5T8SA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
388
structure length
388
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
total genus 137
structure length 388
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA03
4WS9A 4NDNA 1MXAA 3A4IA 4HPVA 1O92A 3TQIA 5T8SA 5A1IA 2YWBA 2DPLA 1QM4A 3SO4A 4KTVA 4L7IA 1GPMA 3S82A 2OBVA 4LE5A 1MXBA 5T8TA 5H9UA 1O9TA 1MXCA 2YWCA 4K0BA 1P7LA 1O93A 5A19A 1FUGA 5A1GA 4KTTA 1XRBA 1RG9A 3RV2A 2P02A 3UOWA 3IMLA 4ODJA 4L2ZA 3TDEA 1XRCA 1O90A 4L4QA 1XRAA
chains in the Genus database with same CATH superfamily
5KYVA 4XX2A 5CZVA 4LF7C 4FTFA 3I08A 2XR1A 4DUYC 1MKYA 5BSUA 2Z51A 2P20A 4DV0C 2JMPA 4OXIA 4B3MC 2WP0C 2ZZMA 4L2ZA 4DR5C 2YCBA 1TH5A 2M5OA 3B7WA 3J81D 3NI2A 4GXRA 3GPCA 4EATA 4AQYC 3S82A 4R1MA 4DV2C 4DV7C 2UUBC 3LUSA 3R44A 2QVZX 2BJOA 1O93A 1XMQC 1T5DX 3H2TA 3UZ0A 2OPLB 4LF5C 4HPVA 3PBKA 1XHJA 2ASBA 1AMUA 1M6XA 2QW0X 2PROA 2EGTA 2YWCA 4RMNA 4DV1C 3IPLA 4JYAC 3DAYA 2Y27A 3DHVA 1WCJA 1LQLA 5A1GA 4KHPC 3RV2A 2P02A 1PA4A 1MDBA 4X65C 2QL8A 1ZB9A 1MXAA 4G37A 4D56A 2DYJA 1NY8A 1LCIA 4MH4A 3SO4A 2YWBA 3E7WA 1YJ7A 1GPMA 3A9VA 3A25A 4BCAA 1PG4A 3GKUA 3L95X 4JI7C 5KYTA 3VNSA 2DHMA 4NDNA 3JAMD 1IBMC 5JRHA 2VQEC 4LFAC 2P2FA 3K6RA 4DUZC 3A9UA 5ADZA 4DR6C 4FUTA 5BSVA 3FCCA 1XNQC 5BSTA 2HHHC 4K0BA 4JI4C 4D4GA 3RG2A 2P2BA 4DR4C 3UEBA 2VQFC 3CW9A 1PG3A 4ODJA 3TDEA 1XRAA 1V25A 4DV4C 4X62C 3EQ6A 2UXBC 2D1QA 3AY0A 3G7SA 1J5EC 4LFCC 4OX9C 3CQ2A 4JI0C 4I9FA 4JM1A 1V26A 1WH9A 1RG9A 2AYAA 3J80D 3LGXA 2KZFA 3LNOA 4WS9A 4DR2C 3VNRA 1XS3A 3CJEA 2UUAC 4YHHC 5IWAC 4G36A 3UX2A 1ML8A 4JV5C 1MXCA 4BSZA 2P2JA 4JI8C 2P2QA 4GS5A 3DLPX 4G1IA 4PZPA 5IT9D 1FJGC 1UWDA 4DR7C 4PUGA 1USPB 4BC9A 1EGAA 4LF6C 3E7XA 2BH1X 1WF3A 4PROC 4D4IA 1N36C 5BUQA 4RM2A 4DR3C 2Y4NA 1JOSA 3C5EA 4BBYA 4TPSB 2UXDC 1T5HX 4RLQA 3T1YC 3UOWA 3IMLA 4ZLPA 4MTNA 1XNRC 5BSRA 2D7VA 2V7BA 5BUSA 5FLXD 4RVOA 4B3SC 3LNVA 1QM4A 3LAXA 2D1RA 1P4EC 3R9XA 2KDNA 4B3RC 4B3TC 4X64C 4GKKC 2OPLA 5AE3A 5BSWA 2MMAB 4R0MA 4FUQA 2HJGA 1K0RA 2NCLA 4PUIA 2E8EA 4RVNA 3O2EA 1HR0C 5K85A 2DPLA 4LFBC 1ULTA 4DG8A 3ETOA 4DCVA 4DV3C 4LE5A 3A26A 4DR1C 2E8FA 2ONFA 1V60A 2CY1A 1QWIA 5E7QA 4IR7A 3GR1A 4DV5C 1VEHA 4L4QA 1O90A 5K8FA 3TQIA 4IZ6A 3AF5A 1HNXC 2E7GA 1PU1A 3PESA 1L2FA 4DCUA 2UXCC 1MXBA 2MCQA 3TR3A 1O9TA 1IBLC 3EERA 1HNZC 4KTTA 1XRBA 2M5HA 3UX3A 3NYRA 3IEUA 1IBKC 2Y4OA 3A4IA 3FCEA 1O92A 3AF6A 2VZEA 1VLAA 4L7IA 5BR8C 2ZZNA 1I94C 4I9GA 4ZJZA 5BURA 5CZXA 2E8CA 1RY2A 2MM9A 3I07A 4DG9A 2CXCA 2D28C 5DV9A 5IFIA 1UKKA 4U5YD 3N54B 4RM3A 5GTDA 5A1IA 2YX1A 5KEIA 1MDFA 1N34C 3IEVA 4DCTA 3CQ3A 4LF8C 1N2FA 3CW8X 1ZB8A 2WD9A 5LMUC 4WV3A 4D57A 4DCSA 3R9WA 3PROC 3NYQA 2CU6A 5T8SA 4NOZA 4LF4C 3ETCA 2QVXX 1KKGA 2OBVA 2UUCC 1NYEA 2E0GA 1USPA 4DV6C 4K0KC 4NXNC 2UU9C 1P7LA 4X66C 2ATWA 5A19A 5LMNC 1FUGA 3T1HC 2OO4A 3VNQA 4OYCA 4NXMC 1N32C 2KZ0A 5LCIA 3TUFA 4JI5C 4JI1C 3CQ1A 1FLOA 4GXQA 4ISBA 2JNVA 3KXWA 2P2MA 5T8TA 4PHTA 4R1LA 5H9UA 2D1TA 3NPDA 1HNWC 3GR0A 1BA3A 4JI3C 1N33C 4JI6C 2VSQA 4BC7A 4GKJC 1XRCA 2PT7G 3N2QA 4JI2C 2PN2A 2F4VC 2ZM6C 3L8CA 5AE2A 2QVYX 4KTVA 4PUHA 4RLFA 2E5LC 2D1SA 3OTOC 1XMOC 1P4EA 2D27A 1IB8A 1MD9A 1M6XC 5BSMA 1HH2P 5AE1A 4LF9C 5A2QD 4YY3C
chains in the Genus database with same CATH topology
5KYVA 4XX2A 5CZVA 4LF7C 4FTFA 3I08A 2XR1A 4DUYC 1MKYA 5BSUA 2P20A 4DV0C 2JMPA 4OXIA 4B3MC 2WP0C 4L2ZA 4DR5C 2YCBA 3B7WA 3J81D 3NI2A 4GXRA 3GPCA 4EATA 4AQYC 3S82A 4R1MA 4DV2C 4DV7C 2UUBC 3LUSA 3R44A 2QVZX 2BJOA 1O93A 1XMQC 1T5DX 3H2TA 3UZ0A 2OPLB 4LF5C 4HPVA 3PBKA 2ASBA 1AMUA 2QW0X 2PROA 2EGTA 2YWCA 4RMNA 4DV1C 3IPLA 4JYAC 3DAYA 2Y27A 3DHVA 1LQLA 5A1GA 4KHPC 3RV2A 2P02A 1PA4A 1MDBA 4X65C 2QL8A 1ZB9A 1MXAA 4G37A 4D56A 2DYJA 1LCIA 4MH4A 3SO4A 2YWBA 3E7WA 1YJ7A 1GPMA 3A9VA 4BCAA 1PG4A 3GKUA 3L95X 4JI7C 5KYTA 3VNSA 4NDNA 3JAMD 1IBMC 5JRHA 2VQEC 4LFAC 2P2FA 4DUZC 3A9UA 5ADZA 4DR6C 4FUTA 5BSVA 3FCCA 1XNQC 5BSTA 2HHHC 4K0BA 4JI4C 4D4GA 3RG2A 2P2BA 4DR4C 2VQFC 3CW9A 1PG3A 4ODJA 3TDEA 1XRAA 1V25A 4DV4C 4X62C 3EQ6A 2UXBC 2D1QA 3G7SA 1J5EC 4LFCC 4OX9C 4JI0C 4I9FA 4JM1A 1V26A 1WH9A 1RG9A 2AYAA 3J80D 3LGXA 2KZFA 4WS9A 4DR2C 3VNRA 3CJEA 2UUAC 4YHHC 5IWAC 4G36A 4JV5C 1ML8A 1MXCA 4BSZA 2P2JA 4JI8C 2P2QA 4GS5A 3DLPX 4G1IA 4PZPA 5IT9D 1FJGC 4DR7C 1USPB 4BC9A 1EGAA 4LF6C 3E7XA 2BH1X 1WF3A 4PROC 4D4IA 1N36C 5BUQA 4RM2A 4DR3C 2Y4NA 1JOSA 3C5EA 4TPSB 4BBYA 2UXDC 1T5HX 4RLQA 3T1YC 3UOWA 3IMLA 4ZLPA 4MTNA 1XNRC 5BSRA 2V7BA 2D7VA 5BUSA 5FLXD 4RVOA 4B3SC 3LNVA 1QM4A 3LAXA 2D1RA 3R9XA 4B3RC 4B3TC 4X64C 4GKKC 2OPLA 5AE3A 5BSWA 4R0MA 4FUQA 2HJGA 1K0RA 2E8EA 4RVNA 1HR0C 5K85A 2DPLA 4LFBC 1ULTA 4DG8A 3ETOA 4DCVA 4DV3C 4LE5A 4DR1C 2E8FA 2ONFA 2CY1A 1QWIA 5E7QA 4IR7A 3GR1A 4DV5C 4L4QA 1O90A 5K8FA 3TQIA 4IZ6A 3AF5A 1HNXC 2E7GA 4DCUA 3PESA 1L2FA 2UXCC 1MXBA 1O9TA 1IBLC 3EERA 1HNZC 4KTTA 1XRBA 3NYRA 3IEUA 1IBKC 2Y4OA 3A4IA 3FCEA 1O92A 3AF6A 2VZEA 1VLAA 4L7IA 5BR8C 1I94C 4I9GA 4ZJZA 5BURA 5CZXA 2E8CA 1RY2A 3I07A 4DG9A 2CXCA 2D28C 5DV9A 5IFIA 1UKKA 4U5YD 3N54B 4RM3A 5GTDA 5A1IA 5KEIA 1MDFA 1N34C 3IEVA 4DCTA 4LF8C 1N2FA 3CW8X 1ZB8A 2WD9A 5LMUC 4WV3A 4D57A 4DCSA 3R9WA 3PROC 3NYQA 5T8SA 4NOZA 4LF4C 3ETCA 2QVXX 1KKGA 2OBVA 2UUCC 1NYEA 2E0GA 1USPA 4DV6C 4K0KC 4NXNC 2UU9C 1P7LA 4X66C 2ATWA 5A19A 5LMNC 1FUGA 3T1HC 2OO4A 3VNQA 4OYCA 4NXMC 1N32C 3TUFA 4JI5C 4JI1C 4GXQA 4ISBA 3KXWA 2P2MA 5T8TA 4PHTA 4R1LA 5H9UA 2D1TA 3NPDA 1HNWC 3GR0A 1BA3A 4JI3C 1N33C 4JI6C 2VSQA 4BC7A 4GKJC 1XRCA 2PT7G 3N2QA 4JI2C 2PN2A 2F4VC 2ZM6C 3L8CA 5AE2A 2QVYX 4KTVA 4RLFA 2E5LC 2D1SA 3OTOC 1XMOC 2D27A 1MD9A 5BSMA 1HH2P 5AE1A 4LF9C 5A2QD 4YY3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WS9 A;  4NDN A;  1MXA A;  3A4I A;  4HPV A;  1O92 A;  3TQI A;  5T8S A;  5A1I A;  2YWB A;  2DPL A;  1QM4 A;  3SO4 A;  4KTV A;  4L7I A;  1GPM A;  3S82 A;  2OBV A;  4LE5 A;  1MXB A;  5T8T A;  5H9U A;  1O9T A;  1MXC A;  2YWC A;  4K0B A;  1P7L A;  1O93 A;  5A19 A;  1FUG A;  5A1G A;  4KTT A;  1XRB A;  1RG9 A;  3RV2 A;  2P02 A;  3UOW A;  3IML A;  4ODJ A;  4L2Z A;  3TDE A;  1XRC A;  1O90 A;  4L4Q A;  1XRA A; 
#chains in the Genus database with same CATH topology
 5KYV A;  4XX2 A;  5CZV A;  4LF7 C;  4FTF A;  3I08 A;  2XR1 A;  4DUY C;  1MKY A;  5BSU A;  2Z51 A;  2P20 A;  4DV0 C;  2JMP A;  4OXI A;  4B3M C;  2WP0 C;  2ZZM A;  4L2Z A;  4DR5 C;  2YCB A;  1TH5 A;  2M5O A;  3B7W A;  3J81 D;  3NI2 A;  4GXR A;  3GPC A;  4EAT A;  4AQY C;  3S82 A;  4R1M A;  4DV2 C;  4DV7 C;  2UUB C;  3LUS A;  3R44 A;  2QVZ X;  2BJO A;  1O93 A;  1XMQ C;  1T5D X;  3H2T A;  3UZ0 A;  2OPL B;  4LF5 C;  4HPV A;  3PBK A;  1XHJ A;  2ASB A;  1AMU A;  1M6X A;  2QW0 X;  2PRO A;  2EGT A;  2YWC A;  4RMN A;  4DV1 C;  3IPL A;  4JYA C;  3DAY A;  2Y27 A;  3DHV A;  1WCJ A;  1LQL A;  5A1G A;  4KHP C;  3RV2 A;  2P02 A;  1PA4 A;  1MDB A;  4X65 C;  2QL8 A;  1ZB9 A;  1MXA A;  4G37 A;  4D56 A;  2DYJ A;  1NY8 A;  1LCI A;  4MH4 A;  3SO4 A;  2YWB A;  3E7W A;  1YJ7 A;  1GPM A;  3A9V A;  3A25 A;  4BCA A;  1PG4 A;  3GKU A;  3L95 X;  4JI7 C;  5KYT A;  3VNS A;  2DHM A;  4NDN A;  3JAM D;  1IBM C;  5JRH A;  2VQE C;  4LFA C;  2P2F A;  3K6R A;  4DUZ C;  3A9U A;  5ADZ A;  4DR6 C;  4FUT A;  5BSV A;  3FCC A;  1XNQ C;  5BST A;  2HHH C;  4K0B A;  4JI4 C;  4D4G A;  3RG2 A;  2P2B A;  4DR4 C;  3UEB A;  2VQF C;  3CW9 A;  1PG3 A;  4ODJ A;  3TDE A;  1XRA A;  1V25 A;  4DV4 C;  4X62 C;  3EQ6 A;  2UXB C;  2D1Q A;  3AY0 A;  3G7S A;  1J5E C;  4LFC C;  4OX9 C;  3CQ2 A;  4JI0 C;  4I9F A;  4JM1 A;  1V26 A;  1WH9 A;  1RG9 A;  2AYA A;  3J80 D;  3LGX A;  2KZF A;  3LNO A;  4WS9 A;  4DR2 C;  3VNR A;  1XS3 A;  3CJE A;  2UUA C;  4YHH C;  5IWA C;  4G36 A;  3UX2 A;  1ML8 A;  4JV5 C;  1MXC A;  4BSZ A;  2P2J A;  4JI8 C;  2P2Q A;  4GS5 A;  3DLP X;  4G1I A;  4PZP A;  5IT9 D;  1FJG C;  1UWD A;  4DR7 C;  4PUG A;  1USP B;  4BC9 A;  1EGA A;  4LF6 C;  3E7X A;  2BH1 X;  1WF3 A;  4PRO C;  4D4I A;  1N36 C;  5BUQ A;  4RM2 A;  4DR3 C;  2Y4N A;  1JOS A;  3C5E A;  4BBY A;  4TPS B;  2UXD C;  1T5H X;  4RLQ A;  3T1Y C;  3UOW A;  3IML A;  4ZLP A;  4MTN A;  1XNR C;  5BSR A;  2D7V A;  2V7B A;  5BUS A;  5FLX D;  4RVO A;  4B3S C;  3LNV A;  1QM4 A;  3LAX A;  2D1R A;  1P4E C;  3R9X A;  2KDN A;  4B3R C;  4B3T C;  4X64 C;  4GKK C;  2OPL A;  5AE3 A;  5BSW A;  2MMA B;  4R0M A;  4FUQ A;  2HJG A;  1K0R A;  2NCL A;  4PUI A;  2E8E A;  4RVN A;  3O2E A;  1HR0 C;  5K85 A;  2DPL A;  4LFB C;  1ULT A;  4DG8 A;  3ETO A;  4DCV A;  4DV3 C;  4LE5 A;  3A26 A;  4DR1 C;  2E8F A;  2ONF A;  1V60 A;  2CY1 A;  1QWI A;  5E7Q A;  4IR7 A;  3GR1 A;  4DV5 C;  1VEH A;  4L4Q A;  1O90 A;  5K8F A;  3TQI A;  4IZ6 A;  3AF5 A;  1HNX C;  2E7G A;  1PU1 A;  3PES A;  1L2F A;  4DCU A;  2UXC C;  1MXB A;  2MCQ A;  3TR3 A;  1O9T A;  1IBL C;  3EER A;  1HNZ C;  4KTT A;  1XRB A;  2M5H A;  3UX3 A;  3NYR A;  3IEU A;  1IBK C;  2Y4O A;  3A4I A;  3FCE A;  1O92 A;  3AF6 A;  2VZE A;  1VLA A;  4L7I A;  5BR8 C;  2ZZN A;  1I94 C;  4I9G A;  4ZJZ A;  5BUR A;  5CZX A;  2E8C A;  1RY2 A;  2MM9 A;  3I07 A;  4DG9 A;  2CXC A;  2D28 C;  5DV9 A;  5IFI A;  1UKK A;  4U5Y D;  3N54 B;  4RM3 A;  5GTD A;  5A1I A;  2YX1 A;  5KEI A;  1MDF A;  1N34 C;  3IEV A;  4DCT A;  3CQ3 A;  4LF8 C;  1N2F A;  3CW8 X;  1ZB8 A;  2WD9 A;  5LMU C;  4WV3 A;  4D57 A;  4DCS A;  3R9W A;  3PRO C;  3NYQ A;  2CU6 A;  5T8S A;  4NOZ A;  4LF4 C;  3ETC A;  2QVX X;  1KKG A;  2OBV A;  2UUC C;  1NYE A;  2E0G A;  1USP A;  4DV6 C;  4K0K C;  4NXN C;  2UU9 C;  1P7L A;  4X66 C;  2ATW A;  5A19 A;  5LMN C;  1FUG A;  3T1H C;  2OO4 A;  3VNQ A;  4OYC A;  4NXM C;  1N32 C;  2KZ0 A;  5LCI A;  3TUF A;  4JI5 C;  4JI1 C;  3CQ1 A;  1FLO A;  4GXQ A;  4ISB A;  2JNV A;  3KXW A;  2P2M A;  5T8T A;  4PHT A;  4R1L A;  5H9U A;  2D1T A;  3NPD A;  1HNW C;  3GR0 A;  1BA3 A;  4JI3 C;  1N33 C;  4JI6 C;  2VSQ A;  4BC7 A;  4GKJ C;  1XRC A;  2PT7 G;  3N2Q A;  4JI2 C;  2PN2 A;  2F4V C;  2ZM6 C;  3L8C A;  5AE2 A;  2QVY X;  4KTV A;  4PUH A;  4RLF A;  2E5L C;  2D1S A;  3OTO C;  1XMO C;  1P4E A;  2D27 A;  1IB8 A;  1MD9 A;  1M6X C;  5BSM A;  1HH2 P;  5AE1 A;  4LF9 C;  5A2Q D;  4YY3 C; 
#chains in the Genus database with same CATH homology
 5KYV A;  4XX2 A;  5CZV A;  4LF7 C;  4FTF A;  3I08 A;  2XR1 A;  4DUY C;  1MKY A;  5BSU A;  2P20 A;  4DV0 C;  2JMP A;  4OXI A;  4B3M C;  2WP0 C;  4L2Z A;  4DR5 C;  2YCB A;  3B7W A;  3J81 D;  3NI2 A;  4GXR A;  3GPC A;  4EAT A;  4AQY C;  3S82 A;  4R1M A;  4DV2 C;  4DV7 C;  2UUB C;  3LUS A;  3R44 A;  2QVZ X;  2BJO A;  1O93 A;  1XMQ C;  1T5D X;  3H2T A;  3UZ0 A;  2OPL B;  4LF5 C;  4HPV A;  3PBK A;  2ASB A;  1AMU A;  2QW0 X;  2PRO A;  2EGT A;  2YWC A;  4RMN A;  4DV1 C;  3IPL A;  4JYA C;  3DAY A;  2Y27 A;  3DHV A;  1LQL A;  5A1G A;  4KHP C;  3RV2 A;  2P02 A;  1PA4 A;  1MDB A;  4X65 C;  2QL8 A;  1ZB9 A;  1MXA A;  4G37 A;  4D56 A;  2DYJ A;  1LCI A;  4MH4 A;  3SO4 A;  2YWB A;  3E7W A;  1YJ7 A;  1GPM A;  3A9V A;  4BCA A;  1PG4 A;  3GKU A;  3L95 X;  4JI7 C;  5KYT A;  3VNS A;  4NDN A;  3JAM D;  1IBM C;  5JRH A;  2VQE C;  4LFA C;  2P2F A;  4DUZ C;  3A9U A;  5ADZ A;  4DR6 C;  4FUT A;  5BSV A;  3FCC A;  1XNQ C;  5BST A;  2HHH C;  4K0B A;  4JI4 C;  4D4G A;  3RG2 A;  2P2B A;  4DR4 C;  2VQF C;  3CW9 A;  1PG3 A;  4ODJ A;  3TDE A;  1XRA A;  1V25 A;  4DV4 C;  4X62 C;  3EQ6 A;  2UXB C;  2D1Q A;  3G7S A;  1J5E C;  4LFC C;  4OX9 C;  4JI0 C;  4I9F A;  4JM1 A;  1V26 A;  1WH9 A;  1RG9 A;  2AYA A;  3J80 D;  3LGX A;  2KZF A;  4WS9 A;  4DR2 C;  3VNR A;  3CJE A;  2UUA C;  4YHH C;  5IWA C;  4G36 A;  4JV5 C;  1ML8 A;  1MXC A;  4BSZ A;  2P2J A;  4JI8 C;  2P2Q A;  4GS5 A;  3DLP X;  4G1I A;  4PZP A;  5IT9 D;  1FJG C;  4DR7 C;  1USP B;  4BC9 A;  1EGA A;  4LF6 C;  3E7X A;  2BH1 X;  1WF3 A;  4PRO C;  4D4I A;  1N36 C;  5BUQ A;  4RM2 A;  4DR3 C;  2Y4N A;  1JOS A;  3C5E A;  4TPS B;  4BBY A;  2UXD C;  1T5H X;  4RLQ A;  3T1Y C;  3UOW A;  3IML A;  4ZLP A;  4MTN A;  1XNR C;  5BSR A;  2V7B A;  2D7V A;  5BUS A;  5FLX D;  4RVO A;  4B3S C;  3LNV A;  1QM4 A;  3LAX A;  2D1R A;  3R9X A;  4B3R C;  4B3T C;  4X64 C;  4GKK C;  2OPL A;  5AE3 A;  5BSW A;  4R0M A;  4FUQ A;  2HJG A;  1K0R A;  2E8E A;  4RVN A;  1HR0 C;  5K85 A;  2DPL A;  4LFB C;  1ULT A;  4DG8 A;  3ETO A;  4DCV A;  4DV3 C;  4LE5 A;  4DR1 C;  2E8F A;  2ONF A;  2CY1 A;  1QWI A;  5E7Q A;  4IR7 A;  3GR1 A;  4DV5 C;  4L4Q A;  1O90 A;  5K8F A;  3TQI A;  4IZ6 A;  3AF5 A;  1HNX C;  2E7G A;  4DCU A;  3PES A;  1L2F A;  2UXC C;  1MXB A;  1O9T A;  1IBL C;  3EER A;  1HNZ C;  4KTT A;  1XRB A;  3NYR A;  3IEU A;  1IBK C;  2Y4O A;  3A4I A;  3FCE A;  1O92 A;  3AF6 A;  2VZE A;  1VLA A;  4L7I A;  5BR8 C;  1I94 C;  4I9G A;  4ZJZ A;  5BUR A;  5CZX A;  2E8C A;  1RY2 A;  3I07 A;  4DG9 A;  2CXC A;  2D28 C;  5DV9 A;  5IFI A;  1UKK A;  4U5Y D;  3N54 B;  4RM3 A;  5GTD A;  5A1I A;  5KEI A;  1MDF A;  1N34 C;  3IEV A;  4DCT A;  4LF8 C;  1N2F A;  3CW8 X;  1ZB8 A;  2WD9 A;  5LMU C;  4WV3 A;  4D57 A;  4DCS A;  3R9W A;  3PRO C;  3NYQ A;  5T8S A;  4NOZ A;  4LF4 C;  3ETC A;  2QVX X;  1KKG A;  2OBV A;  2UUC C;  1NYE A;  2E0G A;  1USP A;  4DV6 C;  4K0K C;  4NXN C;  2UU9 C;  1P7L A;  4X66 C;  2ATW A;  5A19 A;  5LMN C;  1FUG A;  3T1H C;  2OO4 A;  3VNQ A;  4OYC A;  4NXM C;  1N32 C;  3TUF A;  4JI5 C;  4JI1 C;  4GXQ A;  4ISB A;  3KXW A;  2P2M A;  5T8T A;  4PHT A;  4R1L A;  5H9U A;  2D1T A;  3NPD A;  1HNW C;  3GR0 A;  1BA3 A;  4JI3 C;  1N33 C;  4JI6 C;  2VSQ A;  4BC7 A;  4GKJ C;  1XRC A;  2PT7 G;  3N2Q A;  4JI2 C;  2PN2 A;  2F4V C;  2ZM6 C;  3L8C A;  5AE2 A;  2QVY X;  4KTV A;  4RLF A;  2E5L C;  2D1S A;  3OTO C;  1XMO C;  2D27 A;  1MD9 A;  5BSM A;  1HH2 P;  5AE1 A;  4LF9 C;  5A2Q D;  4YY3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...