5T8SA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
388
structure length
388
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
total genus 137
structure length 388
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA03
1MXBA 3TDEA 4LE5A 2DPLA 3RV2A 1XRBA 5A19A 3IMLA 4L4QA 3TQIA 4HPVA 4KTTA 1O90A 4ODJA 4K0BA 1O93A 4KTVA 2YWCA 1MXCA 1O92A 3UOWA 1O9TA 1GPMA 1XRAA 1FUGA 1XRCA 2OBVA 5T8SA 3A4IA 5T8TA 5A1GA 5A1IA 1P7LA 5H9UA 3S82A 1MXAA 4WS9A 1RG9A 1QM4A 4L7IA 3SO4A 2P02A 4L2ZA 2YWBA 4NDNA
chains in the Genus database with same CATH superfamily
2CU6A 2QL8A 1HR0C 2Y4NA 1HNXC 5KEIA 5DV9A 1O93A 1VLAA 1T5DX 2Y27A 4G1IA 4D4GA 2VQFC 4D56A 3AF6A 1ULTA 2PROA 4LF4C 4L7IA 3GR1A 3C5EA 4LE5A 4L4QA 3UX2A 4XX2A 1WCJA 1XHJA 2E8EA 4GKKC 4LF5C 2UXDC 4B3TC 2UXCC 2PT7G 3RV2A 4I9FA 4LFAC 1N36C 3FCEA 1IBKC 1HH2P 1MXCA 1YJ7A 1QWIA 4GXQA 3B7WA 3UEBA 4JYAC 1M6XC 4K0KC 1O9TA 1N32C 2OBVA 4RM3A 2E0GA 5BUSA 1P7LA 5AE1A 4X65C 2Z51A 4LFCC 2P02A 1MXBA 4RVNA 3IMLA 4JI4C 2P2JA 5LCIA 1O90A 1JOSA 1IBMC 1PA4A 2QVZX 2YWCA 5KYTA 5LMNC 5BUQA 3PROC 4AQYC 4LF7C 4R0MA 1LCIA 1PG4A 3NPDA 4BCAA 2XR1A 2DHMA 4DV0C 4WS9A 4DV1C 3SO4A 1MDBA 2AYAA 5IWAC 4FUTA 1VEHA 4PUGA 4KTTA 3E7WA 1IB8A 4K0BA 3CJEA 2Y4OA 3IPLA 4ZJZA 4I9GA 2VSQA 3J81D 4DCUA 3EQ6A 4YHHC 1XRCA 3TR3A 4DUZC 1V25A 2MM9A 5A1IA 5H9UA 3N54B 2KDNA 4B3RC 3N2QA 1NY8A 2WD9A 4RM2A 1T5HX 1QM4A 5BSUA 4BC9A 3A9VA 1XNQC 4R1MA 3OTOC 3O2EA 4RLFA 1ZB9A 1MKYA 5AE2A 1MDFA 2MCQA 4LF8C 4DR3C 3NI2A 4DV5C 2M5OA 3TDEA 2P2MA 1N34C 2D27A 3RG2A 3LAXA 5BSMA 5KYVA 4DCVA 2KZ0A 1KKGA 4G36A 2JMPA 2UU9C 1MD9A 2ZZMA 3H2TA 4KTVA 2BH1X 1HNZC 4RMNA 3AY0A 2V7BA 2UXBC 4BC7A 3T1YC 4JI2C 1L2FA 3S82A 1V60A 4NXNC 1HNWC 4JI0C 3L8CA 5BSRA 5IFIA 2EGTA 4JV5C 1WH9A 2UUCC 3R9XA 1IBLC 4LF9C 1TH5A 4X62C 2OO4A 3VNSA 2E7GA 1XS3A 2ZM6C 4R1LA 2D7VA 5BSVA 4LF6C 2D1TA 1RY2A 1FJGC 3LNOA 1GPMA 5T8TA 3G7SA 1J5EC 4D57A 2VZEA 2YWBA 3I07A 3VNQA 4DR1C 3FCCA 2UUBC 4HPVA 4DCSA 2NCLA 2PN2A 1P4EA 1BA3A 4DR7C 2P2QA 3UOWA 1USPB 4U5YD 2YCBA 4DV6C 3CW8X 3NYQA 2MMAB 3AF5A 5GTDA 2HHHC 3JAMD 4IR7A 4DR4C 4ZLPA 2DYJA 5LMUC 3IEUA 3GPCA 2DPLA 4GXRA 3TQIA 3R9WA 2D1RA 2QVYX 2E5LC 1N33C 1USPA 4JI1C 1XRAA 4OX9C 3LUSA 4NXMC 1UKKA 1XMOC 3UZ0A 3GKUA 2UUAC 3L95X 4YY3C 5CZXA 5A19A 2VQEC 2HJGA 5E7QA 5JRHA 3ETCA 3DLPX 4MTNA 2ZZNA 5BSTA 2E8CA 2P2FA 4JI6C 3GR0A 2P2BA 4DV4C 1M6XA 4PUIA 2D28C 1UWDA 2JNVA 3LGXA 4NOZA 2ATWA 1K0RA 5T8SA 3A4IA 4JI3C 4RLQA 3CQ3A 1MXAA 4TPSB 4ISBA 3EERA 3UX3A 1ML8A 4FUQA 3NYRA 4DV2C 4JM1A 3KXWA 4JI7C 4PHTA 4PUHA 4D4IA 3CW9A 4RVOA 4BBYA 5K85A 5FLXD 1LQLA 5K8FA 4DG8A 1WF3A 1N2FA 5AE3A 2ASBA 1O92A 1PU1A 3T1HC 3IEVA 3CQ1A 2QVXX 4X66C 4DG9A 4GS5A 2YX1A 2OPLB 3E7XA 1V26A 4L2ZA 4OYCA 4NDNA 4DV3C 2ONFA 2P20A 1PG3A 4DV7C 2F4VC 3PESA 3I08A 2D1SA 5CZVA 4ODJA 5IT9D 3TUFA 4OXIA 4FTFA 4PROC 4JI8C 2CXCA 1XNRC 2E8FA 2OPLA 4GKJC 4MH4A 3DHVA 3ETOA 4BSZA 2QW0X 4LFBC 1XRBA 4JI5C 1EGAA 1FLOA 3J80D 1XMQC 5BSWA 3LNVA 4B3SC 4KHPC 5A1GA 3K6RA 4IZ6A 1I94C 5ADZA 2CY1A 1NYEA 4EATA 3PBKA 5BR8C 3VNRA 3CQ2A 4PZPA 5A2QD 4DUYC 3A9UA 4G37A 1ZB8A 4DR5C 3DAYA 3R44A 3A26A 3A25A 2D1QA 4DR2C 4DR6C 4WV3A 1FUGA 5BURA 2WP0C 1P4EC 4X64C 4B3MC 2BJOA 2M5HA 1RG9A 4DCTA 2KZFA 1AMUA
chains in the Genus database with same CATH topology
2QL8A 1HR0C 2Y4NA 1HNXC 5KEIA 5DV9A 1O93A 1VLAA 1T5DX 2Y27A 4G1IA 4D4GA 2VQFC 4D56A 3AF6A 1ULTA 2PROA 4LF4C 4L7IA 3GR1A 3C5EA 4LE5A 4L4QA 4XX2A 2E8EA 4GKKC 4LF5C 2UXDC 4B3TC 2UXCC 2PT7G 3RV2A 4I9FA 4LFAC 1N36C 3FCEA 1IBKC 1HH2P 1MXCA 1YJ7A 1QWIA 4GXQA 3B7WA 4JYAC 4K0KC 1O9TA 1N32C 2OBVA 4RM3A 2E0GA 5BUSA 1P7LA 5AE1A 4X65C 4LFCC 2P02A 1MXBA 4RVNA 3IMLA 4JI4C 2P2JA 1O90A 1JOSA 1IBMC 1PA4A 2QVZX 2YWCA 5KYTA 5LMNC 5BUQA 3PROC 4AQYC 4LF7C 4R0MA 1LCIA 1PG4A 3NPDA 4BCAA 2XR1A 4DV0C 4WS9A 4DV1C 3SO4A 1MDBA 2AYAA 5IWAC 4FUTA 4KTTA 3E7WA 4K0BA 3CJEA 2Y4OA 3IPLA 4ZJZA 4I9GA 2VSQA 3J81D 4DCUA 3EQ6A 4YHHC 1XRCA 4DUZC 1V25A 5A1IA 5H9UA 3N54B 4B3RC 3N2QA 2WD9A 4RM2A 1T5HX 1QM4A 5BSUA 4BC9A 3A9VA 1XNQC 4R1MA 3OTOC 4RLFA 1ZB9A 1MKYA 5AE2A 1MDFA 4LF8C 4DR3C 3NI2A 4DV5C 3TDEA 1N34C 2P2MA 2D27A 3RG2A 3LAXA 5BSMA 5KYVA 4DCVA 1KKGA 4G36A 2JMPA 2UU9C 1MD9A 3H2TA 4KTVA 2BH1X 1HNZC 4RMNA 2V7BA 2UXBC 4BC7A 3T1YC 4JI2C 1L2FA 3S82A 4NXNC 1HNWC 4JI0C 3L8CA 5BSRA 5IFIA 2EGTA 4JV5C 1WH9A 2UUCC 3R9XA 1IBLC 4LF9C 4X62C 2OO4A 3VNSA 2E7GA 2ZM6C 4R1LA 2D7VA 5BSVA 4LF6C 2D1TA 1RY2A 1FJGC 1GPMA 5T8TA 3G7SA 1J5EC 4D57A 2VZEA 2YWBA 3I07A 3VNQA 4DR1C 3FCCA 2UUBC 4HPVA 4DCSA 2PN2A 1BA3A 4DR7C 2P2QA 3UOWA 1USPB 4U5YD 2YCBA 4DV6C 3CW8X 3NYQA 3AF5A 5GTDA 2HHHC 3JAMD 4IR7A 4DR4C 4ZLPA 2DYJA 5LMUC 3IEUA 3GPCA 2DPLA 4GXRA 3TQIA 3R9WA 2D1RA 2QVYX 2E5LC 1N33C 1USPA 4JI1C 1XRAA 4OX9C 3LUSA 4NXMC 1UKKA 1XMOC 3UZ0A 3GKUA 2UUAC 3L95X 4YY3C 5CZXA 5A19A 2VQEC 2HJGA 5E7QA 5JRHA 3ETCA 3DLPX 4MTNA 5BSTA 2E8CA 2P2FA 4JI6C 3GR0A 2P2BA 4DV4C 2D28C 3LGXA 4NOZA 2ATWA 1K0RA 5T8SA 3A4IA 4JI3C 4RLQA 1MXAA 4TPSB 4ISBA 3EERA 1ML8A 4FUQA 3NYRA 4DV2C 4JM1A 3KXWA 4JI7C 4PHTA 4D4IA 3CW9A 4RVOA 4BBYA 5K85A 5FLXD 1LQLA 5K8FA 4DG8A 1WF3A 1N2FA 5AE3A 2ASBA 1O92A 3T1HC 3IEVA 2QVXX 4X66C 4DG9A 4GS5A 2OPLB 3E7XA 1V26A 4L2ZA 4OYCA 4NDNA 4DV3C 2ONFA 2P20A 1PG3A 4DV7C 2F4VC 3PESA 3I08A 2D1SA 5CZVA 4ODJA 5IT9D 3TUFA 4OXIA 4FTFA 4PROC 4JI8C 2CXCA 1XNRC 2E8FA 2OPLA 4GKJC 4MH4A 3DHVA 3ETOA 4BSZA 2QW0X 4LFBC 1XRBA 4JI5C 1EGAA 3J80D 1XMQC 5BSWA 3LNVA 4B3SC 4KHPC 5A1GA 4IZ6A 1I94C 5ADZA 2CY1A 1NYEA 4EATA 3PBKA 5BR8C 3VNRA 4PZPA 5A2QD 4DUYC 3A9UA 4G37A 1ZB8A 4DR5C 3DAYA 3R44A 2D1QA 4DR2C 4DR6C 4WV3A 1FUGA 5BURA 2WP0C 4X64C 4B3MC 2BJOA 1RG9A 4DCTA 2KZFA 1AMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXB A;  3TDE A;  4LE5 A;  2DPL A;  3RV2 A;  1XRB A;  5A19 A;  3IML A;  4L4Q A;  3TQI A;  4HPV A;  4KTT A;  1O90 A;  4ODJ A;  4K0B A;  1O93 A;  4KTV A;  2YWC A;  1MXC A;  1O92 A;  3UOW A;  1O9T A;  1GPM A;  1XRA A;  1FUG A;  1XRC A;  2OBV A;  5T8S A;  3A4I A;  5T8T A;  5A1G A;  5A1I A;  1P7L A;  5H9U A;  3S82 A;  1MXA A;  4WS9 A;  1RG9 A;  1QM4 A;  4L7I A;  3SO4 A;  2P02 A;  4L2Z A;  2YWB A;  4NDN A; 
#chains in the Genus database with same CATH topology
 2CU6 A;  2QL8 A;  1HR0 C;  2Y4N A;  1HNX C;  5KEI A;  5DV9 A;  1O93 A;  1VLA A;  1T5D X;  2Y27 A;  4G1I A;  4D4G A;  2VQF C;  4D56 A;  3AF6 A;  1ULT A;  2PRO A;  4LF4 C;  4L7I A;  3GR1 A;  3C5E A;  4LE5 A;  4L4Q A;  3UX2 A;  4XX2 A;  1WCJ A;  1XHJ A;  2E8E A;  4GKK C;  4LF5 C;  2UXD C;  4B3T C;  2UXC C;  2PT7 G;  3RV2 A;  4I9F A;  4LFA C;  1N36 C;  3FCE A;  1IBK C;  1HH2 P;  1MXC A;  1YJ7 A;  1QWI A;  4GXQ A;  3B7W A;  3UEB A;  4JYA C;  1M6X C;  4K0K C;  1O9T A;  1N32 C;  2OBV A;  4RM3 A;  2E0G A;  5BUS A;  1P7L A;  5AE1 A;  4X65 C;  2Z51 A;  4LFC C;  2P02 A;  1MXB A;  4RVN A;  3IML A;  4JI4 C;  2P2J A;  5LCI A;  1O90 A;  1JOS A;  1IBM C;  1PA4 A;  2QVZ X;  2YWC A;  5KYT A;  5LMN C;  5BUQ A;  3PRO C;  4AQY C;  4LF7 C;  4R0M A;  1LCI A;  1PG4 A;  3NPD A;  4BCA A;  2XR1 A;  2DHM A;  4DV0 C;  4WS9 A;  4DV1 C;  3SO4 A;  1MDB A;  2AYA A;  5IWA C;  4FUT A;  1VEH A;  4PUG A;  4KTT A;  3E7W A;  1IB8 A;  4K0B A;  3CJE A;  2Y4O A;  3IPL A;  4ZJZ A;  4I9G A;  2VSQ A;  3J81 D;  4DCU A;  3EQ6 A;  4YHH C;  1XRC A;  3TR3 A;  4DUZ C;  1V25 A;  2MM9 A;  5A1I A;  5H9U A;  3N54 B;  2KDN A;  4B3R C;  3N2Q A;  1NY8 A;  2WD9 A;  4RM2 A;  1T5H X;  1QM4 A;  5BSU A;  4BC9 A;  3A9V A;  1XNQ C;  4R1M A;  3OTO C;  3O2E A;  4RLF A;  1ZB9 A;  1MKY A;  5AE2 A;  1MDF A;  2MCQ A;  4LF8 C;  4DR3 C;  3NI2 A;  4DV5 C;  2M5O A;  3TDE A;  2P2M A;  1N34 C;  2D27 A;  3RG2 A;  3LAX A;  5BSM A;  5KYV A;  4DCV A;  2KZ0 A;  1KKG A;  4G36 A;  2JMP A;  2UU9 C;  1MD9 A;  2ZZM A;  3H2T A;  4KTV A;  2BH1 X;  1HNZ C;  4RMN A;  3AY0 A;  2V7B A;  2UXB C;  4BC7 A;  3T1Y C;  4JI2 C;  1L2F A;  3S82 A;  1V60 A;  4NXN C;  1HNW C;  4JI0 C;  3L8C A;  5BSR A;  5IFI A;  2EGT A;  4JV5 C;  1WH9 A;  2UUC C;  3R9X A;  1IBL C;  4LF9 C;  1TH5 A;  4X62 C;  2OO4 A;  3VNS A;  2E7G A;  1XS3 A;  2ZM6 C;  4R1L A;  2D7V A;  5BSV A;  4LF6 C;  2D1T A;  1RY2 A;  1FJG C;  3LNO A;  1GPM A;  5T8T A;  3G7S A;  1J5E C;  4D57 A;  2VZE A;  2YWB A;  3I07 A;  3VNQ A;  4DR1 C;  3FCC A;  2UUB C;  4HPV A;  4DCS A;  2NCL A;  2PN2 A;  1P4E A;  1BA3 A;  4DR7 C;  2P2Q A;  3UOW A;  1USP B;  4U5Y D;  2YCB A;  4DV6 C;  3CW8 X;  3NYQ A;  2MMA B;  3AF5 A;  5GTD A;  2HHH C;  3JAM D;  4IR7 A;  4DR4 C;  4ZLP A;  2DYJ A;  5LMU C;  3IEU A;  3GPC A;  2DPL A;  4GXR A;  3TQI A;  3R9W A;  2D1R A;  2QVY X;  2E5L C;  1N33 C;  1USP A;  4JI1 C;  1XRA A;  4OX9 C;  3LUS A;  4NXM C;  1UKK A;  1XMO C;  3UZ0 A;  3GKU A;  2UUA C;  3L95 X;  4YY3 C;  5CZX A;  5A19 A;  2VQE C;  2HJG A;  5E7Q A;  5JRH A;  3ETC A;  3DLP X;  4MTN A;  2ZZN A;  5BST A;  2E8C A;  2P2F A;  4JI6 C;  3GR0 A;  2P2B A;  4DV4 C;  1M6X A;  4PUI A;  2D28 C;  1UWD A;  2JNV A;  3LGX A;  4NOZ A;  2ATW A;  1K0R A;  5T8S A;  3A4I A;  4JI3 C;  4RLQ A;  3CQ3 A;  1MXA A;  4TPS B;  4ISB A;  3EER A;  3UX3 A;  1ML8 A;  4FUQ A;  3NYR A;  4DV2 C;  4JM1 A;  3KXW A;  4JI7 C;  4PHT A;  4PUH A;  4D4I A;  3CW9 A;  4RVO A;  4BBY A;  5K85 A;  5FLX D;  1LQL A;  5K8F A;  4DG8 A;  1WF3 A;  1N2F A;  5AE3 A;  2ASB A;  1O92 A;  1PU1 A;  3T1H C;  3IEV A;  3CQ1 A;  2QVX X;  4X66 C;  4DG9 A;  4GS5 A;  2YX1 A;  2OPL B;  3E7X A;  1V26 A;  4L2Z A;  4OYC A;  4NDN A;  4DV3 C;  2ONF A;  2P20 A;  1PG3 A;  4DV7 C;  2F4V C;  3PES A;  3I08 A;  2D1S A;  5CZV A;  4ODJ A;  5IT9 D;  3TUF A;  4OXI A;  4FTF A;  4PRO C;  4JI8 C;  2CXC A;  1XNR C;  2E8F A;  2OPL A;  4GKJ C;  4MH4 A;  3DHV A;  3ETO A;  4BSZ A;  2QW0 X;  4LFB C;  1XRB A;  4JI5 C;  1EGA A;  1FLO A;  3J80 D;  1XMQ C;  5BSW A;  3LNV A;  4B3S C;  4KHP C;  5A1G A;  3K6R A;  4IZ6 A;  1I94 C;  5ADZ A;  2CY1 A;  1NYE A;  4EAT A;  3PBK A;  5BR8 C;  3VNR A;  3CQ2 A;  4PZP A;  5A2Q D;  4DUY C;  3A9U A;  4G37 A;  1ZB8 A;  4DR5 C;  3DAY A;  3R44 A;  3A26 A;  3A25 A;  2D1Q A;  4DR2 C;  4DR6 C;  4WV3 A;  1FUG A;  5BUR A;  2WP0 C;  1P4E C;  4X64 C;  4B3M C;  2BJO A;  2M5H A;  1RG9 A;  4DCT A;  2KZF A;  1AMU A; 
#chains in the Genus database with same CATH homology
 2QL8 A;  1HR0 C;  2Y4N A;  1HNX C;  5KEI A;  5DV9 A;  1O93 A;  1VLA A;  1T5D X;  2Y27 A;  4G1I A;  4D4G A;  2VQF C;  4D56 A;  3AF6 A;  1ULT A;  2PRO A;  4LF4 C;  4L7I A;  3GR1 A;  3C5E A;  4LE5 A;  4L4Q A;  4XX2 A;  2E8E A;  4GKK C;  4LF5 C;  2UXD C;  4B3T C;  2UXC C;  2PT7 G;  3RV2 A;  4I9F A;  4LFA C;  1N36 C;  3FCE A;  1IBK C;  1HH2 P;  1MXC A;  1YJ7 A;  1QWI A;  4GXQ A;  3B7W A;  4JYA C;  4K0K C;  1O9T A;  1N32 C;  2OBV A;  4RM3 A;  2E0G A;  5BUS A;  1P7L A;  5AE1 A;  4X65 C;  4LFC C;  2P02 A;  1MXB A;  4RVN A;  3IML A;  4JI4 C;  2P2J A;  1O90 A;  1JOS A;  1IBM C;  1PA4 A;  2QVZ X;  2YWC A;  5KYT A;  5LMN C;  5BUQ A;  3PRO C;  4AQY C;  4LF7 C;  4R0M A;  1LCI A;  1PG4 A;  3NPD A;  4BCA A;  2XR1 A;  4DV0 C;  4WS9 A;  4DV1 C;  3SO4 A;  1MDB A;  2AYA A;  5IWA C;  4FUT A;  4KTT A;  3E7W A;  4K0B A;  3CJE A;  2Y4O A;  3IPL A;  4ZJZ A;  4I9G A;  2VSQ A;  3J81 D;  4DCU A;  3EQ6 A;  4YHH C;  1XRC A;  4DUZ C;  1V25 A;  5A1I A;  5H9U A;  3N54 B;  4B3R C;  3N2Q A;  2WD9 A;  4RM2 A;  1T5H X;  1QM4 A;  5BSU A;  4BC9 A;  3A9V A;  1XNQ C;  4R1M A;  3OTO C;  4RLF A;  1ZB9 A;  1MKY A;  5AE2 A;  1MDF A;  4LF8 C;  4DR3 C;  3NI2 A;  4DV5 C;  3TDE A;  1N34 C;  2P2M A;  2D27 A;  3RG2 A;  3LAX A;  5BSM A;  5KYV A;  4DCV A;  1KKG A;  4G36 A;  2JMP A;  2UU9 C;  1MD9 A;  3H2T A;  4KTV A;  2BH1 X;  1HNZ C;  4RMN A;  2V7B A;  2UXB C;  4BC7 A;  3T1Y C;  4JI2 C;  1L2F A;  3S82 A;  4NXN C;  1HNW C;  4JI0 C;  3L8C A;  5BSR A;  5IFI A;  2EGT A;  4JV5 C;  1WH9 A;  2UUC C;  3R9X A;  1IBL C;  4LF9 C;  4X62 C;  2OO4 A;  3VNS A;  2E7G A;  2ZM6 C;  4R1L A;  2D7V A;  5BSV A;  4LF6 C;  2D1T A;  1RY2 A;  1FJG C;  1GPM A;  5T8T A;  3G7S A;  1J5E C;  4D57 A;  2VZE A;  2YWB A;  3I07 A;  3VNQ A;  4DR1 C;  3FCC A;  2UUB C;  4HPV A;  4DCS A;  2PN2 A;  1BA3 A;  4DR7 C;  2P2Q A;  3UOW A;  1USP B;  4U5Y D;  2YCB A;  4DV6 C;  3CW8 X;  3NYQ A;  3AF5 A;  5GTD A;  2HHH C;  3JAM D;  4IR7 A;  4DR4 C;  4ZLP A;  2DYJ A;  5LMU C;  3IEU A;  3GPC A;  2DPL A;  4GXR A;  3TQI A;  3R9W A;  2D1R A;  2QVY X;  2E5L C;  1N33 C;  1USP A;  4JI1 C;  1XRA A;  4OX9 C;  3LUS A;  4NXM C;  1UKK A;  1XMO C;  3UZ0 A;  3GKU A;  2UUA C;  3L95 X;  4YY3 C;  5CZX A;  5A19 A;  2VQE C;  2HJG A;  5E7Q A;  5JRH A;  3ETC A;  3DLP X;  4MTN A;  5BST A;  2E8C A;  2P2F A;  4JI6 C;  3GR0 A;  2P2B A;  4DV4 C;  2D28 C;  3LGX A;  4NOZ A;  2ATW A;  1K0R A;  5T8S A;  3A4I A;  4JI3 C;  4RLQ A;  1MXA A;  4TPS B;  4ISB A;  3EER A;  1ML8 A;  4FUQ A;  3NYR A;  4DV2 C;  4JM1 A;  3KXW A;  4JI7 C;  4PHT A;  4D4I A;  3CW9 A;  4RVO A;  4BBY A;  5K85 A;  5FLX D;  1LQL A;  5K8F A;  4DG8 A;  1WF3 A;  1N2F A;  5AE3 A;  2ASB A;  1O92 A;  3T1H C;  3IEV A;  2QVX X;  4X66 C;  4DG9 A;  4GS5 A;  2OPL B;  3E7X A;  1V26 A;  4L2Z A;  4OYC A;  4NDN A;  4DV3 C;  2ONF A;  2P20 A;  1PG3 A;  4DV7 C;  2F4V C;  3PES A;  3I08 A;  2D1S A;  5CZV A;  4ODJ A;  5IT9 D;  3TUF A;  4OXI A;  4FTF A;  4PRO C;  4JI8 C;  2CXC A;  1XNR C;  2E8F A;  2OPL A;  4GKJ C;  4MH4 A;  3DHV A;  3ETO A;  4BSZ A;  2QW0 X;  4LFB C;  1XRB A;  4JI5 C;  1EGA A;  3J80 D;  1XMQ C;  5BSW A;  3LNV A;  4B3S C;  4KHP C;  5A1G A;  4IZ6 A;  1I94 C;  5ADZ A;  2CY1 A;  1NYE A;  4EAT A;  3PBK A;  5BR8 C;  3VNR A;  4PZP A;  5A2Q D;  4DUY C;  3A9U A;  4G37 A;  1ZB8 A;  4DR5 C;  3DAY A;  3R44 A;  2D1Q A;  4DR2 C;  4DR6 C;  4WV3 A;  1FUG A;  5BUR A;  2WP0 C;  4X64 C;  4B3M C;  2BJO A;  1RG9 A;  4DCT A;  2KZF A;  1AMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...