Y2 1RG9A 3GTKI 2QRDB 3J80D 1LQLA 1O92A 1TWGI 3I07A 2P2QA 4D57A 1ULTA 2QRCB 3L8CA 4NBHA 4E2XA 4NBDA 2O53A 3HOZI 2WP0C 3NH5A 3CC7Z 3IFUA 4BBYA 5BSVA 4NOZA 4DV2C 1QVFY 4TNUA 1KQSY 5CZXA 4MD9A 1L1OC 3I561 4RVFA 4RM3A 5LL6f 2RT9A 3G7SA 1KRLA 4OXIA 3JAMf 4QTTA 4RS4A 3G71Z 3QWUA 4I9FA 1YJ7A 1M1K1 1YHQZ 1VQNZ 2KI7B 2JA6I 2E2HI 3LAXA 4KTVA 5T8SA 5K8FA 4B3TC 3VMHA 1MD9A 3RV2A 1N34C 1USPA 3J80f 1VQ81 2PT7G 2P20A 1Q7Y1 4S1TA 5A2Qb 1JWHC 3DHVA 1MXCA 2D7VA 3NDIA 3HOYI 2NVXI 4RM2A 2GTIA 4E31A 3CW9A 5D1OB 1O9TA 2QLVB 5H9UA 3TQIA 4BBRI 3VMGA 2P2BA 5ADZA 3CCE1 1Q862 3NI2A 2IZ4A 1RO4A 2IZ3A 3TDEA 2D1QA 4GKJC 1FJGC 1VQ51 2V8JA 3CMEZ 1VQ41 1QVGY 3CD6Z 1XRAA 1O93A 2W03A 3CXCY 5BR8C 3CCU1 2UXCC 4PHTA 2R6MA 3SO4A 1RO2A 1VQ6Z 2PROA 2VF1A 4HGZA 2OPLA 1M902 2DE5A 3JAMb 1YJ91 2ONFA 3IPLA 2K5RA 5BSWA 1HNZC 3I551 5FLXf 3GCFA 4BY7I 2OTJ1 4A3GI 5D1PA 1KQSZ 4X6AI 1HH2P 3A9VA 3NFZA 3S17I 3R44A 3G6E1 1I6HI 5K85A 4NBEA 3J80b 5BSMA 4IZ6A 4G37A 3EQ6A 2QEXZ 3UZ0A 3G4SZ 5BUQA 1Z02A 3IX0A 3GTPI 2RHBA 4JI1C 1Q861 3C5EA 2Y4NA 4D56A 4MD8A 1YJN1 5CM2M 1VQ7Z 3CCV1 1R9TI 3GPCA 3A9UA 2J6AA 2JMPA 5T6BA 1VQP1 1O90A 1YIJ1 1HNXC 3OW2Y 3H0GI 2E7GA 1WCMI 3J7A4 1M901 1MDFA 4MXUA 2OPLB 1K732 3GTMI 4R1LA 1GPMA 4JI3C 3CC21 3P5JB 2UUBC 4NDNA 3U50C 1XRCA 1YUAA 1VQMZ 4GS5A 5C4XI 5AE2A 5BSRA 4NBCA 4OX9C 1LCIA 3ESWA 3DAYA 4DR6C 5FLXb 3ETOA 5IFIA 1QVGZ 4E2YA 4DR5C 4GXRA 3CXCZ 4RLFA 3B7WA 1K8A2 4DG9A 4FUTA 2V8IA 5BSTA 2V8KA 3LNVA 3N2QA 2AKLA 4X64C 3CCM1 2P28A 1TWCI 2LFUA 2P02A 3TDHB 1I94C 2DE6A 2DE7A 1W2BY 3DLPX 3I4MI 5LMNC 4RLQA 3CCJZ 2PM9A 5D1OA 3CC71 2ZM6C 2HF1A 5IT9D 1K731 2JMOA 4DQYB 2UXBC 1V25A 1YJWZ 1MDBA 4DCTA 2KPIA 3S16I 3AF5A 2Y27A 1XRBA 1T5DX 2QVXX 3T1YC 3PO3I 1VQOZ 3VNSA 4A3JI 2HJGA 5AN9F 3OW2Z 3GKQA 3NPDA 1K8A1 1Z01A 5C3EI 4A3LI 1VQN1 1VQK1 1X3WA 2JUBA 4NB8A 2P2MA 1HR0C 2Q51A 2JS4A 4JI8C 1KD12 1DL6A 2W04A 4MD7A 2CY1A 4BC7A 4LF7C 4R0MA 3I08A 5KEIA 5BURA 3H2TA 4DCSA 1RNIA 4ZLPA 1TWFI 3RG2A 4FUQA 4KTTA 2OBVA 2YWCA 3GKUA 3MZLB 3CCQZ 1X3ZA 4AQYC 2UUAC 3IEUA 2OTLZ 2YCBA 4RVGA 3CME1 3CD61 2RPRA 1JJ2Z 1S7MA 3VNQA 5GTDA 1SFOI 3BG1B 4ZJZA 4RV9A 1VQLZ 4G36A 1S72Z 1L2FA 2ASBA 4K0KC 3CJEA 1W2BZ 1BA3A 1RY2A 2QR1B 2QKDA 1KD11 2VZEA 4YHHC 5A1GA 3FCCA 1N33C 1MXBA 3TE5B 2E2JI 2NVTI 4NBAA 1I50I 3CCEZ 4RVDA 5DV9A 2JR6A 1YUKA 4JI2C 1N2FA 1PFTA 1YI2Z 5BUSA 5BSUA 4BXXI 3VMIA 3OTOC 1Y1VI 2QEX1 1Q822 3G4S1 2EGTA 4E33A 2WB1A 3GTJI 2VUGA 2R7ZI 4G1IA 4RMNA 2HHHC 4IR7A 3J81D 2RIQA 2GU2A 4NFRA 4B3RC 3I4NI 3MZKB 2D1TA 4RVNA 1WF3A 2OOXB 2QA4Z 1VQ9Z 4GXQA 3FCEA 4E2WA 1QF8A 4DR1C 4NBGA 4X66C 2QVYX 3HOWI 2OTJZ 4DV6C 3T1HC 1YITZ 1J5EC 4RVHA 4DV7C 3CW8X 3NYQA 3G6EZ 1Q812 4DV4C 4JI4C 5KYVA 4AYBA 2XR1A 2D1RA 1ZB8A 1ZH1A 2PN2A 2R93I 1NUIA 3S1NI 4NXNC 3BG0B 1NYEA 5A19A 5AE1A 4BBSI 1PA4A 2E9HA 1VQM1 4A3EI 1YJNZ 3CCVZ 3GTGI 3UOWA 3S2DI 4DV5C 3F3FC 3CC41 3CCRZ 5A2QD 1QYPA 4MH4A 3S14I 3J81f 4ISBA 3HKZA 3EERA 1Q821 5KYTA 4K0BA 3CCLZ 1YIJZ 2E8CA 2YWBA 3NYRA 1X0TA 3CMA1 2UXDC 3VB9A 4A3DI 1T5HX 4JM1A 1MXAA 3KIHA 1KC82 2E8EA 2E8FA 1ML8A 3MONA 3NH4A 3M4OI 2F4MA 2HU9A 3CC2Z 1JJ2Y 3N54B 1EGAA 2WD9A 1HNWC 2VQEC 2P2FA 4LFBC 5IP7I 1Q811 5E7QA 3CCJ1 2G2KA 3PBKA 1IBLC 2P3YA 4BY1I 2B63I 3CPWY 2D27A 3FKII 3T4NB 3JAMD 2QW0X 3RZDI 5T64A 3VNRA 4NBBA 1VQO1 3GTLI 3CCSZ 2OZKA 2NVYI 4MTNA 2GTHA 1UKKA 4A3KI 3G711 4MONA 5FLMI 3IF8A 3S1QI 3R9WA 1Z03A 1YHQ1 3RZOI 4BCAA 5JRHA 4DV3C 3J81b 1KC81 3K7AI 2R92I 2YADA 3S2HI 4R1MA 4NXMC 4NB9A 3NH8A 1PG4A 4D4IA 1XNQC 2VQFC 2BJOA 4BC9A 1K83I 2DYJA 3ETCA 1PG3A 2P2JA 5IP9I 5IT9f 2OO4A 4L2ZA 3I56Z 1K9M2 2BH1X 1IBMC 3LUSA 3GTQI 3GTMS 3IEVA 3S1MI 2RBLA 3EEDA 3Q87A 2VUMI 1IBKC 4RVOA 4LFCC 4GKKC 4YY3C 3E7WA 2V7BA 5AE3A 3CCQ1 2VSQA 1VQKZ 4PZPA 2AYAA 1RLYA 2QVZX 3PESA 4WS9A 2OTL1 1WH9A 1XMQC 5C4JI 3D9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S C;  1N36 C;  4JI0 C;  3AF6 A;  1QWI A;  3D6W A;  1XMO C;  4A3F I;  2QL8 A;  4Y7N I;  5FLX D;  4XX2 A;  3PO2 I;  4A3B I;  3S15 I;  2F4V C;  5IWA C;  4LF8 C;  4LF5 C;  2JA7 I;  4LF9 C;  2E5L C;  1K0R A;  1XNR C;  4JYA C;  4BSZ A;  1MKY A;  4DCU A;  4DR4 C;  3PO3 S;  1WW9 A;  4JI5 C;  3R9X A;  4A3C I;  1USP B;  2CXC A;  1N32 C;  4JI6 C;  2E2I I;  4DR7 C;  2KZF A;  4DV0 C;  2YU9 I;  3HOU I;  4QTU A;  4X62 C;  1TFI A;  2UU9 C;  2F4O A;  4DUZ C;  4DR2 C;  4LF4 C;  2PK7 A;  3HOV I;  5C44 I;  3M3Y I;  4DUY C;  3CQZ I;  1JOS A;  4A3I I;  2ATW A;  3HOX I;  4DR3 C;  4B3M C;  4LFA C;  2NVQ I;  1ZB9 A;  2JA8 I;  4JV5 C;  1VLA A;  5LMU C;  3GTO I;  1Y1W I;  1TWH I;  4JI7 C;  1TWA I;  4A3M I;  3H3V J;  2JNY A;  4X65 C;  4KHP C;  2JA5 I;  4Y52 I;  4LF6 C;  4DV1 C;  2UUC C;  4DCV A;  1Y1V S;  4NBF A;  1KKG A;  1I3Q I;  3S1R I;  4A93 I;  3GTK I;  3J80 D;  1LQL A;  1TWG I;  3I07 A;  4NBH A;  3HOZ I;  4NBD A;  4NOZ A;  4DV2 C;  1L1O C;  4QTT A;  2JA6 I;  2E2H I;  4B3T C;  3VMH A;  1N34 C;  1USP A;  2PT7 G;  2D7V A;  3HOY I;  2NVX I;  4BBR I;  3VMG A;  1RO4 A;  4GKJ C;  1FJG C;  5BR8 C;  2UXC C;  2OPL A;  2ONF A;  2DE5 A;  2K5R A;  1HNZ C;  3GCF A;  4BY7 I;  4A3G I;  4X6A I;  1HH2 P;  3S17 I;  1I6H I;  4NBE A;  3GTP I;  4JI1 C;  5CM2 M;  1R9T I;  2J6A A;  2JMP A;  1HNX C;  3H0G I;  2E7G A;  1WCM I;  2OPL B;  3GTM I;  4JI3 C;  2UUB C;  3U50 C;  1YUA A;  5C4X I;  4NBC A;  4OX9 C;  4DR6 C;  3ESW A;  4DR5 C;  4X64 C;  2AKL A;  1TWC I;  1I94 C;  2DE6 A;  2DE7 A;  3I4M I;  5LMN C;  2ZM6 C;  2HF1 A;  5IT9 D;  2UXB C;  4DCT A;  2KPI A;  3S16 I;  3AF5 A;  3T1Y C;  3PO3 I;  4A3J I;  2HJG A;  3GKQ A;  5C3E I;  4A3L I;  1X3W A;  4JI8 C;  4NB8 A;  1HR0 C;  2JS4 A;  1DL6 A;  2CY1 A;  4LF7 C;  4DCS A;  1TWF I;  3GKU A;  1X3Z A;  4AQY C;  2UUA C;  3IEU A;  2YCB A;  1SFO I;  2ASB A;  1L2F A;  4K0K C;  3CJE A;  4YHH C;  1N33 C;  2E2J I;  2NVT I;  4NBA A;  1I50 I;  2JR6 A;  4JI2 C;  1N2F A;  1PFT A;  4BXX I;  3VMI A;  3OTO C;  1Y1V I;  2R7Z I;  2EGT A;  3GTJ I;  2HHH C;  4B3R C;  3J81 D;  3I4N I;  1WF3 A;  4DR1 C;  4NBG A;  4X66 C;  3HOW I;  3T1H C;  4DV6 C;  1J5E C;  4DV7 C;  4DV4 C;  4JI4 C;  2XR1 A;  1ZB8 A;  2PN2 A;  2R93 I;  1NUI A;  3S1N I;  4NXN C;  1NYE A;  4BBS I;  1PA4 A;  4A3E I;  3GTG I;  3S2D I;  4DV5 C;  5A2Q D;  1QYP A;  4MH4 A;  3S14 I;  3EER A;  2E8C A;  2UXD C;  3VB9 A;  4A3D I;  2E8E A;  2E8F A;  1ML8 A;  3M4O I;  2F4M A;  1EGA A;  1HNW C;  2VQE C;  4LFB C;  5IP7 I;  1IBL C;  2P3Y A;  4BY1 I;  2B63 I;  3FKI I;  3JAM D;  3RZD I;  4NBB A;  3GTL I;  2NVY I;  4MTN A;  1UKK A;  4A3K I;  5FLM I;  3S1Q I;  3R9W A;  3RZO I;  4DV3 C;  3S2H I;  3K7A I;  2R92 I;  4NXM C;  4NB9 A;  1XNQ C;  2VQF C;  2BJO A;  1K83 I;  2DYJ A;  5IP9 I;  1IBM C;  3LUS A;  3GTQ I;  3GTM S;  3IEV A;  3S1M I;  2RBL A;  3Q87 A;  1IBK C;  2VUM I;  4LFC C;  4GKK C;  4YY3 C;  1RLY A;  1XMQ C;  1WH9 A;  5C4J I; 
#chains in the Genus database with same CATH topology
 1VQ8 Z;  4B3S C;  3FQQ A;  1N36 C;  4JI0 C;  3AF6 A;  1QWI A;  4L7I A;  3D6W A;  1VQL 1;  4A3F I;  1S72 1;  4Y7N I;  2QL8 A;  3IML A;  4HPV A;  5FLX D;  1XMO C;  3FQM A;  4XX2 A;  1VQ6 1;  5T8T A;  3PO2 I;  4A3B I;  3L95 X;  4I9G A;  3S15 I;  3UEB A;  2F4V C;  5IWA C;  4LF8 C;  1WZN A;  3CPW Z;  4E30 A;  3E7X A;  4E32 A;  2D1S A;  1P9N A;  1AMU A;  4LF5 C;  2JA7 I;  4LF9 C;  1NJI 2;  1YI2 1;  2E5L C;  1NP6 A;  1K9M 1;  2V45 A;  1K0R A;  3LNO A;  1VQ5 Z;  1XNR C;  4JYA C;  1VQ4 Z;  2Y0S A;  2ZAE B;  4MRI A;  4BSZ A;  1MKY A;  1V26 A;  3CCU Z;  5IT9 b;  2LIY A;  3GR1 A;  4DCU A;  4DR4 C;  4CL1 A;  3TUF A;  4HH4 A;  3PO3 S;  1WW9 A;  1VQ9 1;  2QA4 1;  4WV3 A;  1VQ7 1;  4DG8 A;  4JI5 C;  1XHJ A;  3R9X A;  1YJ9 Z;  4NH1 C;  4EWC A;  4A3C I;  3I55 Z;  1USP B;  1YIT 1;  2Y4O A;  1QVF Z;  1QM4 A;  2QRE B;  2CXC A;  1N32 C;  4JI6 C;  2E2I I;  4TPS B;  4DR7 C;  2KZF A;  1TH5 A;  3GR0 A;  2Q4Z A;  4PRO C;  2YU9 I;  3HOU I;  2K3R A;  4L4Q A;  1N8R 2;  4EAT A;  4DV0 C;  4QTU A;  1WII A;  3KXW A;  4X62 C;  2I3C A;  1TFI A;  4ODJ A;  2UU9 C;  2F4O A;  4FTF A;  1NJI 1;  4DUZ C;  3LGX A;  4DR2 C;  2H85 A;  2JNV A;  4LF4 C;  2PK7 A;  1RQF A;  3CCR 1;  5A1I A;  3HOV I;  1FUG A;  5C44 I;  3M3Y I;  1VQP Z;  3CCL 1;  4DUY C;  3VTN A;  1WCJ A;  3CQZ I;  1JOS A;  1V60 A;  4A3I I;  2ATW A;  2E0G A;  3HOX I;  2M6N A;  1P4E A;  1NY8 A;  3S82 A;  2D28 C;  4DR3 C;  3KIF A;  4B3M C;  4LFA C;  2DPL A;  2NVQ I;  1ZB9 A;  2WAQ A;  3D2L A;  4DK1 A;  4E2Z A;  1VEH A;  2JA8 I;  4JV5 C;  4D4G A;  1VLA A;  5LMU C;  1Y8C A;  1Y1W I;  3CC4 Z;  3GTO I;  1N8R 1;  1TWH I;  4JI7 C;  1TWA I;  4A3M I;  2PMZ A;  2M48 A;  3H3V J;  2JNY A;  1YJW 1;  4PUI A;  4PUG A;  4LE5 A;  4X65 C;  2VPY A;  1P7L A;  4KHP C;  3F3P C;  3CMA Z;  1M1K 2;  2JA5 I;  4Y52 I;  4U5Y D;  5A2Q f;  3PRO C;  4OYC A;  5CZV A;  5T67 A;  4DGL A;  3CCS 1;  4LF6 C;  4DV1 C;  4DCV A;  2UUC C;  3CCM Z;  1Y1V S;  4HGY A;  4NBF A;  3A4I A;  1I3Q I;  1KKG A;  1RO0 A;  3S1R I;  2OOY B;  4A93 I;  3NDJ A;  2O4H A;  1Q7Y 2;  1RG9 A;  3GTK I;  2QRD B;  2JIP A;  2VPW A;  3J80 D;  1LQL A;  1O92 A;  1TWG I;  3I07 A;  2P2Q A;  4D57 A;  1ULT A;  2QRC B;  3L8C A;  4NBH A;  4E2X A;  4NBD A;  2O53 A;  3HOZ I;  2WP0 C;  3NH5 A;  3CC7 Z;  3IFU A;  4BBY A;  5BSV A;  4NOZ A;  4DV2 C;  1QVF Y;  4TNU A;  1KQS Y;  5CZX A;  4MD9 A;  2CU6 A;  1L1O C;  3I56 1;  4RVF A;  4RM3 A;  5LL6 f;  2RT9 A;  3G7S A;  1KRL A;  4OXI A;  3JAM f;  3UX3 A;  4QTT A;  4RS4 A;  3G71 Z;  2MM9 A;  3QWU A;  4I9F A;  1YJ7 A;  1M1K 1;  1YHQ Z;  2M5H A;  1VQN Z;  2KI7 B;  2JA6 I;  2E2H I;  3LAX A;  4KTV A;  5T8S A;  5K8F A;  2MMA B;  4B3T C;  3VMH A;  1MD9 A;  3RV2 A;  1N34 C;  1USP A;  3J80 f;  1VQ8 1;  2PT7 G;  2P20 A;  1Q7Y 1;  4S1T A;  5A2Q b;  1JWH C;  3DHV A;  1MXC A;  2D7V A;  3NDI A;  3HOY I;  1FDI A;  2NVX I;  4RM2 A;  2GTI A;  4E31 A;  3CW9 A;  5D1O B;  1O9T A;  2QLV B;  5H9U A;  2KDN A;  4BBR I;  3TQI A;  3VMG A;  2DHM A;  2P2B A;  5ADZ A;  3CCE 1;  1Q86 2;  3NI2 A;  2IZ4 A;  1RO4 A;  2IZ3 A;  3TDE A;  2D1Q A;  4GKJ C;  1FJG C;  2ZZN A;  1VQ5 1;  2V8J A;  2VPX A;  3CME Z;  1VQ4 1;  1QVG Y;  3CD6 Z;  1XRA A;  1O93 A;  2W03 A;  3CXC Y;  5BR8 C;  3CCU 1;  2UXC C;  4PHT A;  2R6M A;  3SO4 A;  1RO2 A;  2IV2 X;  1VQ6 Z;  2VF1 A;  2PRO A;  4HGZ A;  2OPL A;  1M90 2;  2DE5 A;  3JAM b;  1YJ9 1;  2ONF A;  3IPL A;  2K5R A;  5BSW A;  1HNZ C;  3I55 1;  5FLX f;  3GCF A;  4BY7 I;  2OTJ 1;  4A3G I;  5D1P A;  1KQS Z;  4X6A I;  1HH2 P;  2M5O A;  3A9V A;  3NFZ A;  3S17 I;  2Z51 A;  3R44 A;  3G6E 1;  1I6H I;  5K85 A;  4NBE A;  3J80 b;  5BSM A;  4IZ6 A;  4G37 A;  2E7Z A;  3EQ6 A;  2QEX Z;  3UZ0 A;  3G4S Z;  5BUQ A;  1Z02 A;  3IX0 A;  3GTP I;  2RHB A;  4JI1 C;  1Q86 1;  3C5E A;  2Y4N A;  4D56 A;  4MD8 A;  1YJN 1;  5CM2 M;  1VQ7 Z;  3CCV 1;  1R9T I;  2JIM A;  3GPC A;  3A9U A;  2J6A A;  2JMP A;  5T6B A;  3K6R A;  1VQP 1;  1O90 A;  1YIJ 1;  1HNX C;  3OW2 Y;  3H0G I;  2E7G A;  2NCL A;  2JIQ A;  1WCM I;  3J7A 4;  1M90 1;  1MDF A;  4MXU A;  2OPL B;  1K73 2;  3GTM I;  4R1L A;  1GPM A;  4JI3 C;  1Q16 A;  3CC2 1;  3P5J B;  2UUB C;  4NDN A;  3U50 C;  1XRC A;  1YUA A;  1VQM Z;  4GS5 A;  5C4X I;  5AE2 A;  5BSR A;  4NBC A;  4OX9 C;  1LCI A;  3ESW A;  3DAY A;  4DR6 C;  1FDO A;  5FLX b;  3ETO A;  5IFI A;  1QVG Z;  3IR7 A;  4E2Y A;  4DR5 C;  4GXR A;  3CXC Z;  4RLF A;  2ZZM A;  3B7W A;  1K8A 2;  4DG9 A;  4FUT A;  2V8I A;  5BST A;  2V8K A;  3LNV A;  3N2Q A;  2AKL A;  4X64 C;  2VPZ A;  3CCM 1;  2P28 A;  1TWC I;  2LFU A;  2P02 A;  3TDH B;  2LEX A;  1I94 C;  2DE6 A;  1QXF A;  2DE7 A;  3CQ2 A;  3TR3 A;  1W2B Y;  3DLP X;  3I4M I;  5LMN C;  4RLQ A;  1M6X C;  3CCJ Z;  2PM9 A;  2KZ0 A;  5D1O A;  3CC7 1;  2ZM6 C;  2HF1 A;  5IT9 D;  1K73 1;  2JMO A;  4DQY B;  2UXB C;  1V25 A;  1YJW Z;  1MDB A;  4DCT A;  2KPI A;  3S16 I;  3AF5 A;  1IB8 A;  2Y27 A;  1XRB A;  1T5D X;  2QVX X;  3T1Y C;  3PO3 I;  1VQO Z;  3VNS A;  4A3J I;  2HJG A;  5AN9 F;  3OW2 Z;  3GKQ A;  3NPD A;  1K8A 1;  1Z01 A;  2V3V A;  5C3E I;  4A3L I;  1VQN 1;  1VQK 1;  1X3W A;  2JUB A;  4NB8 A;  2P2M A;  1HR0 C;  2Q51 A;  2JS4 A;  4JI8 C;  1KD1 2;  1DL6 A;  2W04 A;  4MD7 A;  2CY1 A;  4BC7 A;  4LF7 C;  4R0M A;  3I08 A;  5KEI A;  5BUR A;  3H2T A;  4DCS A;  1RNI A;  4ZLP A;  1TWF I;  3RG2 A;  4FUQ A;  4KTT A;  2OBV A;  2JIR A;  2YWC A;  3GKU A;  3O2E A;  3MZL B;  3CCQ Z;  1X3Z A;  4AQY C;  2UUA C;  3IEU A;  2OTL Z;  2YCB A;  4RVG A;  3CME 1;  3CD6 1;  2RPR A;  1JJ2 Z;  1S7M A;  5LCI A;  1WJ2 A;  3VNQ A;  5GTD A;  1SFO I;  3BG1 B;  4ZJZ A;  4RV9 A;  1VQL Z;  4G36 A;  1S72 Z;  1L2F A;  2ASB A;  4K0K C;  3CJE A;  1W2B Z;  1BA3 A;  1RY2 A;  2QR1 B;  2QKD A;  1KD1 1;  2VZE A;  4YHH C;  5A1G A;  3FCC A;  1N33 C;  1MXB A;  3TE5 B;  2E2J I;  2NVT I;  4NBA A;  1I50 I;  3CCE Z;  4RVD A;  1SIW A;  5DV9 A;  2JR6 A;  1YUK A;  4JI2 C;  1N2F A;  2MCQ A;  1PFT A;  1YI2 Z;  5BUS A;  5BSU A;  1UWD A;  4BXX I;  3VMI A;  1M6X A;  3OTO C;  1Y1V I;  2QEX 1;  1Q82 2;  3G4S 1;  2EGT A;  4E33 A;  2WB1 A;  3GTJ I;  2VUG A;  2R7Z I;  4G1I A;  4RMN A;  2HHH C;  4IR7 A;  3J81 D;  2RIQ A;  2GU2 A;  4NFR A;  4B3R C;  3I4N I;  3MZK B;  2D1T A;  4RVN A;  1WF3 A;  2OOX B;  2QA4 Z;  1VQ9 Z;  4GXQ A;  3FCE A;  1XS3 A;  4E2W A;  1QF8 A;  4DR1 C;  4NBG A;  4X66 C;  2QVY X;  3HOW I;  2OTJ Z;  4DV6 C;  3T1H C;  1YIT Z;  1J5E C;  3A26 A;  4RVH A;  4DV7 C;  3CW8 X;  3NYQ A;  3G6E Z;  1Q81 2;  1PU1 A;  4DV4 C;  4JI4 C;  5KYV A;  4AYB A;  2XR1 A;  2D1R A;  1ZB8 A;  1ZH1 A;  2PN2 A;  2R93 I;  1NUI A;  3S1N I;  4NXN C;  3BG0 B;  1NYE A;  5A19 A;  5AE1 A;  4BBS I;  1PA4 A;  2E9H A;  1VQM 1;  4A3E I;  1YJN Z;  3CCV Z;  3GTG I;  3UOW A;  3S2D I;  4DV5 C;  3F3F C;  3CC4 1;  3CCR Z;  5A2Q D;  1QYP A;  4MH4 A;  3S14 I;  3J81 f;  4ISB A;  3HKZ A;  3EER A;  1Q82 1;  5KYT A;  4K0B A;  3CCL Z;  1YIJ Z;  2E8C A;  2YWB A;  3NYR A;  1X0T A;  3CMA 1;  2UXD C;  3VB9 A;  2JIO A;  4A3D I;  1T5H X;  4JM1 A;  1MXA A;  3KIH A;  1KC8 2;  2E8E A;  2E8F A;  1ML8 A;  3MON A;  3NH4 A;  3M4O I;  2F4M A;  2HU9 A;  2YX1 A;  3CC2 Z;  1JJ2 Y;  3N54 B;  1EGA A;  2WD9 A;  3CQ1 A;  1HNW C;  2VQE C;  2P2F A;  4LFB C;  5IP7 I;  1Q81 1;  5E7Q A;  3CCJ 1;  2G2K A;  3A25 A;  3PBK A;  1IBL C;  2P3Y A;  4BY1 I;  2B63 I;  3CPW Y;  2D27 A;  3FKI I;  3T4N B;  3JAM D;  2QW0 X;  3RZD I;  5T64 A;  3VNR A;  4NBB A;  1VQO 1;  3GTL I;  3CCS Z;  2OZK A;  2NVY I;  4MTN A;  2GTH A;  1UKK A;  4A3K I;  3G71 1;  4MON A;  5FLM I;  3IF8 A;  3S1Q I;  3R9W A;  1Z03 A;  1YHQ 1;  3RZO I;  4BCA A;  5JRH A;  4DV3 C;  3J81 b;  1KC8 1;  3K7A I;  2R92 I;  2YAD A;  3S2H I;  4R1M A;  4NXM C;  4NB9 A;  3NH8 A;  1PG4 A;  4D4I A;  3UX2 A;  1XNQ C;  2VQF C;  2BJO A;  4BC9 A;  1K83 I;  2NAP A;  2DYJ A;  2AYD A;  3CQ3 A;  3ETC A;  1PG3 A;  2P2J A;  5IP9 I;  5IT9 f;  2OO4 A;  4L2Z A;  3I56 Z;  1K9M 2;  2BH1 X;  1IBM C;  3LUS A;  3GTQ I;  3GTM S;  3IEV A;  4PUH A;  3S1M I;  2RBL A;  3EED A;  3Q87 A;  2VUM I;  3AY0 A;  4RVO A;  1IBK C;  4LFC C;  4YY3 C;  3E7W A;  4GKK C;  1AA6 A;  2V7B A;  5AE3 A;  3CCQ 1;  2VSQ A;  1P4E C;  1VQK Z;  4PZP A;  2AYA A;  1RLY A;  2QVZ X;  1FLO A;  3PES A;  4WS9 A;  2OTL 1;  1WH9 A;  1XMQ C;  5C4J I;  3D9X A; 
#chains in the Genus database with same CATH homology
 1VQ8 Z;  4B3S C;  3FQQ A;  1N36 C;  4JI0 C;  3AF6 A;  1QWI A;  4L7I A;  3D6W A;  1VQL 1;  4A3F I;  1S72 1;  4Y7N I;  2QL8 A;  3IML A;  4HPV A;  5FLX D;  1XMO C;  3FQM A;  4XX2 A;  1VQ6 1;  5T8T A;  3PO2 I;  4A3B I;  3L95 X;  4I9G A;  3S15 I;  2F4V C;  5IWA C;  4LF8 C;  3CPW Z;  4E30 A;  3E7X A;  4E32 A;  2D1S A;  1P9N A;  1AMU A;  4LF5 C;  2JA7 I;  4LF9 C;  1NJI 2;  1YI2 1;  2E5L C;  1NP6 A;  1K9M 1;  1K0R A;  1VQ5 Z;  1XNR C;  4JYA C;  1VQ4 Z;  2Y0S A;  2ZAE B;  4MRI A;  4BSZ A;  1MKY A;  1V26 A;  3CCU Z;  5IT9 b;  2LIY A;  3GR1 A;  4DCU A;  4DR4 C;  4CL1 A;  3TUF A;  4HH4 A;  3PO3 S;  1WW9 A;  1VQ9 1;  2QA4 1;  4WV3 A;  1VQ7 1;  4DG8 A;  4JI5 C;  3R9X A;  1YJ9 Z;  4NH1 C;  4EWC A;  4A3C I;  3I55 Z;  1USP B;  1YIT 1;  2Y4O A;  1QVF Z;  1QM4 A;  2QRE B;  2CXC A;  1N32 C;  4JI6 C;  2E2I I;  4TPS B;  4DR7 C;  2KZF A;  3GR0 A;  2Q4Z A;  4PRO C;  2YU9 I;  3HOU I;  2K3R A;  4L4Q A;  1N8R 2;  4EAT A;  4DV0 C;  4QTU A;  1WII A;  3KXW A;  4X62 C;  2I3C A;  1TFI A;  4ODJ A;  2UU9 C;  2F4O A;  4FTF A;  1NJI 1;  4DUZ C;  3LGX A;  4DR2 C;  2H85 A;  4LF4 C;  2PK7 A;  1RQF A;  3CCR 1;  5A1I A;  3HOV I;  1FUG A;  5C44 I;  3M3Y I;  1VQP Z;  3CCL 1;  4DUY C;  3VTN A;  3CQZ I;  1JOS A;  4A3I I;  2ATW A;  2E0G A;  3HOX I;  2M6N A;  3S82 A;  2D28 C;  4DR3 C;  3KIF A;  4B3M C;  4LFA C;  2DPL A;  2NVQ I;  1ZB9 A;  2WAQ A;  4DK1 A;  4E2Z A;  2JA8 I;  4JV5 C;  4D4G A;  1VLA A;  5LMU C;  3CC4 Z;  1Y1W I;  3GTO I;  1N8R 1;  1TWH I;  4JI7 C;  1TWA I;  4A3M I;  2PMZ A;  2M48 A;  3H3V J;  2JNY A;  1YJW 1;  4LE5 A;  4X65 C;  1P7L A;  4KHP C;  3F3P C;  3CMA Z;  1M1K 2;  2JA5 I;  4Y52 I;  4U5Y D;  5A2Q f;  3PRO C;  4OYC A;  5CZV A;  5T67 A;  4DGL A;  3CCS 1;  4LF6 C;  4DV1 C;  4DCV A;  2UUC C;  3CCM Z;  1Y1V S;  4HGY A;  4NBF A;  3A4I A;  1I3Q I;  1KKG A;  1RO0 A;  3S1R I;  2OOY B;  4A93 I;  3NDJ A;  2O4H A;  1Q7Y 2;  1RG9 A;  3GTK I;  2QRD B;  3J80 D;  1LQL A;  1O92 A;  1TWG I;  3I07 A;  2P2Q A;  4D57 A;  1ULT A;  2QRC B;  3L8C A;  4NBH A;  4E2X A;  4NBD A;  2O53 A;  3HOZ I;  2WP0 C;  3NH5 A;  3CC7 Z;  3IFU A;  4BBY A;  5BSV A;  4NOZ A;  4DV2 C;  1QVF Y;  4TNU A;  1KQS Y;  5CZX A;  4MD9 A;  1L1O C;  3I56 1;  4RVF A;  4RM3 A;  5LL6 f;  2RT9 A;  3G7S A;  1KRL A;  4OXI A;  3JAM f;  4QTT A;  4RS4 A;  3G71 Z;  3QWU A;  4I9F A;  1YJ7 A;  1M1K 1;  1YHQ Z;  1VQN Z;  2KI7 B;  2JA6 I;  2E2H I;  3LAX A;  4KTV A;  5T8S A;  5K8F A;  4B3T C;  3VMH A;  1MD9 A;  3RV2 A;  1N34 C;  1USP A;  3J80 f;  1VQ8 1;  2PT7 G;  2P20 A;  1Q7Y 1;  4S1T A;  5A2Q b;  1JWH C;  3DHV A;  1MXC A;  2D7V A;  3NDI A;  3HOY I;  2NVX I;  4RM2 A;  2GTI A;  4E31 A;  3CW9 A;  5D1O B;  1O9T A;  2QLV B;  5H9U A;  3TQI A;  4BBR I;  3VMG A;  2P2B A;  5ADZ A;  3CCE 1;  1Q86 2;  3NI2 A;  2IZ4 A;  1RO4 A;  2IZ3 A;  3TDE A;  2D1Q A;  4GKJ C;  1FJG C;  1VQ5 1;  2V8J A;  3CME Z;  1VQ4 1;  1QVG Y;  3CD6 Z;  1XRA A;  1O93 A;  2W03 A;  3CXC Y;  5BR8 C;  3CCU 1;  2UXC C;  4PHT A;  2R6M A;  3SO4 A;  1RO2 A;  1VQ6 Z;  2PRO A;  2VF1 A;  4HGZ A;  2OPL A;  1M90 2;  2DE5 A;  3JAM b;  1YJ9 1;  2ONF A;  3IPL A;  2K5R A;  5BSW A;  1HNZ C;  3I55 1;  5FLX f;  3GCF A;  4BY7 I;  2OTJ 1;  4A3G I;  5D1P A;  1KQS Z;  4X6A I;  1HH2 P;  3A9V A;  3NFZ A;  3S17 I;  3R44 A;  3G6E 1;  1I6H I;  5K85 A;  4NBE A;  3J80 b;  5BSM A;  4IZ6 A;  4G37 A;  3EQ6 A;  2QEX Z;  3UZ0 A;  3G4S Z;  5BUQ A;  1Z02 A;  3IX0 A;  3GTP I;  2RHB A;  4JI1 C;  1Q86 1;  3C5E A;  2Y4N A;  4D56 A;  4MD8 A;  1YJN 1;  5CM2 M;  1VQ7 Z;  3CCV 1;  1R9T I;  3GPC A;  3A9U A;  2J6A A;  2JMP A;  5T6B A;  1VQP 1;  1O90 A;  1YIJ 1;  1HNX C;  3OW2 Y;  3H0G I;  2E7G A;  1WCM I;  3J7A 4;  1M90 1;  1MDF A;  4MXU A;  2OPL B;  1K73 2;  3GTM I;  4R1L A;  1GPM A;  4JI3 C;  3CC2 1;  3P5J B;  2UUB C;  4NDN A;  3U50 C;  1XRC A;  1YUA A;  1VQM Z;  4GS5 A;  5C4X I;  5AE2 A;  5BSR A;  4NBC A;  4OX9 C;  1LCI A;  3ESW A;  3DAY A;  4DR6 C;  5FLX b;  3ETO A;  5IFI A;  1QVG Z;  4E2Y A;  4DR5 C;  4GXR A;  3CXC Z;  4RLF A;  3B7W A;  1K8A 2;  4DG9 A;  4FUT A;  2V8I A;  5BST A;  2V8K A;  3LNV A;  3N2Q A;  2AKL A;  4X64 C;  3CCM 1;  2P28 A;  1TWC I;  2LFU A;  2P02 A;  3TDH B;  1I94 C;  2DE6 A;  2DE7 A;  1W2B Y;  3DLP X;  3I4M I;  5LMN C;  4RLQ A;  3CCJ Z;  2PM9 A;  5D1O A;  3CC7 1;  2ZM6 C;  2HF1 A;  5IT9 D;  1K73 1;  2JMO A;  4DQY B;  2UXB C;  1V25 A;  1YJW Z;  1MDB A;  4DCT A;  2KPI A;  3S16 I;  3AF5 A;  2Y27 A;  1XRB A;  1T5D X;  2QVX X;  3T1Y C;  3PO3 I;  1VQO Z;  3VNS A;  4A3J I;  2HJG A;  5AN9 F;  3OW2 Z;  3GKQ A;  3NPD A;  1K8A 1;  1Z01 A;  5C3E I;  4A3L I;  1VQN 1;  1VQK 1;  1X3W A;  2JUB A;  4NB8 A;  2P2M A;  1HR0 C;  2Q51 A;  2JS4 A;  4JI8 C;  1KD1 2;  1DL6 A;  2W04 A;  4MD7 A;  2CY1 A;  4BC7 A;  4LF7 C;  4R0M A;  3I08 A;  5KEI A;  5BUR A;  3H2T A;  4DCS A;  1RNI A;  4ZLP A;  1TWF I;  3RG2 A;  4FUQ A;  4KTT A;  2OBV A;  2YWC A;  3GKU A;  3MZL B;  3CCQ Z;  1X3Z A;  4AQY C;  2UUA C;  3IEU A;  2OTL Z;  2YCB A;  4RVG A;  3CME 1;  3CD6 1;  2RPR A;  1JJ2 Z;  1S7M A;  3VNQ A;  5GTD A;  1SFO I;  3BG1 B;  4ZJZ A;  4RV9 A;  1VQL Z;  4G36 A;  1S72 Z;  1L2F A;  2ASB A;  4K0K C;  3CJE A;  1W2B Z;  1BA3 A;  1RY2 A;  2QR1 B;  2QKD A;  1KD1 1;  2VZE A;  4YHH C;  5A1G A;  3FCC A;  1N33 C;  1MXB A;  3TE5 B;  2E2J I;  2NVT I;  4NBA A;  1I50 I;  3CCE Z;  4RVD A;  5DV9 A;  2JR6 A;  1YUK A;  4JI2 C;  1N2F A;  1PFT A;  1YI2 Z;  5BUS A;  5BSU A;  4BXX I;  3VMI A;  3OTO C;  1Y1V I;  2QEX 1;  1Q82 2;  3G4S 1;  2EGT A;  4E33 A;  2WB1 A;  3GTJ I;  2VUG A;  2R7Z I;  4G1I A;  4RMN A;  2HHH C;  4IR7 A;  3J81 D;  2RIQ A;  2GU2 A;  4NFR A;  4B3R C;  3I4N I;  3MZK B;  2D1T A;  4RVN A;  1WF3 A;  2OOX B;  2QA4 Z;  1VQ9 Z;  4GXQ A;  3FCE A;  4E2W A;  1QF8 A;  4DR1 C;  4NBG A;  4X66 C;  2QVY X;  3HOW I;  2OTJ Z;  4DV6 C;  3T1H C;  1YIT Z;  1J5E C;  4RVH A;  4DV7 C;  3CW8 X;  3NYQ A;  3G6E Z;  1Q81 2;  4DV4 C;  4JI4 C;  5KYV A;  4AYB A;  2XR1 A;  2D1R A;  1ZB8 A;  1ZH1 A;  2PN2 A;  2R93 I;  1NUI A;  3S1N I;  4NXN C;  3BG0 B;  1NYE A;  5A19 A;  5AE1 A;  4BBS I;  1PA4 A;  2E9H A;  1VQM 1;  4A3E I;  1YJN Z;  3CCV Z;  3GTG I;  3UOW A;  3S2D I;  4DV5 C;  3F3F C;  3CC4 1;  3CCR Z;  5A2Q D;  1QYP A;  4MH4 A;  3S14 I;  3J81 f;  4ISB A;  3HKZ A;  3EER A;  1Q82 1;  5KYT A;  4K0B A;  3CCL Z;  1YIJ Z;  2E8C A;  2YWB A;  3NYR A;  1X0T A;  3CMA 1;  2UXD C;  3VB9 A;  4A3D I;  1T5H X;  4JM1 A;  1MXA A;  3KIH A;  1KC8 2;  2E8E A;  2E8F A;  1ML8 A;  3MON A;  3NH4 A;  3M4O I;  2F4M A;  2HU9 A;  3CC2 Z;  1JJ2 Y;  3N54 B;  1EGA A;  2WD9 A;  1HNW C;  2VQE C;  2P2F A;  4LFB C;  5IP7 I;  1Q81 1;  5E7Q A;  3CCJ 1;  2G2K A;  3PBK A;  1IBL C;  2P3Y A;  4BY1 I;  2B63 I;  3CPW Y;  2D27 A;  3FKI I;  3T4N B;  3JAM D;  2QW0 X;  3RZD I;  5T64 A;  3VNR A;  4NBB A;  1VQO 1;  3GTL I;  3CCS Z;  2OZK A;  2NVY I;  4MTN A;  2GTH A;  1UKK A;  4A3K I;  3G71 1;  4MON A;  5FLM I;  3IF8 A;  3S1Q I;  3R9W A;  1Z03 A;  1YHQ 1;  3RZO I;  4BCA A;  5JRH A;  4DV3 C;  3J81 b;  1KC8 1;  3K7A I;  2R92 I;  2YAD A;  3S2H I;  4R1M A;  4NXM C;  4NB9 A;  3NH8 A;  1PG4 A;  4D4I A;  1XNQ C;  2VQF C;  2BJO A;  4BC9 A;  1K83 I;  2DYJ A;  3ETC A;  1PG3 A;  2P2J A;  5IP9 I;  5IT9 f;  2OO4 A;  4L2Z A;  3I56 Z;  1K9M 2;  2BH1 X;  1IBM C;  3LUS A;  3GTQ I;  3GTM S;  3IEV A;  3S1M I;  2RBL A;  3EED A;  3Q87 A;  2VUM I;  1IBK C;  4RVO A;  4LFC C;  4GKK C;  4YY3 C;  3E7W A;  2V7B A;  5AE3 A;  3CCQ 1;  2VSQ A;  1VQK Z;  4PZP A;  2AYA A;  1RLY A;  2QVZ X;  3PES A;  4WS9 A;  2OTL 1;  1WH9 A;  1XMQ C;  5C4J I;  3D9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...