1XHJA

Solution structure of the staphylococcus epidermidis protein se0630. northest structural genomics consortium target ser8.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
88
structure length
88
Chain Sequence
MPTENPTMFDQVAEVIERLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEVEQVFLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen Fixation Protein NifU
publication title Solution Structure Of The Staphylococcus Epidermidis Protein SE0630. Northest Strucutral Genomics Consortium Target SeR8.
rcsb
source organism Staphylococcus epidermidis
molecule tags Metal binding protein
total genus 16
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1xhjA00
1TH5A 3LNOA 2M5HA 1WCJA 1VEHA 3UX3A 3UX2A 1XHJA 3CQ1A 2Z51A 2JNVA 2CU6A 3CQ3A 2M5OA 1UWDA 3CQ2A
chains in the Genus database with same CATH superfamily
1MKYA 1HNWC 3VNQA 3OTOC 3A9VA 1MDFA 2MCQA 4LF8C 3CW9A 4RLFA 2Z51A 3N54B 4R1MA 5BSVA 3DHVA 4DG8A 1HNXC 4PUHA 1VLAA 4LF5C 5K8FA 1MDBA 2VQEC 3DAYA 5FLXD 3KXWA 3A9UA 1LCIA 3EERA 1T5DX 2Y4OA 1FJGC 1WCJA 1XS3A 2VSQA 3UEBA 3PESA 4X66C 4OXIA 3DLPX 4PUGA 4JI2C 2P02A 4DR3C 4HPVA 4DV2C 2PROA 1IBLC 4OX9C 1O92A 4LFBC 1N34C 2ONFA 1XMQC 4K0KC 1MXBA 1AMUA 2P2QA 2PT7G 2KZFA 5IWAC 5BSMA 1NYEA 5T8TA 4BC7A 3GR0A 2OBVA 3NYQA 4RMNA 5BUSA 3E7XA 2JNVA 3NI2A 4D4GA 3AF5A 2BJOA 2UXCC 3CQ2A 2E8CA 2MM9A 2V7BA 1N32C 5A19A 1EGAA 5AE2A 3I08A 4X65C 2CXCA 4GKJC 4PUIA 4U5YD 1XRAA 4D57A 3T1YC 1RY2A 3VNSA 5A1IA 3TDEA 1K0RA 1HNZC 4LF6C 3CQ3A 3PBKA 4G1IA 3I07A 4KTVA 4RLQA 2UXBC 5CZVA 2NCLA 4JI4C 4DCTA 2CU6A 1TH5A 5LMUC 4B3SC 1PA4A 4JYAC 3R9XA 4RVNA 5KYTA 4BSZA 4MH4A 4DV6C 1BA3A 5BR8C 1T5HX 1RG9A 3PROC 4DV7C 5BSUA 2HJGA 4FTFA 5LMNC 1FUGA 4FUTA 4DV5C 5KYVA 2UXDC 5AE1A 3J80D 2Y27A 4BC9A 3NYRA 4LE5A 3C5EA 4LFCC 1XRBA 3LAXA 5BURA 1IB8A 1FLOA 1IBMC 3RV2A 2QVYX 3UX3A 2D27A 2UUCC 2EGTA 4RM3A 3IEVA 4JV5C 2E5LC 4LF7C 1USPA 2D1TA 3AY0A 1V60A 2P20A 1VEHA 1MXCA 3AF6A 4MTNA 3EQ6A 3UX2A 2WD9A 3JAMD 2PN2A 1XNRC 2M5HA 2VQFC 4WS9A 3R9WA 3G7SA 2KDNA 4X64C 3UZ0A 2OPLA 1N36C 4IZ6A 1HH2P 4D4IA 3N2QA 1UWDA 4L2ZA 5BSWA 5JRHA 1XMOC 1XNQC 4JM1A 2ZZMA 4DV4C 4GS5A 4JI8C 4G37A 2P2BA 4BCAA 2ZM6C 4BBYA 4DR6C 4XX2A 4FUQA 5LCIA 3FCCA 4DUYC 4I9FA 3A4IA 1N33C 2ATWA 1MXAA 2DHMA 4JI6C 1UKKA 5BUQA 4B3RC 4DR5C 2OO4A 2ASBA 3RG2A 5CZXA 2E8EA 4ZJZA 1KKGA 4EATA 2F4VC 2BH1X 1QWIA 4DR7C 2YX1A 1MD9A 5IFIA 4D56A 3ETCA 4NDNA 3CJEA 2QL8A 3S82A 4YHHC 4DR4C 3A26A 2QVZX 4B3TC 1IBKC 2UUAC 1O90A 1O9TA 2AYAA 4DCUA 2QVXX 2ZZNA 1PU1A 4NOZA 1V25A 4GKKC 1WH9A 4L4QA 5H9UA 2DYJA 2D7VA 4DG9A 5E7QA 1NY8A 2QW0X 4RVOA 2D1SA 3GKUA 4JI7C 3TR3A 5AE3A 4NXNC 5T8SA 3UOWA 5KEIA 2KZ0A 2YWCA 2MMAB 3LUSA 1P4EA 1YJ7A 1P7LA 1LQLA 4GXQA 3H2TA 4OYCA 5BSTA 5GTDA 3GPCA 2E7GA 3VNRA 3B7WA 2UU9C 2VZEA 2D28C 4JI3C 4JI0C 1N2FA 4DR2C 2D1QA 5K85A 3T1HC 3TQIA 3LNOA 3LNVA 2WP0C 4LF9C 4ZLPA 5A1GA 5A2QD 1XRCA 3CW8X 4LF4C 3O2EA 2E0GA 1XHJA 4I9GA 3L95X 3IMLA 5DV9A 3A25A 4K0BA 4PHTA 2YCBA 2Y4NA 2M5OA 4NXMC 2CY1A 4KTTA 4L7IA 4WV3A 1L2FA 5IT9D 1JOSA 1QM4A 3CQ1A 1ZB9A 4ODJA 3IPLA 2P2MA 1J5EC 3GR1A 1WF3A 4PROC 1ULTA 1O93A 4PZPA 3L8CA 2P2FA 3LGXA 1HR0C 1PG3A 4R0MA 4AQYC 5BSRA 4LFAC 1ZB8A 3K6RA 3TUFA 2HHHC 4DCSA 3IEUA 2D1RA 3NPDA 2XR1A 1USPB 4G36A 5ADZA 2UUBC 4TPSB 4X62C 4JI5C 4DV3C 4KHPC 4DR1C 2JMPA 4IR7A 4DV0C 2YWBA 3ETOA 4DCVA 1M6XC 2DPLA 3R44A 1PG4A 1V26A 3E7WA 2P2JA 1ML8A 4JI1C 4R1LA 3J81D 2OPLB 4DV1C 4YY3C 1GPMA 4DUZC 1P4EC 2E8FA 4ISBA 3SO4A 1I94C 4B3MC 1M6XA 3FCEA 4GXRA 4RM2A
chains in the Genus database with same CATH topology
1TH5A 3LNOA 2M5HA 1WCJA 1VEHA 3UX3A 3UX2A 1XHJA 3CQ1A 2Z51A 2JNVA 2CU6A 3CQ3A 2M5OA 1UWDA 3CQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TH5 A;  3LNO A;  2M5H A;  1WCJ A;  1VEH A;  3UX3 A;  3UX2 A;  1XHJ A;  3CQ1 A;  2Z51 A;  2JNV A;  2CU6 A;  3CQ3 A;  2M5O A;  1UWD A;  3CQ2 A; 
#chains in the Genus database with same CATH topology
 1MKY A;  1HNW C;  3VNQ A;  3OTO C;  3A9V A;  1MDF A;  2MCQ A;  4LF8 C;  3CW9 A;  4RLF A;  2Z51 A;  3N54 B;  4R1M A;  5BSV A;  3DHV A;  4DG8 A;  1HNX C;  4PUH A;  1VLA A;  4LF5 C;  5K8F A;  1MDB A;  2VQE C;  3DAY A;  5FLX D;  3KXW A;  3A9U A;  1LCI A;  3EER A;  1T5D X;  2Y4O A;  1FJG C;  1WCJ A;  1XS3 A;  2VSQ A;  3UEB A;  3PES A;  4X66 C;  4OXI A;  3DLP X;  4PUG A;  4JI2 C;  2P02 A;  4DR3 C;  4HPV A;  4DV2 C;  2PRO A;  1IBL C;  4OX9 C;  1O92 A;  4LFB C;  1N34 C;  2ONF A;  1XMQ C;  4K0K C;  1MXB A;  1AMU A;  2P2Q A;  2PT7 G;  2KZF A;  5IWA C;  5BSM A;  1NYE A;  5T8T A;  4BC7 A;  3GR0 A;  2OBV A;  3NYQ A;  4RMN A;  5BUS A;  3E7X A;  2JNV A;  3NI2 A;  4D4G A;  3AF5 A;  2BJO A;  2UXC C;  3CQ2 A;  2E8C A;  2MM9 A;  2V7B A;  1N32 C;  5A19 A;  1EGA A;  5AE2 A;  3I08 A;  4X65 C;  2CXC A;  4GKJ C;  4PUI A;  4U5Y D;  1XRA A;  4D57 A;  3T1Y C;  1RY2 A;  3VNS A;  5A1I A;  3TDE A;  1K0R A;  1HNZ C;  4LF6 C;  3CQ3 A;  3PBK A;  4G1I A;  3I07 A;  4KTV A;  4RLQ A;  2UXB C;  5CZV A;  2NCL A;  4JI4 C;  4DCT A;  2CU6 A;  1TH5 A;  5LMU C;  4B3S C;  1PA4 A;  4JYA C;  3R9X A;  4RVN A;  5KYT A;  4BSZ A;  4MH4 A;  4DV6 C;  1BA3 A;  5BR8 C;  1T5H X;  1RG9 A;  3PRO C;  4DV7 C;  5BSU A;  2HJG A;  4FTF A;  5LMN C;  1FUG A;  4FUT A;  4DV5 C;  5KYV A;  2UXD C;  5AE1 A;  3J80 D;  2Y27 A;  4BC9 A;  3NYR A;  4LE5 A;  3C5E A;  4LFC C;  1XRB A;  3LAX A;  5BUR A;  1IB8 A;  1FLO A;  1IBM C;  3RV2 A;  2QVY X;  3UX3 A;  2D27 A;  2UUC C;  2EGT A;  4RM3 A;  3IEV A;  4JV5 C;  2E5L C;  4LF7 C;  1USP A;  2D1T A;  3AY0 A;  1V60 A;  2P20 A;  1VEH A;  1MXC A;  3AF6 A;  4MTN A;  3EQ6 A;  3UX2 A;  2WD9 A;  3JAM D;  2PN2 A;  1XNR C;  2M5H A;  2VQF C;  4WS9 A;  3R9W A;  3G7S A;  2KDN A;  4X64 C;  3UZ0 A;  2OPL A;  1N36 C;  4IZ6 A;  1HH2 P;  4D4I A;  3N2Q A;  1UWD A;  4L2Z A;  5BSW A;  5JRH A;  1XMO C;  1XNQ C;  4JM1 A;  2ZZM A;  4DV4 C;  4GS5 A;  4JI8 C;  4G37 A;  2P2B A;  4BCA A;  2ZM6 C;  4BBY A;  4DR6 C;  4XX2 A;  4FUQ A;  5LCI A;  3FCC A;  4DUY C;  4I9F A;  3A4I A;  1N33 C;  2ATW A;  1MXA A;  2DHM A;  4JI6 C;  1UKK A;  5BUQ A;  4B3R C;  4DR5 C;  2OO4 A;  2ASB A;  3RG2 A;  5CZX A;  2E8E A;  4ZJZ A;  1KKG A;  4EAT A;  2F4V C;  2BH1 X;  1QWI A;  4DR7 C;  2YX1 A;  1MD9 A;  5IFI A;  4D56 A;  3ETC A;  4NDN A;  3CJE A;  2QL8 A;  3S82 A;  4YHH C;  4DR4 C;  3A26 A;  2QVZ X;  4B3T C;  1IBK C;  2UUA C;  1O90 A;  1O9T A;  2AYA A;  4DCU A;  2QVX X;  2ZZN A;  1PU1 A;  4NOZ A;  1V25 A;  4GKK C;  1WH9 A;  4L4Q A;  5H9U A;  2DYJ A;  2D7V A;  4DG9 A;  5E7Q A;  1NY8 A;  2QW0 X;  4RVO A;  2D1S A;  3GKU A;  4JI7 C;  3TR3 A;  5AE3 A;  4NXN C;  5T8S A;  3UOW A;  5KEI A;  2KZ0 A;  2YWC A;  2MMA B;  3LUS A;  1P4E A;  1YJ7 A;  1P7L A;  1LQL A;  4GXQ A;  3H2T A;  4OYC A;  5BST A;  5GTD A;  3GPC A;  2E7G A;  3VNR A;  3B7W A;  2UU9 C;  2VZE A;  2D28 C;  4JI3 C;  4JI0 C;  1N2F A;  4DR2 C;  2D1Q A;  5K85 A;  3T1H C;  3TQI A;  3LNO A;  3LNV A;  2WP0 C;  4LF9 C;  4ZLP A;  5A1G A;  5A2Q D;  1XRC A;  3CW8 X;  4LF4 C;  3O2E A;  2E0G A;  1XHJ A;  4I9G A;  3L95 X;  3IML A;  5DV9 A;  3A25 A;  4K0B A;  4PHT A;  2YCB A;  2Y4N A;  2M5O A;  4NXM C;  2CY1 A;  4KTT A;  4L7I A;  4WV3 A;  1L2F A;  5IT9 D;  1JOS A;  1QM4 A;  3CQ1 A;  1ZB9 A;  4ODJ A;  3IPL A;  2P2M A;  1J5E C;  3GR1 A;  1WF3 A;  4PRO C;  1ULT A;  1O93 A;  4PZP A;  3L8C A;  2P2F A;  3LGX A;  1HR0 C;  1PG3 A;  4R0M A;  4AQY C;  5BSR A;  4LFA C;  1ZB8 A;  3K6R A;  3TUF A;  2HHH C;  4DCS A;  3IEU A;  2D1R A;  3NPD A;  2XR1 A;  1USP B;  4G36 A;  5ADZ A;  2UUB C;  4TPS B;  4X62 C;  4JI5 C;  4DV3 C;  4KHP C;  4DR1 C;  2JMP A;  4IR7 A;  4DV0 C;  2YWB A;  3ETO A;  4DCV A;  1M6X C;  2DPL A;  3R44 A;  1PG4 A;  1V26 A;  3E7W A;  2P2J A;  1ML8 A;  4JI1 C;  4R1L A;  3J81 D;  2OPL B;  4DV1 C;  4YY3 C;  1GPM A;  4DUZ C;  1P4E C;  2E8F A;  4ISB A;  3SO4 A;  1I94 C;  4B3M C;  1M6X A;  3FCE A;  4GXR A;  4RM2 A; 
#chains in the Genus database with same CATH homology
 1TH5 A;  3LNO A;  2M5H A;  1WCJ A;  1VEH A;  3UX3 A;  3UX2 A;  1XHJ A;  3CQ1 A;  2Z51 A;  2JNV A;  2CU6 A;  3CQ3 A;  2M5O A;  1UWD A;  3CQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...