5T8SA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
388
structure length
388
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
total genus 137
structure length 388
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA03
4KTVA 3UOWA 2DPLA 2P02A 1O92A 1XRBA 5A1IA 3A4IA 4KTTA 1P7LA 4ODJA 3S82A 1O9TA 3IMLA 1O93A 4L4QA 1GPMA 1XRAA 5A1GA 2OBVA 4L2ZA 4L7IA 4HPVA 5T8TA 4WS9A 5A19A 1MXCA 4NDNA 1MXBA 2YWCA 3TDEA 1RG9A 3RV2A 1O90A 1QM4A 1MXAA 4LE5A 4K0BA 5H9UA 5T8SA 1XRCA 3TQIA 2YWBA 3SO4A 1FUGA
chains in the Genus database with same CATH superfamily
1WH9A 1XMOC 1FJGC 4MH4A 4LF8C 2UUCC 3EQ6A 3UX3A 4LF7C 4FTFA 4DCUA 4DG8A 1USPA 1MD9A 2OPLA 1QWIA 3TR3A 2Y4OA 2VZEA 3PESA 1RG9A 2V7BA 2ASBA 5AE2A 4RVNA 1XRCA 4YHHC 2M5HA 1WF3A 4DR1C 4PROC 2P02A 2YCBA 3A4IA 2CY1A 3IPLA 4DCTA 2CXCA 3ETOA 2D1SA 4X64C 1LCIA 3FCEA 4BSZA 2ATWA 1MXCA 3E7WA 1MXBA 3A9UA 3DAYA 4D57A 4JI3C 3LNVA 4LE5A 1N2FA 2KZ0A 2WD9A 2P2QA 3TQIA 3I07A 4DUZC 2D1QA 4LFAC 2VQEC 1V60A 2ZZMA 5AE1A 4G37A 4L2ZA 4B3TC 1XMQC 5LCIA 2P2MA 5IFIA 4ISBA 2D7VA 5CZVA 3R9XA 4AQYC 2P2JA 3DHVA 4R1MA 2UXBC 4DR6C 5JRHA 5A1IA 4I9GA 1RY2A 3RG2A 3LUSA 3A25A 2E8CA 3LAXA 4L4QA 3R44A 1N33C 3VNRA 4ZJZA 4DV5C 1ULTA 4WS9A 3CW9A 4DR4C 2QVYX 4LF5C 4GXRA 2M5OA 3I08A 4DCSA 2YWBA 2QL8A 3E7XA 1K0RA 3N2QA 2UUBC 1N32C 3GR1A 1L2FA 1J5EC 4XX2A 2Y27A 1P4EC 5KEIA 2KZFA 1N36C 5A1GA 4DV1C 5ADZA 4DV3C 3LNOA 1V26A 1HNXC 4JI8C 1P4EA 2MCQA 4JI0C 3JAMD 4X65C 5BSWA 4PZPA 2YX1A 4U5YD 2QVXX 4JI6C 2F4VC 1M6XA 4JI2C 4D4GA 5BSTA 4DG9A 4NXNC 2OBVA 5CZXA 5KYVA 5KYTA 3TUFA 5BR8C 2YWCA 3O2EA 4X66C 2KDNA 5AE3A 1TH5A 1MDFA 2D28C 4DUYC 3KXWA 4RMNA 2DYJA 1T5HX 5BURA 3UOWA 1HNWC 1N34C 2E7GA 1P7LA 5BSUA 3CJEA 1O93A 1HNZC 4LF4C 3L8CA 1PA4A 4OYCA 2E8FA 1ZB8A 2E8EA 2D27A 4B3SC 4DV0C 4IR7A 1FUGA 2E5LC 2D1TA 4IZ6A 1UKKA 2MMAB 3NPDA 3DLPX 3PROC 4ZLPA 2DPLA 1O92A 4X62C 1JOSA 1HH2P 3UEBA 1O9TA 1IBLC 2DHMA 3GKUA 3AF5A 1PG4A 2QW0X 2MM9A 4RLFA 1QM4A 5K85A 4DCVA 4RVOA 4DR3C 5H9UA 2HJGA 4YY3C 2AYAA 1IBMC 2EGTA 2NCLA 3SO4A 4BC9A 2ZZNA 3IEUA 4R0MA 3GPCA 3T1YC 3NI2A 1EGAA 4OXIA 2WP0C 5DV9A 4HPVA 3AF6A 3L95X 2ZM6C 1IB8A 3TDEA 4LFBC 2JNVA 2XR1A 2P20A 3CW8X 1UWDA 1WCJA 4NOZA 4TPSB 4ODJA 5GTDA 4DR5C 5BUSA 2ONFA 2Z51A 4DV7C 5A2QD 4NDNA 5IT9D 4PUHA 4JI4C 5T8SA 2UU9C 3B7WA 3A9VA 1NYEA 4JV5C 1XHJA 2P2BA 4NXMC 1ML8A 1BA3A 1KKGA 1XS3A 3PBKA 4BC7A 4GXQA 4D56A 4EATA 5LMNC 2CU6A 4WV3A 1AMUA 3VNSA 3CQ1A 4K0BA 4JM1A 3NYRA 4FUQA 3UZ0A 4BBYA 3R9WA 1IBKC 3CQ3A 1FLOA 4KHPC 4B3MC 4JYAC 5BSRA 2VSQA 1XNRC 3AY0A 1XRAA 4PUIA 4L7IA 4K0KC 4LFCC 5BUQA 5IWAC 3RV2A 3NYQA 3J81D 4KTVA 3ETCA 2P2FA 2Y4NA 4KTTA 3J80D 4LF6C 4JI7C 2BJOA 2PROA 1GPMA 1MDBA 3VNQA 2E0GA 3GR0A 4DR2C 4FUTA 4G1IA 1LQLA 4DV2C 3H2TA 3IEVA 5K8FA 4RM2A 1VLAA 2UUAC 1PU1A 4GKKC 1NY8A 5E7QA 3FCCA 3S82A 2OPLB 3T1HC 1YJ7A 2PN2A 4R1LA 2BH1X 2D1RA 2OO4A 5T8TA 4PUGA 5A19A 3K6RA 4MTNA 4JI1C 1T5DX 2QVZX 5LMUC 4GKJC 4BCAA 1XRBA 3N54B 4OX9C 1V25A 2UXCC 1I94C 3IMLA 5BSVA 2UXDC 1XNQC 3UX2A 4LF9C 1O90A 3C5EA 4D4IA 4DV6C 3A26A 3LGXA 5FLXD 1ZB9A 4I9FA 4GS5A 1M6XC 3CQ2A 4G36A 4DR7C 4DV4C 1PG3A 1VEHA 3OTOC 1HR0C 2HHHC 5BSMA 1MKYA 4B3RC 2JMPA 4JI5C 1MXAA 2VQFC 4PHTA 4RM3A 4RLQA 3EERA 2PT7G 3G7SA 1USPB
chains in the Genus database with same CATH topology
1WH9A 1XMOC 1FJGC 4MH4A 4LF8C 2UUCC 3EQ6A 4LF7C 4FTFA 4DCUA 4DG8A 1USPA 1MD9A 2OPLA 1QWIA 2Y4OA 2VZEA 3PESA 1RG9A 2V7BA 2ASBA 5AE2A 4RVNA 1XRCA 4YHHC 1WF3A 4DR1C 4PROC 2P02A 2YCBA 3A4IA 2CY1A 3IPLA 4DCTA 2CXCA 3ETOA 2D1SA 4X64C 1LCIA 3FCEA 4BSZA 2ATWA 1MXCA 3E7WA 1MXBA 3A9UA 3DAYA 4D57A 4JI3C 3LNVA 4LE5A 1N2FA 2WD9A 2P2QA 3TQIA 3I07A 4DUZC 2D1QA 4LFAC 2VQEC 5AE1A 4G37A 4L2ZA 4B3TC 1XMQC 2P2MA 5IFIA 4ISBA 2D7VA 5CZVA 3R9XA 4AQYC 2P2JA 3DHVA 4R1MA 2UXBC 4DR6C 5JRHA 5A1IA 4I9GA 1RY2A 3RG2A 3LUSA 2E8CA 3LAXA 4L4QA 3R44A 1N33C 3VNRA 4ZJZA 4DV5C 1ULTA 4WS9A 3CW9A 4DR4C 2QVYX 4LF5C 4GXRA 3I08A 4DCSA 2YWBA 2QL8A 3E7XA 1K0RA 3N2QA 2UUBC 1N32C 3GR1A 1L2FA 1J5EC 4XX2A 2Y27A 5KEIA 2KZFA 1N36C 5A1GA 4DV1C 5ADZA 4DV3C 1V26A 1HNXC 4JI8C 4JI0C 3JAMD 4X65C 5BSWA 4PZPA 4U5YD 2QVXX 4JI6C 2F4VC 4JI2C 4D4GA 5BSTA 4DG9A 4NXNC 2OBVA 5CZXA 5KYVA 5KYTA 3TUFA 5BR8C 2YWCA 4X66C 5AE3A 1MDFA 2D28C 4DUYC 3KXWA 4RMNA 2DYJA 1T5HX 5BURA 3UOWA 1HNWC 1N34C 2E7GA 1P7LA 5BSUA 3CJEA 1O93A 1HNZC 4LF4C 3L8CA 1PA4A 4OYCA 2E8FA 1ZB8A 2E8EA 2D27A 4B3SC 4DV0C 4IR7A 1FUGA 2E5LC 2D1TA 4IZ6A 1UKKA 3NPDA 3DLPX 3PROC 4ZLPA 2DPLA 1O92A 4X62C 1JOSA 1HH2P 1O9TA 1IBLC 3GKUA 3AF5A 1PG4A 2QW0X 4RLFA 1QM4A 5K85A 4DCVA 4RVOA 4DR3C 5H9UA 2HJGA 4YY3C 1IBMC 2AYAA 2EGTA 3SO4A 4BC9A 3IEUA 4R0MA 3GPCA 3T1YC 3NI2A 1EGAA 4OXIA 2WP0C 5DV9A 4HPVA 3AF6A 3L95X 2ZM6C 3TDEA 4LFBC 2XR1A 2P20A 3CW8X 4NOZA 4TPSB 4ODJA 5GTDA 4DR5C 5BUSA 2ONFA 4DV7C 5A2QD 4NDNA 5IT9D 4JI4C 5T8SA 2UU9C 3B7WA 3A9VA 1NYEA 4JV5C 2P2BA 4NXMC 1ML8A 1BA3A 1KKGA 3PBKA 4BC7A 4GXQA 4D56A 4EATA 5LMNC 4WV3A 1AMUA 3VNSA 4K0BA 4JM1A 3NYRA 4FUQA 3UZ0A 4BBYA 3R9WA 1IBKC 4KHPC 4B3MC 4JYAC 5BSRA 2VSQA 1XNRC 1XRAA 4K0KC 4L7IA 4LFCC 5BUQA 5IWAC 3RV2A 3NYQA 3J81D 4KTVA 3ETCA 2P2FA 2Y4NA 4KTTA 3J80D 4LF6C 4JI7C 2BJOA 2PROA 1GPMA 1MDBA 3VNQA 2E0GA 3GR0A 4DR2C 4FUTA 4G1IA 1LQLA 4DV2C 3H2TA 3IEVA 5K8FA 4RM2A 1VLAA 2UUAC 4GKKC 5E7QA 3FCCA 3S82A 2OPLB 3T1HC 1YJ7A 2PN2A 4R1LA 2BH1X 2D1RA 2OO4A 5T8TA 5A19A 4MTNA 4JI1C 1T5DX 2QVZX 5LMUC 4GKJC 4BCAA 1XRBA 3N54B 4OX9C 1V25A 2UXCC 1I94C 3IMLA 5BSVA 2UXDC 1XNQC 4LF9C 1O90A 3C5EA 4D4IA 4DV6C 3LGXA 1ZB9A 5FLXD 4I9FA 4GS5A 4G36A 4DR7C 4DV4C 1PG3A 3OTOC 1HR0C 2HHHC 5BSMA 1MKYA 4B3RC 2JMPA 4JI5C 1MXAA 2VQFC 4PHTA 4RM3A 4RLQA 3EERA 2PT7G 3G7SA 1USPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTV A;  3UOW A;  2DPL A;  2P02 A;  1O92 A;  1XRB A;  5A1I A;  3A4I A;  4KTT A;  1P7L A;  4ODJ A;  3S82 A;  1O9T A;  3IML A;  1O93 A;  4L4Q A;  1GPM A;  1XRA A;  5A1G A;  2OBV A;  4L2Z A;  4L7I A;  4HPV A;  5T8T A;  4WS9 A;  5A19 A;  1MXC A;  4NDN A;  1MXB A;  2YWC A;  3TDE A;  1RG9 A;  3RV2 A;  1O90 A;  1QM4 A;  1MXA A;  4LE5 A;  4K0B A;  5H9U A;  5T8S A;  1XRC A;  3TQI A;  2YWB A;  3SO4 A;  1FUG A; 
#chains in the Genus database with same CATH topology
 1WH9 A;  1XMO C;  1FJG C;  4MH4 A;  4LF8 C;  2UUC C;  3EQ6 A;  3UX3 A;  4LF7 C;  4FTF A;  4DCU A;  4DG8 A;  1USP A;  1MD9 A;  2OPL A;  1QWI A;  3TR3 A;  2Y4O A;  2VZE A;  3PES A;  1RG9 A;  2V7B A;  2ASB A;  5AE2 A;  4RVN A;  1XRC A;  4YHH C;  2M5H A;  1WF3 A;  4DR1 C;  4PRO C;  2P02 A;  2YCB A;  3A4I A;  2CY1 A;  3IPL A;  4DCT A;  2CXC A;  3ETO A;  2D1S A;  4X64 C;  1LCI A;  3FCE A;  4BSZ A;  2ATW A;  1MXC A;  3E7W A;  1MXB A;  3A9U A;  3DAY A;  4D57 A;  4JI3 C;  3LNV A;  4LE5 A;  1N2F A;  2KZ0 A;  2WD9 A;  2P2Q A;  3TQI A;  3I07 A;  4DUZ C;  2D1Q A;  4LFA C;  2VQE C;  1V60 A;  2ZZM A;  5AE1 A;  4G37 A;  4L2Z A;  4B3T C;  1XMQ C;  5LCI A;  2P2M A;  5IFI A;  4ISB A;  2D7V A;  5CZV A;  3R9X A;  4AQY C;  2P2J A;  3DHV A;  4R1M A;  2UXB C;  4DR6 C;  5JRH A;  5A1I A;  4I9G A;  1RY2 A;  3RG2 A;  3LUS A;  3A25 A;  2E8C A;  3LAX A;  4L4Q A;  3R44 A;  1N33 C;  3VNR A;  4ZJZ A;  4DV5 C;  1ULT A;  4WS9 A;  3CW9 A;  4DR4 C;  2QVY X;  4LF5 C;  4GXR A;  2M5O A;  3I08 A;  4DCS A;  2YWB A;  2QL8 A;  3E7X A;  1K0R A;  3N2Q A;  2UUB C;  1N32 C;  3GR1 A;  1L2F A;  1J5E C;  4XX2 A;  2Y27 A;  1P4E C;  5KEI A;  2KZF A;  1N36 C;  5A1G A;  4DV1 C;  5ADZ A;  4DV3 C;  3LNO A;  1V26 A;  1HNX C;  4JI8 C;  1P4E A;  2MCQ A;  4JI0 C;  3JAM D;  4X65 C;  5BSW A;  4PZP A;  2YX1 A;  4U5Y D;  2QVX X;  4JI6 C;  2F4V C;  1M6X A;  4JI2 C;  4D4G A;  5BST A;  4DG9 A;  4NXN C;  2OBV A;  5CZX A;  5KYV A;  5KYT A;  3TUF A;  5BR8 C;  2YWC A;  3O2E A;  4X66 C;  2KDN A;  5AE3 A;  1TH5 A;  1MDF A;  2D28 C;  4DUY C;  3KXW A;  4RMN A;  2DYJ A;  1T5H X;  5BUR A;  3UOW A;  1HNW C;  1N34 C;  2E7G A;  1P7L A;  5BSU A;  3CJE A;  1O93 A;  1HNZ C;  4LF4 C;  3L8C A;  1PA4 A;  4OYC A;  2E8F A;  1ZB8 A;  2E8E A;  2D27 A;  4B3S C;  4DV0 C;  4IR7 A;  1FUG A;  2E5L C;  2D1T A;  4IZ6 A;  1UKK A;  2MMA B;  3NPD A;  3DLP X;  3PRO C;  4ZLP A;  2DPL A;  1O92 A;  4X62 C;  1JOS A;  1HH2 P;  3UEB A;  1O9T A;  1IBL C;  2DHM A;  3GKU A;  3AF5 A;  1PG4 A;  2QW0 X;  2MM9 A;  4RLF A;  1QM4 A;  5K85 A;  4DCV A;  4RVO A;  4DR3 C;  5H9U A;  2HJG A;  4YY3 C;  2AYA A;  1IBM C;  2EGT A;  2NCL A;  3SO4 A;  4BC9 A;  2ZZN A;  3IEU A;  4R0M A;  3GPC A;  3T1Y C;  3NI2 A;  1EGA A;  4OXI A;  2WP0 C;  5DV9 A;  4HPV A;  3AF6 A;  3L95 X;  2ZM6 C;  1IB8 A;  3TDE A;  4LFB C;  2JNV A;  2XR1 A;  2P20 A;  3CW8 X;  1UWD A;  1WCJ A;  4NOZ A;  4TPS B;  4ODJ A;  5GTD A;  4DR5 C;  5BUS A;  2ONF A;  2Z51 A;  4DV7 C;  5A2Q D;  4NDN A;  5IT9 D;  4PUH A;  4JI4 C;  5T8S A;  2UU9 C;  3B7W A;  3A9V A;  1NYE A;  4JV5 C;  1XHJ A;  2P2B A;  4NXM C;  1ML8 A;  1BA3 A;  1KKG A;  1XS3 A;  3PBK A;  4BC7 A;  4GXQ A;  4D56 A;  4EAT A;  5LMN C;  2CU6 A;  4WV3 A;  1AMU A;  3VNS A;  3CQ1 A;  4K0B A;  4JM1 A;  3NYR A;  4FUQ A;  3UZ0 A;  4BBY A;  3R9W A;  1IBK C;  3CQ3 A;  1FLO A;  4KHP C;  4B3M C;  4JYA C;  5BSR A;  2VSQ A;  1XNR C;  3AY0 A;  1XRA A;  4PUI A;  4L7I A;  4K0K C;  4LFC C;  5BUQ A;  5IWA C;  3RV2 A;  3NYQ A;  3J81 D;  4KTV A;  3ETC A;  2P2F A;  2Y4N A;  4KTT A;  3J80 D;  4LF6 C;  4JI7 C;  2BJO A;  2PRO A;  1GPM A;  1MDB A;  3VNQ A;  2E0G A;  3GR0 A;  4DR2 C;  4FUT A;  4G1I A;  1LQL A;  4DV2 C;  3H2T A;  3IEV A;  5K8F A;  4RM2 A;  1VLA A;  2UUA C;  1PU1 A;  4GKK C;  1NY8 A;  5E7Q A;  3FCC A;  3S82 A;  2OPL B;  3T1H C;  1YJ7 A;  2PN2 A;  4R1L A;  2BH1 X;  2D1R A;  2OO4 A;  5T8T A;  4PUG A;  5A19 A;  3K6R A;  4MTN A;  4JI1 C;  1T5D X;  2QVZ X;  5LMU C;  4GKJ C;  4BCA A;  1XRB A;  3N54 B;  4OX9 C;  1V25 A;  2UXC C;  1I94 C;  3IML A;  5BSV A;  2UXD C;  1XNQ C;  3UX2 A;  4LF9 C;  1O90 A;  3C5E A;  4D4I A;  4DV6 C;  3A26 A;  3LGX A;  5FLX D;  1ZB9 A;  4I9F A;  4GS5 A;  1M6X C;  3CQ2 A;  4G36 A;  4DR7 C;  4DV4 C;  1PG3 A;  1VEH A;  3OTO C;  1HR0 C;  2HHH C;  5BSM A;  1MKY A;  4B3R C;  2JMP A;  4JI5 C;  1MXA A;  2VQF C;  4PHT A;  4RM3 A;  4RLQ A;  3EER A;  2PT7 G;  3G7S A;  1USP B; 
#chains in the Genus database with same CATH homology
 1WH9 A;  1XMO C;  1FJG C;  4MH4 A;  4LF8 C;  2UUC C;  3EQ6 A;  4LF7 C;  4FTF A;  4DCU A;  4DG8 A;  1USP A;  1MD9 A;  2OPL A;  1QWI A;  2Y4O A;  2VZE A;  3PES A;  1RG9 A;  2V7B A;  2ASB A;  5AE2 A;  4RVN A;  1XRC A;  4YHH C;  1WF3 A;  4DR1 C;  4PRO C;  2P02 A;  2YCB A;  3A4I A;  2CY1 A;  3IPL A;  4DCT A;  2CXC A;  3ETO A;  2D1S A;  4X64 C;  1LCI A;  3FCE A;  4BSZ A;  2ATW A;  1MXC A;  3E7W A;  1MXB A;  3A9U A;  3DAY A;  4D57 A;  4JI3 C;  3LNV A;  4LE5 A;  1N2F A;  2WD9 A;  2P2Q A;  3TQI A;  3I07 A;  4DUZ C;  2D1Q A;  4LFA C;  2VQE C;  5AE1 A;  4G37 A;  4L2Z A;  4B3T C;  1XMQ C;  2P2M A;  5IFI A;  4ISB A;  2D7V A;  5CZV A;  3R9X A;  4AQY C;  2P2J A;  3DHV A;  4R1M A;  2UXB C;  4DR6 C;  5JRH A;  5A1I A;  4I9G A;  1RY2 A;  3RG2 A;  3LUS A;  2E8C A;  3LAX A;  4L4Q A;  3R44 A;  1N33 C;  3VNR A;  4ZJZ A;  4DV5 C;  1ULT A;  4WS9 A;  3CW9 A;  4DR4 C;  2QVY X;  4LF5 C;  4GXR A;  3I08 A;  4DCS A;  2YWB A;  2QL8 A;  3E7X A;  1K0R A;  3N2Q A;  2UUB C;  1N32 C;  3GR1 A;  1L2F A;  1J5E C;  4XX2 A;  2Y27 A;  5KEI A;  2KZF A;  1N36 C;  5A1G A;  4DV1 C;  5ADZ A;  4DV3 C;  1V26 A;  1HNX C;  4JI8 C;  4JI0 C;  3JAM D;  4X65 C;  5BSW A;  4PZP A;  4U5Y D;  2QVX X;  4JI6 C;  2F4V C;  4JI2 C;  4D4G A;  5BST A;  4DG9 A;  4NXN C;  2OBV A;  5CZX A;  5KYV A;  5KYT A;  3TUF A;  5BR8 C;  2YWC A;  4X66 C;  5AE3 A;  1MDF A;  2D28 C;  4DUY C;  3KXW A;  4RMN A;  2DYJ A;  1T5H X;  5BUR A;  3UOW A;  1HNW C;  1N34 C;  2E7G A;  1P7L A;  5BSU A;  3CJE A;  1O93 A;  1HNZ C;  4LF4 C;  3L8C A;  1PA4 A;  4OYC A;  2E8F A;  1ZB8 A;  2E8E A;  2D27 A;  4B3S C;  4DV0 C;  4IR7 A;  1FUG A;  2E5L C;  2D1T A;  4IZ6 A;  1UKK A;  3NPD A;  3DLP X;  3PRO C;  4ZLP A;  2DPL A;  1O92 A;  4X62 C;  1JOS A;  1HH2 P;  1O9T A;  1IBL C;  3GKU A;  3AF5 A;  1PG4 A;  2QW0 X;  4RLF A;  1QM4 A;  5K85 A;  4DCV A;  4RVO A;  4DR3 C;  5H9U A;  2HJG A;  4YY3 C;  1IBM C;  2AYA A;  2EGT A;  3SO4 A;  4BC9 A;  3IEU A;  4R0M A;  3GPC A;  3T1Y C;  3NI2 A;  1EGA A;  4OXI A;  2WP0 C;  5DV9 A;  4HPV A;  3AF6 A;  3L95 X;  2ZM6 C;  3TDE A;  4LFB C;  2XR1 A;  2P20 A;  3CW8 X;  4NOZ A;  4TPS B;  4ODJ A;  5GTD A;  4DR5 C;  5BUS A;  2ONF A;  4DV7 C;  5A2Q D;  4NDN A;  5IT9 D;  4JI4 C;  5T8S A;  2UU9 C;  3B7W A;  3A9V A;  1NYE A;  4JV5 C;  2P2B A;  4NXM C;  1ML8 A;  1BA3 A;  1KKG A;  3PBK A;  4BC7 A;  4GXQ A;  4D56 A;  4EAT A;  5LMN C;  4WV3 A;  1AMU A;  3VNS A;  4K0B A;  4JM1 A;  3NYR A;  4FUQ A;  3UZ0 A;  4BBY A;  3R9W A;  1IBK C;  4KHP C;  4B3M C;  4JYA C;  5BSR A;  2VSQ A;  1XNR C;  1XRA A;  4K0K C;  4L7I A;  4LFC C;  5BUQ A;  5IWA C;  3RV2 A;  3NYQ A;  3J81 D;  4KTV A;  3ETC A;  2P2F A;  2Y4N A;  4KTT A;  3J80 D;  4LF6 C;  4JI7 C;  2BJO A;  2PRO A;  1GPM A;  1MDB A;  3VNQ A;  2E0G A;  3GR0 A;  4DR2 C;  4FUT A;  4G1I A;  1LQL A;  4DV2 C;  3H2T A;  3IEV A;  5K8F A;  4RM2 A;  1VLA A;  2UUA C;  4GKK C;  5E7Q A;  3FCC A;  3S82 A;  2OPL B;  3T1H C;  1YJ7 A;  2PN2 A;  4R1L A;  2BH1 X;  2D1R A;  2OO4 A;  5T8T A;  5A19 A;  4MTN A;  4JI1 C;  1T5D X;  2QVZ X;  5LMU C;  4GKJ C;  4BCA A;  1XRB A;  3N54 B;  4OX9 C;  1V25 A;  2UXC C;  1I94 C;  3IML A;  5BSV A;  2UXD C;  1XNQ C;  4LF9 C;  1O90 A;  3C5E A;  4D4I A;  4DV6 C;  3LGX A;  1ZB9 A;  5FLX D;  4I9F A;  4GS5 A;  4G36 A;  4DR7 C;  4DV4 C;  1PG3 A;  3OTO C;  1HR0 C;  2HHH C;  5BSM A;  1MKY A;  4B3R C;  2JMP A;  4JI5 C;  1MXA A;  2VQF C;  4PHT A;  4RM3 A;  4RLQ A;  3EER A;  2PT7 G;  3G7S A;  1USP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...