1XHJA

Solution structure of the staphylococcus epidermidis protein se0630. northest structural genomics consortium target ser8.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
MPTENPTMFDQVAEVIERLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEVEQVFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Nitrogen Fixation Protein NifU
publication title Solution Structure Of The Staphylococcus Epidermidis Protein SE0630. Northest Strucutral Genomics Consortium Target SeR8.
rcsb
source organism Staphylococcus epidermidis
total genus 16
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1xhjA00
1UWDA 1VEHA 3CQ1A 1WCJA 3LNOA 2JNVA 2M5HA 1TH5A 1XHJA 3UX3A 3UX2A 3CQ3A 2CU6A 2Z51A 3CQ2A 2M5OA
chains in the Genus database with same CATH superfamily
1MXBA 3DLPX 1LQLA 4DV0C 4ISBA 4JI8C 1IB8A 3PESA 3CQ2A 2PN2A 4OX9C 2M5HA 3AY0A 3I08A 4L7IA 1HR0C 2E8EA 5LMNC 4PHTA 4R1MA 5BSVA 1UWDA 4YHHC 2ZM6C 1UKKA 4DV4C 3UOWA 4PUHA 2E5LC 1FJGC 3R9WA 4PZPA 4D4IA 3E7XA 4DCTA 3A4IA 3NI2A 4DR6C 1RG9A 4LFAC 1WF3A 3PBKA 2EGTA 4ODJA 4OXIA 2DYJA 5LCIA 1HNZC 3B7WA 2JNVA 1I94C 1JOSA 3O2EA 4DV6C 4K0BA 4LFCC 4NXNC 2YX1A 4JI4C 2QVXX 5AE2A 2VQFC 2OPLB 3IEUA 1MXAA 2YCBA 2MMAB 2KDNA 3NYQA 1XHJA 4YY3C 4I9GA 3J80D 4KHPC 1XS3A 2P2MA 2E8FA 3TQIA 4RMNA 2ATWA 4RLQA 4FTFA 3LAXA 1NYEA 2Y4NA 4DR4C 5IFIA 1PG4A 1XMQC 1N34C 5K8FA 3L8CA 4BC7A 2UXDC 4DUZC 1WCJA 5KYTA 2VQEC 1M6XA 5IWAC 4LF6C 3OTOC 1QWIA 4DV5C 4JYAC 1AMUA 3TDEA 1O92A 3AF5A 1N32C 2QVZX 1FUGA 4X64C 1BA3A 1P4EA 1N2FA 4X65C 3K6RA 2DHMA 1KKGA 5T8TA 3GKUA 3VNQA 1ZB9A 2E0GA 1O90A 3G7SA 2UXCC 4DG8A 4DR3C 2D1TA 2UUAC 4PROC 1QM4A 4XX2A 3DHVA 4GXRA 4D57A 2OO4A 4RM3A 1HH2P 4GKKC 1V25A 1O93A 1MXCA 4DCVA 4X62C 1WH9A 2QVYX 2WP0C 4WV3A 4LE5A 4TPSB 2P2QA 1HNXC 1XRCA 2Z51A 4DV3C 4DR2C 1ULTA 1PU1A 1M6XC 2KZ0A 2MM9A 4JV5C 3T1YC 3NPDA 3EERA 1XNQC 5FLXD 5A2QD 5JRHA 3A25A 1IBKC 4I9FA 4DV7C 5KEIA 2D27A 4JI5C 4G37A 4ZJZA 1PA4A 3C5EA 3UX3A 5KYVA 1O9TA 4JI1C 4ZLPA 4DCSA 4LF7C 4BBYA 1N33C 4RVNA 1VEHA 3LNOA 1MKYA 2YWCA 2D1QA 1USPB 1USPA 1MD9A 4LF9C 3L95X 3DAYA 4LF8C 5A19A 1XMOC 2UUCC 5BSMA 3TR3A 4PUIA 4OYCA 4LF5C 4U5YD 2BH1X 3TUFA 1TH5A 3A26A 3RV2A 4NOZA 3AF6A 3IEVA 4DR7C 2ZZNA 4EATA 2P2BA 2QW0X 1IBMC 2Y4OA 3GPCA 2E8CA 3CW8X 3GR1A 1T5HX 3S82A 3RG2A 4B3MC 1HNWC 1K0RA 5BUQA 2M5OA 2MCQA 2P2JA 2D7VA 5BSWA 3JAMD 3N54B 1N36C 1MDBA 5A1GA 4D56A 3R9XA 2XR1A 5BURA 4JI7C 1FLOA 5DV9A 5AE1A 2D28C 3SO4A 3EQ6A 2BJOA 4IZ6A 1YJ7A 4B3RC 1IBLC 4RLFA 4DV2C 2AYAA 2PT7G 2OBVA 3NYRA 5BUSA 1V60A 1RY2A 4JM1A 3A9UA 4X66C 3FCEA 2WD9A 4WS9A 1GPMA 5BSRA 4B3TC 2NCLA 3FCCA 4GKJC 2YWBA 4AQYC 1P4EC 2ONFA 4GS5A 2UUBC 5A1IA 2F4VC 2CU6A 4NXMC 3PROC 4DV1C 2JMPA 5ADZA 1VLAA 1J5EC 5IT9D 4JI0C 5CZXA 4NDNA 5BR8C 3IPLA 4MH4A 3CQ3A 2D1SA 4RVOA 4DCUA 4BC9A 4IR7A 1XRBA 2D1RA 1LCIA 2VZEA 2HHHC 2UU9C 2CXCA 1ML8A 5CZVA 3CW9A 4FUTA 1MDFA 2VSQA 4BSZA 2P20A 1P7LA 3UZ0A 1XRAA 1V26A 3ETOA 4DR5C 1ZB8A 3CJEA 2Y27A 4R1LA 4KTVA 2OPLA 1NY8A 4DR1C 2E7GA 2ASBA 1T5DX 3I07A 4HPVA 4RM2A 5H9UA 4L4QA 3VNSA 4B3SC 2V7BA 4DUYC 5LMUC 3T1HC 4MTNA 4BCAA 4G36A 4D4GA 2PROA 5AE3A 2ZZMA 3UX2A 2UXBC 1PG3A 5T8SA 3LUSA 5BSTA 4JI2C 2P2FA 2P02A 4L2ZA 5K85A 3J81D 4FUQA 3ETCA 1L2FA 2QL8A 3VNRA 5GTDA 3UEBA 5E7QA 2HJGA 3E7WA 4DG9A 3IMLA 2DPLA 4LF4C 4G1IA 4PUGA 3R44A 2CY1A 4JI3C 3KXWA 4LFBC 3LGXA 4R0MA 3N2QA 3A9VA 1XNRC 2KZFA 3CQ1A 4JI6C 3GR0A 3H2TA 4K0KC 4KTTA 3LNVA 1EGAA 5BSUA 4GXQA
chains in the Genus database with same CATH topology
1UWDA 1VEHA 3CQ1A 1WCJA 3LNOA 2JNVA 2M5HA 1TH5A 1XHJA 3UX3A 3UX2A 3CQ3A 2CU6A 2Z51A 3CQ2A 2M5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWD A;  1VEH A;  3CQ1 A;  1WCJ A;  3LNO A;  2JNV A;  2M5H A;  1TH5 A;  1XHJ A;  3UX3 A;  3UX2 A;  3CQ3 A;  2CU6 A;  2Z51 A;  3CQ2 A;  2M5O A; 
#chains in the Genus database with same CATH topology
 1MXB A;  3DLP X;  1LQL A;  4DV0 C;  4ISB A;  4JI8 C;  1IB8 A;  3PES A;  3CQ2 A;  2PN2 A;  4OX9 C;  2M5H A;  3AY0 A;  3I08 A;  4L7I A;  1HR0 C;  2E8E A;  5LMN C;  4PHT A;  4R1M A;  5BSV A;  1UWD A;  4YHH C;  2ZM6 C;  1UKK A;  4DV4 C;  3UOW A;  4PUH A;  2E5L C;  1FJG C;  3R9W A;  4PZP A;  4D4I A;  3E7X A;  4DCT A;  3A4I A;  3NI2 A;  4DR6 C;  1RG9 A;  4LFA C;  1WF3 A;  3PBK A;  2EGT A;  4ODJ A;  4OXI A;  2DYJ A;  5LCI A;  1HNZ C;  3B7W A;  2JNV A;  1I94 C;  1JOS A;  3O2E A;  4DV6 C;  4K0B A;  4LFC C;  4NXN C;  2YX1 A;  4JI4 C;  2QVX X;  5AE2 A;  2VQF C;  2OPL B;  3IEU A;  1MXA A;  2YCB A;  2MMA B;  2KDN A;  3NYQ A;  1XHJ A;  4YY3 C;  4I9G A;  3J80 D;  4KHP C;  1XS3 A;  2P2M A;  2E8F A;  3TQI A;  4RMN A;  2ATW A;  4RLQ A;  4FTF A;  3LAX A;  1NYE A;  2Y4N A;  4DR4 C;  5IFI A;  1PG4 A;  1XMQ C;  1N34 C;  5K8F A;  3L8C A;  4BC7 A;  2UXD C;  4DUZ C;  1WCJ A;  5KYT A;  2VQE C;  1M6X A;  5IWA C;  4LF6 C;  3OTO C;  1QWI A;  4DV5 C;  4JYA C;  1AMU A;  3TDE A;  1O92 A;  3AF5 A;  1N32 C;  2QVZ X;  1FUG A;  4X64 C;  1BA3 A;  1P4E A;  1N2F A;  4X65 C;  3K6R A;  2DHM A;  1KKG A;  5T8T A;  3GKU A;  3VNQ A;  1ZB9 A;  2E0G A;  1O90 A;  3G7S A;  2UXC C;  4DG8 A;  4DR3 C;  2D1T A;  2UUA C;  4PRO C;  1QM4 A;  4XX2 A;  3DHV A;  4GXR A;  4D57 A;  2OO4 A;  4RM3 A;  1HH2 P;  4GKK C;  1V25 A;  1O93 A;  1MXC A;  4DCV A;  4X62 C;  1WH9 A;  2QVY X;  2WP0 C;  4WV3 A;  4LE5 A;  4TPS B;  2P2Q A;  1HNX C;  1XRC A;  2Z51 A;  4DV3 C;  4DR2 C;  1ULT A;  1PU1 A;  1M6X C;  2KZ0 A;  2MM9 A;  4JV5 C;  3T1Y C;  3NPD A;  3EER A;  1XNQ C;  5FLX D;  5A2Q D;  5JRH A;  3A25 A;  1IBK C;  4I9F A;  4DV7 C;  5KEI A;  2D27 A;  4JI5 C;  4G37 A;  4ZJZ A;  1PA4 A;  3C5E A;  3UX3 A;  5KYV A;  1O9T A;  4JI1 C;  4ZLP A;  4DCS A;  4LF7 C;  4BBY A;  1N33 C;  4RVN A;  1VEH A;  3LNO A;  1MKY A;  2YWC A;  2D1Q A;  1USP B;  1USP A;  1MD9 A;  4LF9 C;  3L95 X;  3DAY A;  4LF8 C;  5A19 A;  1XMO C;  2UUC C;  5BSM A;  3TR3 A;  4PUI A;  4OYC A;  4LF5 C;  4U5Y D;  2BH1 X;  3TUF A;  1TH5 A;  3A26 A;  3RV2 A;  4NOZ A;  3AF6 A;  3IEV A;  4DR7 C;  2ZZN A;  4EAT A;  2P2B A;  2QW0 X;  1IBM C;  2Y4O A;  3GPC A;  2E8C A;  3CW8 X;  3GR1 A;  1T5H X;  3S82 A;  3RG2 A;  4B3M C;  1HNW C;  1K0R A;  5BUQ A;  2M5O A;  2MCQ A;  2P2J A;  2D7V A;  5BSW A;  3JAM D;  3N54 B;  1N36 C;  1MDB A;  5A1G A;  4D56 A;  3R9X A;  2XR1 A;  5BUR A;  4JI7 C;  1FLO A;  5DV9 A;  5AE1 A;  2D28 C;  3SO4 A;  3EQ6 A;  2BJO A;  4IZ6 A;  1YJ7 A;  4B3R C;  1IBL C;  4RLF A;  4DV2 C;  2AYA A;  2PT7 G;  2OBV A;  3NYR A;  5BUS A;  1V60 A;  1RY2 A;  4JM1 A;  3A9U A;  4X66 C;  3FCE A;  2WD9 A;  4WS9 A;  1GPM A;  5BSR A;  4B3T C;  2NCL A;  3FCC A;  4GKJ C;  2YWB A;  4AQY C;  1P4E C;  2ONF A;  4GS5 A;  2UUB C;  5A1I A;  2F4V C;  2CU6 A;  4NXM C;  3PRO C;  4DV1 C;  2JMP A;  5ADZ A;  1VLA A;  1J5E C;  5IT9 D;  4JI0 C;  5CZX A;  4NDN A;  5BR8 C;  3IPL A;  4MH4 A;  3CQ3 A;  2D1S A;  4RVO A;  4DCU A;  4BC9 A;  4IR7 A;  1XRB A;  2D1R A;  1LCI A;  2VZE A;  2HHH C;  2UU9 C;  2CXC A;  1ML8 A;  5CZV A;  3CW9 A;  4FUT A;  1MDF A;  2VSQ A;  4BSZ A;  2P20 A;  1P7L A;  3UZ0 A;  1XRA A;  1V26 A;  3ETO A;  4DR5 C;  1ZB8 A;  3CJE A;  2Y27 A;  4R1L A;  4KTV A;  2OPL A;  1NY8 A;  4DR1 C;  2E7G A;  2ASB A;  1T5D X;  3I07 A;  4HPV A;  4RM2 A;  5H9U A;  4L4Q A;  3VNS A;  4B3S C;  2V7B A;  4DUY C;  5LMU C;  3T1H C;  4MTN A;  4BCA A;  4G36 A;  4D4G A;  2PRO A;  5AE3 A;  2ZZM A;  3UX2 A;  2UXB C;  1PG3 A;  5T8S A;  3LUS A;  5BST A;  4JI2 C;  2P2F A;  2P02 A;  4L2Z A;  5K85 A;  3J81 D;  4FUQ A;  3ETC A;  1L2F A;  2QL8 A;  3VNR A;  5GTD A;  3UEB A;  5E7Q A;  2HJG A;  3E7W A;  4DG9 A;  3IML A;  2DPL A;  4LF4 C;  4G1I A;  4PUG A;  3R44 A;  2CY1 A;  4JI3 C;  3KXW A;  4LFB C;  3LGX A;  4R0M A;  3N2Q A;  3A9V A;  1XNR C;  2KZF A;  3CQ1 A;  4JI6 C;  3GR0 A;  3H2T A;  4K0K C;  4KTT A;  3LNV A;  1EGA A;  5BSU A;  4GXQ A; 
#chains in the Genus database with same CATH homology
 1UWD A;  1VEH A;  3CQ1 A;  1WCJ A;  3LNO A;  2JNV A;  2M5H A;  1TH5 A;  1XHJ A;  3UX3 A;  3UX2 A;  3CQ3 A;  2CU6 A;  2Z51 A;  3CQ2 A;  2M5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...