5T8SA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
388
structure length
388
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
total genus 137
structure length 388
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA03
1O9TA 3IMLA 5A1IA 1RG9A 1XRAA 4ODJA 1QM4A 5T8TA 4L2ZA 4K0BA 4KTTA 4LE5A 3SO4A 3TQIA 5A19A 5H9UA 3TDEA 1O90A 1MXCA 3RV2A 1XRCA 1O93A 4L7IA 5A1GA 1XRBA 4NDNA 5T8SA 1O92A 2P02A 3S82A 3A4IA 2DPLA 1FUGA 1GPMA 3UOWA 2YWCA 1P7LA 4KTVA 4WS9A 4HPVA 2OBVA 1MXBA 4L4QA 1MXAA 2YWBA
chains in the Genus database with same CATH superfamily
4EATA 4DV7C 1HNZC 2CXCA 4OXIA 3UX2A 2P2MA 2OO4A 4DUYC 4RM2A 1FLOA 5IT9D 3NI2A 4LF7C 1L2FA 1O92A 3GKUA 4RMNA 3VNQA 3L95X 4PUIA 5E7QA 5BUQA 1J5EC 1O9TA 2PROA 4ODJA 1MKYA 4JI3C 2ATWA 1O93A 4MTNA 3J81D 3NYQA 2UUAC 3R9WA 2HJGA 3IEVA 4NXNC 1V26A 2DPLA 2E5LC 1VLAA 4WS9A 3C5EA 1WH9A 1XRAA 2YCBA 3ETCA 5BURA 3SO4A 3N54B 5DV9A 2MCQA 1NYEA 1MXCA 1XMQC 3JAMD 4K0KC 4DCSA 1V25A 1WF3A 4L7IA 3E7WA 3H2TA 1M6XA 2QVXX 3CQ1A 4L2ZA 5K8FA 4GKKC 2UXCC 4PHTA 4DV2C 1PG3A 4LFAC 4I9FA 3O2EA 1XHJA 4DCUA 3AY0A 1MDBA 1FUGA 1USPB 2EGTA 2QW0X 3B7WA 2BH1X 4U5YD 4KHPC 1PA4A 4FUQA 3OTOC 1XNQC 4BC7A 4ZJZA 2DHMA 4KTTA 5JRHA 1HNWC 4NOZA 2QL8A 2P2FA 2MM9A 5CZXA 2P02A 3T1YC 4RVOA 4B3MC 4BC9A 3PROC 4HPVA 4MH4A 4GXQA 2OPLB 4LFCC 3IMLA 4JYAC 1IBKC 2JMPA 3I07A 3NPDA 3I08A 2D1RA 1XRCA 4DV1C 1XRBA 1UWDA 2UU9C 2CU6A 2JNVA 4LF6C 2Y4OA 1P7LA 2E8CA 4JM1A 5AE2A 2PT7G 5BSTA 1PU1A 2MMAB 4JI4C 1NY8A 4TPSB 4OX9C 2Y4NA 5H9UA 5LMNC 4B3TC 4RM3A 1VEHA 1UKKA 2WD9A 3UEBA 1IB8A 3TUFA 4DV3C 5BSUA 4LF5C 4G36A 4X65C 3CQ3A 2XR1A 1BA3A 2E7GA 3CQ2A 3K6RA 4K0BA 5KYTA 1ZB8A 4LE5A 1T5HX 4JI0C 4DG8A 3TDEA 5IFIA 1QWIA 1IBLC 2Y27A 4DR1C 3S82A 3KXWA 5AE3A 2BJOA 1WCJA 3A9UA 2WP0C 2YWBA 1MD9A 1RG9A 1V60A 4JV5C 3CW9A 2Z51A 3L8CA 5BR8C 2D1QA 4LF9C 4PUHA 4DV5C 4DR7C 1RY2A 1PG4A 1P4EC 2D28C 3GR1A 4D4GA 3RV2A 4RLFA 4IZ6A 1YJ7A 3A4IA 1IBMC 4JI8C 4BCAA 1JOSA 4WV3A 2OBVA 4PZPA 4G1IA 4ZLPA 5T8TA 3VNSA 2P2QA 1KKGA 3R9XA 4XX2A 4B3RC 1N32C 5T8SA 2UXDC 1XS3A 4PROC 3UOWA 3VNRA 2D1TA 4OYCA 2NCLA 2V7BA 4JI7C 2ZZNA 4R1LA 1N2FA 2M5OA 3RG2A 1K0RA 2CY1A 4DR5C 2UUCC 2D7VA 3TQIA 3E7XA 3PBKA 4D4IA 3EQ6A 2P20A 2HHHC 1N33C 2VQFC 5FLXD 4NXMC 4DR4C 1FJGC 2UUBC 1TH5A 5LCIA 4GKJC 3CW8X 1ML8A 3R44A 2VZEA 3PESA 3ETOA 3LNOA 4FTFA 4B3SC 4DV6C 1HH2P 1O90A 3FCCA 3DHVA 3LAXA 4R0MA 4D57A 2ZZMA 3UZ0A 4DV4C 4DR3C 4DCVA 4JI2C 3TR3A 2VQEC 3A25A 4LF4C 3UX3A 1QM4A 3AF5A 5BSVA 4BSZA 2PN2A 1MDFA 3A26A 4X62C 2D27A 2DYJA 1LQLA 3DLPX 4I9GA 1T5DX 2YX1A 1ZB9A 4JI1C 1P4EA 5GTDA 4DV0C 1I94C 5LMUC 4PUGA 1N34C 3T1HC 4DUZC 2KZFA 5ADZA 1MXAA 4DCTA 3EERA 2QVYX 5AE1A 2ZM6C 3AF6A 5IWAC 5A19A 3GPCA 3CJEA 3J80D 4AQYC 2E8EA 5A1GA 2ASBA 4LF8C 1LCIA 3A9VA 4ISBA 2P2JA 5BSRA 1HR0C 4IR7A 4DG9A 5BSWA 3FCEA 2P2BA 4L4QA 4YY3C 5BSMA 2KZ0A 5K85A 2UXBC 5KEIA 2ONFA 2QVZX 4BBYA 4D56A 1EGAA 4R1MA 1XNRC 3NYRA 4G37A 1AMUA 2M5HA 2E8FA 2D1SA 4LFBC 4NDNA 4RVNA 1HNXC 4X64C 2E0GA 1USPA 4YHHC 3IPLA 3GR0A 1GPMA 2YWCA 5BUSA 1M6XC 2KDNA 4GS5A 4JI5C 3G7SA 1MXBA 3N2QA 5KYVA 2VSQA 5A1IA 4JI6C 4X66C 1N36C 2F4VC 5A2QD 1XMOC 5CZVA 3DAYA 4GXRA 3LUSA 2AYAA 1ULTA 4RLQA 3LGXA 4DR2C 4FUTA 4DR6C 3IEUA 4KTVA 2OPLA 3LNVA
chains in the Genus database with same CATH topology
4EATA 4DV7C 1HNZC 2CXCA 4OXIA 2P2MA 2OO4A 4DUYC 4RM2A 5IT9D 3NI2A 4LF7C 1L2FA 1O92A 3GKUA 4RMNA 3VNQA 3L95X 5E7QA 5BUQA 1J5EC 1O9TA 2PROA 4ODJA 1MKYA 4JI3C 2ATWA 1O93A 4MTNA 3J81D 3NYQA 2UUAC 3R9WA 2HJGA 3IEVA 4NXNC 1V26A 2DPLA 2E5LC 1VLAA 4WS9A 3C5EA 1WH9A 1XRAA 2YCBA 3ETCA 5BURA 3SO4A 3N54B 5DV9A 1NYEA 1MXCA 1XMQC 3JAMD 4K0KC 4DCSA 1V25A 1WF3A 4L7IA 3E7WA 3H2TA 2QVXX 4L2ZA 5K8FA 4GKKC 2UXCC 4PHTA 4DV2C 1PG3A 4LFAC 4I9FA 4DCUA 1MDBA 1FUGA 1USPB 2EGTA 2QW0X 3B7WA 2BH1X 4U5YD 4KHPC 1PA4A 4FUQA 3OTOC 1XNQC 4BC7A 4ZJZA 4KTTA 5JRHA 1HNWC 4NOZA 2QL8A 2P2FA 5CZXA 2P02A 3T1YC 4RVOA 4B3MC 4BC9A 3PROC 4HPVA 4MH4A 4GXQA 2OPLB 4LFCC 3IMLA 4JYAC 1IBKC 2JMPA 3I07A 3NPDA 3I08A 2D1RA 1XRCA 4DV1C 1XRBA 2UU9C 4LF6C 2Y4OA 1P7LA 2E8CA 4JM1A 5AE2A 2PT7G 5BSTA 4JI4C 4TPSB 4OX9C 2Y4NA 5H9UA 5LMNC 4B3TC 4RM3A 1UKKA 2WD9A 3TUFA 4DV3C 5BSUA 4LF5C 4G36A 4X65C 2XR1A 1BA3A 2E7GA 4K0BA 5KYTA 1ZB8A 4LE5A 1T5HX 4JI0C 4DG8A 3TDEA 5IFIA 1QWIA 1IBLC 2Y27A 4DR1C 3S82A 3KXWA 5AE3A 2BJOA 3A9UA 2WP0C 2YWBA 1MD9A 1RG9A 4JV5C 3CW9A 3L8CA 5BR8C 2D1QA 4LF9C 4DV5C 4DR7C 1RY2A 1PG4A 2D28C 3GR1A 4D4GA 3RV2A 4RLFA 4IZ6A 1YJ7A 3A4IA 1IBMC 4JI8C 4BCAA 1JOSA 4WV3A 2OBVA 4PZPA 4G1IA 4ZLPA 5T8TA 3VNSA 2P2QA 1KKGA 3R9XA 4XX2A 4B3RC 1N32C 5T8SA 2UXDC 4PROC 3UOWA 3VNRA 2D1TA 4OYCA 2V7BA 4JI7C 4R1LA 1N2FA 3RG2A 1K0RA 2CY1A 4DR5C 2UUCC 2D7VA 3TQIA 3E7XA 3PBKA 4D4IA 3EQ6A 2P20A 2HHHC 1N33C 2VQFC 5FLXD 4NXMC 4DR4C 1FJGC 2UUBC 4GKJC 3CW8X 1ML8A 3R44A 2VZEA 3PESA 3ETOA 4FTFA 4B3SC 4DV6C 1HH2P 1O90A 3FCCA 3DHVA 3LAXA 4R0MA 4D57A 3UZ0A 4DV4C 4DR3C 4DCVA 4JI2C 2VQEC 4LF4C 1QM4A 3AF5A 5BSVA 4BSZA 2PN2A 1MDFA 4X62C 2D27A 2DYJA 1LQLA 3DLPX 4I9GA 1T5DX 1ZB9A 4JI1C 5GTDA 4DV0C 1I94C 5LMUC 1N34C 3T1HC 4DUZC 2KZFA 5ADZA 1MXAA 4DCTA 3EERA 2QVYX 5AE1A 2ZM6C 3AF6A 5IWAC 5A19A 3GPCA 3CJEA 3J80D 4AQYC 2E8EA 5A1GA 2ASBA 4LF8C 1LCIA 3A9VA 4ISBA 2P2JA 5BSRA 1HR0C 4IR7A 4DG9A 5BSWA 3FCEA 2P2BA 4L4QA 4YY3C 5BSMA 5K85A 2UXBC 5KEIA 2ONFA 2QVZX 4BBYA 4D56A 1EGAA 4R1MA 1XNRC 3NYRA 4G37A 1AMUA 2E8FA 2D1SA 4LFBC 4NDNA 4RVNA 1HNXC 4X64C 2E0GA 1USPA 4YHHC 3IPLA 3GR0A 1GPMA 2YWCA 5BUSA 4GS5A 4JI5C 3G7SA 1MXBA 3N2QA 5KYVA 2VSQA 5A1IA 4JI6C 4X66C 1N36C 2F4VC 5A2QD 1XMOC 5CZVA 3DAYA 4GXRA 3LUSA 2AYAA 1ULTA 4RLQA 3LGXA 4DR2C 4FUTA 4DR6C 3IEUA 4KTVA 2OPLA 3LNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9T A;  3IML A;  5A1I A;  1RG9 A;  1XRA A;  4ODJ A;  1QM4 A;  5T8T A;  4L2Z A;  4K0B A;  4KTT A;  4LE5 A;  3SO4 A;  3TQI A;  5A19 A;  5H9U A;  3TDE A;  1O90 A;  1MXC A;  3RV2 A;  1XRC A;  1O93 A;  4L7I A;  5A1G A;  1XRB A;  4NDN A;  5T8S A;  1O92 A;  2P02 A;  3S82 A;  3A4I A;  2DPL A;  1FUG A;  1GPM A;  3UOW A;  2YWC A;  1P7L A;  4KTV A;  4WS9 A;  4HPV A;  2OBV A;  1MXB A;  4L4Q A;  1MXA A;  2YWB A; 
#chains in the Genus database with same CATH topology
 4EAT A;  4DV7 C;  1HNZ C;  2CXC A;  4OXI A;  3UX2 A;  2P2M A;  2OO4 A;  4DUY C;  4RM2 A;  1FLO A;  5IT9 D;  3NI2 A;  4LF7 C;  1L2F A;  1O92 A;  3GKU A;  4RMN A;  3VNQ A;  3L95 X;  4PUI A;  5E7Q A;  5BUQ A;  1J5E C;  1O9T A;  2PRO A;  4ODJ A;  1MKY A;  4JI3 C;  2ATW A;  1O93 A;  4MTN A;  3J81 D;  3NYQ A;  2UUA C;  3R9W A;  2HJG A;  3IEV A;  4NXN C;  1V26 A;  2DPL A;  2E5L C;  1VLA A;  4WS9 A;  3C5E A;  1WH9 A;  1XRA A;  2YCB A;  3ETC A;  5BUR A;  3SO4 A;  3N54 B;  5DV9 A;  2MCQ A;  1NYE A;  1MXC A;  1XMQ C;  3JAM D;  4K0K C;  4DCS A;  1V25 A;  1WF3 A;  4L7I A;  3E7W A;  3H2T A;  1M6X A;  2QVX X;  3CQ1 A;  4L2Z A;  5K8F A;  4GKK C;  2UXC C;  4PHT A;  4DV2 C;  1PG3 A;  4LFA C;  4I9F A;  3O2E A;  1XHJ A;  4DCU A;  3AY0 A;  1MDB A;  1FUG A;  1USP B;  2EGT A;  2QW0 X;  3B7W A;  2BH1 X;  4U5Y D;  4KHP C;  1PA4 A;  4FUQ A;  3OTO C;  1XNQ C;  4BC7 A;  4ZJZ A;  2DHM A;  4KTT A;  5JRH A;  1HNW C;  4NOZ A;  2QL8 A;  2P2F A;  2MM9 A;  5CZX A;  2P02 A;  3T1Y C;  4RVO A;  4B3M C;  4BC9 A;  3PRO C;  4HPV A;  4MH4 A;  4GXQ A;  2OPL B;  4LFC C;  3IML A;  4JYA C;  1IBK C;  2JMP A;  3I07 A;  3NPD A;  3I08 A;  2D1R A;  1XRC A;  4DV1 C;  1XRB A;  1UWD A;  2UU9 C;  2CU6 A;  2JNV A;  4LF6 C;  2Y4O A;  1P7L A;  2E8C A;  4JM1 A;  5AE2 A;  2PT7 G;  5BST A;  1PU1 A;  2MMA B;  4JI4 C;  1NY8 A;  4TPS B;  4OX9 C;  2Y4N A;  5H9U A;  5LMN C;  4B3T C;  4RM3 A;  1VEH A;  1UKK A;  2WD9 A;  3UEB A;  1IB8 A;  3TUF A;  4DV3 C;  5BSU A;  4LF5 C;  4G36 A;  4X65 C;  3CQ3 A;  2XR1 A;  1BA3 A;  2E7G A;  3CQ2 A;  3K6R A;  4K0B A;  5KYT A;  1ZB8 A;  4LE5 A;  1T5H X;  4JI0 C;  4DG8 A;  3TDE A;  5IFI A;  1QWI A;  1IBL C;  2Y27 A;  4DR1 C;  3S82 A;  3KXW A;  5AE3 A;  2BJO A;  1WCJ A;  3A9U A;  2WP0 C;  2YWB A;  1MD9 A;  1RG9 A;  1V60 A;  4JV5 C;  3CW9 A;  2Z51 A;  3L8C A;  5BR8 C;  2D1Q A;  4LF9 C;  4PUH A;  4DV5 C;  4DR7 C;  1RY2 A;  1PG4 A;  1P4E C;  2D28 C;  3GR1 A;  4D4G A;  3RV2 A;  4RLF A;  4IZ6 A;  1YJ7 A;  3A4I A;  1IBM C;  4JI8 C;  4BCA A;  1JOS A;  4WV3 A;  2OBV A;  4PZP A;  4G1I A;  4ZLP A;  5T8T A;  3VNS A;  2P2Q A;  1KKG A;  3R9X A;  4XX2 A;  4B3R C;  1N32 C;  5T8S A;  2UXD C;  1XS3 A;  4PRO C;  3UOW A;  3VNR A;  2D1T A;  4OYC A;  2NCL A;  2V7B A;  4JI7 C;  2ZZN A;  4R1L A;  1N2F A;  2M5O A;  3RG2 A;  1K0R A;  2CY1 A;  4DR5 C;  2UUC C;  2D7V A;  3TQI A;  3E7X A;  3PBK A;  4D4I A;  3EQ6 A;  2P20 A;  2HHH C;  1N33 C;  2VQF C;  5FLX D;  4NXM C;  4DR4 C;  1FJG C;  2UUB C;  1TH5 A;  5LCI A;  4GKJ C;  3CW8 X;  1ML8 A;  3R44 A;  2VZE A;  3PES A;  3ETO A;  3LNO A;  4FTF A;  4B3S C;  4DV6 C;  1HH2 P;  1O90 A;  3FCC A;  3DHV A;  3LAX A;  4R0M A;  4D57 A;  2ZZM A;  3UZ0 A;  4DV4 C;  4DR3 C;  4DCV A;  4JI2 C;  3TR3 A;  2VQE C;  3A25 A;  4LF4 C;  3UX3 A;  1QM4 A;  3AF5 A;  5BSV A;  4BSZ A;  2PN2 A;  1MDF A;  3A26 A;  4X62 C;  2D27 A;  2DYJ A;  1LQL A;  3DLP X;  4I9G A;  1T5D X;  2YX1 A;  1ZB9 A;  4JI1 C;  1P4E A;  5GTD A;  4DV0 C;  1I94 C;  5LMU C;  4PUG A;  1N34 C;  3T1H C;  4DUZ C;  2KZF A;  5ADZ A;  1MXA A;  4DCT A;  3EER A;  2QVY X;  5AE1 A;  2ZM6 C;  3AF6 A;  5IWA C;  5A19 A;  3GPC A;  3CJE A;  3J80 D;  4AQY C;  2E8E A;  5A1G A;  2ASB A;  4LF8 C;  1LCI A;  3A9V A;  4ISB A;  2P2J A;  5BSR A;  1HR0 C;  4IR7 A;  4DG9 A;  5BSW A;  3FCE A;  2P2B A;  4L4Q A;  4YY3 C;  5BSM A;  2KZ0 A;  5K85 A;  2UXB C;  5KEI A;  2ONF A;  2QVZ X;  4BBY A;  4D56 A;  1EGA A;  4R1M A;  1XNR C;  3NYR A;  4G37 A;  1AMU A;  2M5H A;  2E8F A;  2D1S A;  4LFB C;  4NDN A;  4RVN A;  1HNX C;  4X64 C;  2E0G A;  1USP A;  4YHH C;  3IPL A;  3GR0 A;  1GPM A;  2YWC A;  5BUS A;  1M6X C;  2KDN A;  4GS5 A;  4JI5 C;  3G7S A;  1MXB A;  3N2Q A;  5KYV A;  2VSQ A;  5A1I A;  4JI6 C;  4X66 C;  1N36 C;  2F4V C;  5A2Q D;  1XMO C;  5CZV A;  3DAY A;  4GXR A;  3LUS A;  2AYA A;  1ULT A;  4RLQ A;  3LGX A;  4DR2 C;  4FUT A;  4DR6 C;  3IEU A;  4KTV A;  2OPL A;  3LNV A; 
#chains in the Genus database with same CATH homology
 4EAT A;  4DV7 C;  1HNZ C;  2CXC A;  4OXI A;  2P2M A;  2OO4 A;  4DUY C;  4RM2 A;  5IT9 D;  3NI2 A;  4LF7 C;  1L2F A;  1O92 A;  3GKU A;  4RMN A;  3VNQ A;  3L95 X;  5E7Q A;  5BUQ A;  1J5E C;  1O9T A;  2PRO A;  4ODJ A;  1MKY A;  4JI3 C;  2ATW A;  1O93 A;  4MTN A;  3J81 D;  3NYQ A;  2UUA C;  3R9W A;  2HJG A;  3IEV A;  4NXN C;  1V26 A;  2DPL A;  2E5L C;  1VLA A;  4WS9 A;  3C5E A;  1WH9 A;  1XRA A;  2YCB A;  3ETC A;  5BUR A;  3SO4 A;  3N54 B;  5DV9 A;  1NYE A;  1MXC A;  1XMQ C;  3JAM D;  4K0K C;  4DCS A;  1V25 A;  1WF3 A;  4L7I A;  3E7W A;  3H2T A;  2QVX X;  4L2Z A;  5K8F A;  4GKK C;  2UXC C;  4PHT A;  4DV2 C;  1PG3 A;  4LFA C;  4I9F A;  4DCU A;  1MDB A;  1FUG A;  1USP B;  2EGT A;  2QW0 X;  3B7W A;  2BH1 X;  4U5Y D;  4KHP C;  1PA4 A;  4FUQ A;  3OTO C;  1XNQ C;  4BC7 A;  4ZJZ A;  4KTT A;  5JRH A;  1HNW C;  4NOZ A;  2QL8 A;  2P2F A;  5CZX A;  2P02 A;  3T1Y C;  4RVO A;  4B3M C;  4BC9 A;  3PRO C;  4HPV A;  4MH4 A;  4GXQ A;  2OPL B;  4LFC C;  3IML A;  4JYA C;  1IBK C;  2JMP A;  3I07 A;  3NPD A;  3I08 A;  2D1R A;  1XRC A;  4DV1 C;  1XRB A;  2UU9 C;  4LF6 C;  2Y4O A;  1P7L A;  2E8C A;  4JM1 A;  5AE2 A;  2PT7 G;  5BST A;  4JI4 C;  4TPS B;  4OX9 C;  2Y4N A;  5H9U A;  5LMN C;  4B3T C;  4RM3 A;  1UKK A;  2WD9 A;  3TUF A;  4DV3 C;  5BSU A;  4LF5 C;  4G36 A;  4X65 C;  2XR1 A;  1BA3 A;  2E7G A;  4K0B A;  5KYT A;  1ZB8 A;  4LE5 A;  1T5H X;  4JI0 C;  4DG8 A;  3TDE A;  5IFI A;  1QWI A;  1IBL C;  2Y27 A;  4DR1 C;  3S82 A;  3KXW A;  5AE3 A;  2BJO A;  3A9U A;  2WP0 C;  2YWB A;  1MD9 A;  1RG9 A;  4JV5 C;  3CW9 A;  3L8C A;  5BR8 C;  2D1Q A;  4LF9 C;  4DV5 C;  4DR7 C;  1RY2 A;  1PG4 A;  2D28 C;  3GR1 A;  4D4G A;  3RV2 A;  4RLF A;  4IZ6 A;  1YJ7 A;  3A4I A;  1IBM C;  4JI8 C;  4BCA A;  1JOS A;  4WV3 A;  2OBV A;  4PZP A;  4G1I A;  4ZLP A;  5T8T A;  3VNS A;  2P2Q A;  1KKG A;  3R9X A;  4XX2 A;  4B3R C;  1N32 C;  5T8S A;  2UXD C;  4PRO C;  3UOW A;  3VNR A;  2D1T A;  4OYC A;  2V7B A;  4JI7 C;  4R1L A;  1N2F A;  3RG2 A;  1K0R A;  2CY1 A;  4DR5 C;  2UUC C;  2D7V A;  3TQI A;  3E7X A;  3PBK A;  4D4I A;  3EQ6 A;  2P20 A;  2HHH C;  1N33 C;  2VQF C;  5FLX D;  4NXM C;  4DR4 C;  1FJG C;  2UUB C;  4GKJ C;  3CW8 X;  1ML8 A;  3R44 A;  2VZE A;  3PES A;  3ETO A;  4FTF A;  4B3S C;  4DV6 C;  1HH2 P;  1O90 A;  3FCC A;  3DHV A;  3LAX A;  4R0M A;  4D57 A;  3UZ0 A;  4DV4 C;  4DR3 C;  4DCV A;  4JI2 C;  2VQE C;  4LF4 C;  1QM4 A;  3AF5 A;  5BSV A;  4BSZ A;  2PN2 A;  1MDF A;  4X62 C;  2D27 A;  2DYJ A;  1LQL A;  3DLP X;  4I9G A;  1T5D X;  1ZB9 A;  4JI1 C;  5GTD A;  4DV0 C;  1I94 C;  5LMU C;  1N34 C;  3T1H C;  4DUZ C;  2KZF A;  5ADZ A;  1MXA A;  4DCT A;  3EER A;  2QVY X;  5AE1 A;  2ZM6 C;  3AF6 A;  5IWA C;  5A19 A;  3GPC A;  3CJE A;  3J80 D;  4AQY C;  2E8E A;  5A1G A;  2ASB A;  4LF8 C;  1LCI A;  3A9V A;  4ISB A;  2P2J A;  5BSR A;  1HR0 C;  4IR7 A;  4DG9 A;  5BSW A;  3FCE A;  2P2B A;  4L4Q A;  4YY3 C;  5BSM A;  5K85 A;  2UXB C;  5KEI A;  2ONF A;  2QVZ X;  4BBY A;  4D56 A;  1EGA A;  4R1M A;  1XNR C;  3NYR A;  4G37 A;  1AMU A;  2E8F A;  2D1S A;  4LFB C;  4NDN A;  4RVN A;  1HNX C;  4X64 C;  2E0G A;  1USP A;  4YHH C;  3IPL A;  3GR0 A;  1GPM A;  2YWC A;  5BUS A;  4GS5 A;  4JI5 C;  3G7S A;  1MXB A;  3N2Q A;  5KYV A;  2VSQ A;  5A1I A;  4JI6 C;  4X66 C;  1N36 C;  2F4V C;  5A2Q D;  1XMO C;  5CZV A;  3DAY A;  4GXR A;  3LUS A;  2AYA A;  1ULT A;  4RLQ A;  3LGX A;  4DR2 C;  4FUT A;  4DR6 C;  3IEU A;  4KTV A;  2OPL A;  3LNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...