5T8SA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
388
structure length
388
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthase
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
total genus 137
structure length 388
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA03
4KTVA 1O92A 1XRAA 4L4QA 1MXBA 1XRBA 4HPVA 4L2ZA 3IMLA 4WS9A 1XRCA 3S82A 4LE5A 5H9UA 5A1IA 3TDEA 1QM4A 1FUGA 1O90A 4NDNA 2YWBA 5T8SA 2OBVA 1MXCA 3SO4A 1O9TA 2YWCA 2DPLA 4KTTA 1P7LA 5A19A 1RG9A 4K0BA 4L7IA 1GPMA 3RV2A 5A1GA 4ODJA 1O93A 2P02A 3TQIA 5T8TA 3UOWA 3A4IA 1MXAA
chains in the Genus database with same CATH superfamily
1QWIA 3L8CA 5BUSA 4MTNA 2D1SA 2WP0C 4ZLPA 1XRCA 1ZB8A 3S82A 2MMAB 3A26A 4RLQA 1M6XA 1XNRC 1YJ7A 3UEBA 4X62C 1HNXC 1V25A 4YY3C 3I07A 2UUAC 2CXCA 4XX2A 3RV2A 2Y4OA 4ODJA 3R9WA 1RY2A 4BCAA 1IBKC 4DG8A 1IB8A 2VSQA 4LF5C 3FCCA 4BC9A 3ETOA 4LF8C 3DAYA 2PN2A 4RVOA 4EATA 3TDEA 4D4GA 2ZZMA 5T8SA 1MXCA 1XMQC 5A2QD 1T5DX 2P20A 2V7BA 1HNZC 5AE3A 1UKKA 4FUTA 3VNRA 1IBLC 1KKGA 4NXMC 4DV2C 3AF6A 4OX9C 1AMUA 1MKYA 4K0KC 1FLOA 2YWBA 3TUFA 4LFBC 2AYAA 2D7VA 3VNSA 4JI4C 2DPLA 4RLFA 3TR3A 3T1HC 1MDBA 2D1RA 5AE2A 5T8TA 4BBYA 3E7WA 1K0RA 3CQ3A 3LGXA 1MXBA 5IFIA 2P2QA 2HHHC 1XS3A 4GXRA 3AY0A 3PESA 2UUCC 5E7QA 4BSZA 1PA4A 2P2FA 4DR2C 4DV3C 4PROC 3KXWA 4RM3A 3PROC 4YHHC 2Y27A 3GR1A 1M6XC 4JI2C 2P2BA 1PU1A 1XRBA 5BR8C 1MDFA 5H9UA 4R0MA 3UX2A 5BSVA 2ASBA 1XHJA 5LCIA 3FCEA 4RM2A 3EERA 3VNQA 4I9GA 4R1LA 4PHTA 4FTFA 4U5YD 1N32C 4JV5C 4B3SC 1O93A 3PBKA 3UOWA 2QW0X 4L4QA 2KZ0A 1VEHA 4NOZA 1WF3A 1QM4A 1LQLA 4MH4A 3RG2A 2YWCA 4PUIA 2D28C 2QVYX 5DV9A 2M5OA 3I08A 3A9UA 4TPSB 2ZZNA 5BSRA 1TH5A 2ATWA 1VLAA 1HR0C 1NY8A 4DV0C 1EGAA 5K85A 2E8EA 2KDNA 3G7SA 3IPLA 3IEUA 3GKUA 5A19A 1RG9A 1N34C 5A1GA 3J81D 1HH2P 2P02A 3NPDA 1MXAA 4KTVA 1XRAA 4WS9A 3IMLA 4LF6C 4LF9C 1ZB9A 2UUBC 3K6RA 3OTOC 1O90A 1PG3A 5ADZA 2JMPA 3E7XA 3DLPX 2JNVA 1V60A 2E0GA 2PT7G 1P7LA 2PROA 3A25A 4LF7C 2OPLA 1N36C 4D4IA 1NYEA 4DUYC 5KEIA 5CZVA 3R9XA 3O2EA 3L95X 4FUQA 4JI8C 4KHPC 5JRHA 4DR1C 2OPLB 4DCVA 2OO4A 3LNVA 4WV3A 5BURA 3N54B 1WH9A 4DR7C 2E8CA 4IZ6A 4DR3C 3R44A 1N33C 2UXBC 5BSTA 5BSMA 2D1TA 3TQIA 2Y4NA 4B3TC 3AF5A 1L2FA 2KZFA 2UXDC 2DHMA 3J80D 1I94C 5LMNC 2MM9A 4B3RC 4JI1C 5KYVA 4LFCC 2QL8A 4JI3C 4RMNA 3IEVA 1ML8A 4DV7C 5BSWA 4JI7C 4JI6C 4GKJC 4ISBA 2D1QA 3DHVA 4I9FA 4DV5C 4DV6C 4X64C 2QVZX 1WCJA 3UX3A 2D27A 4IR7A 5K8FA 4DUZC 4DR6C 3SO4A 2E7GA 2UXCC 3LAXA 2P2JA 1P4EA 1ULTA 3NYRA 2EGTA 4JM1A 1O92A 4GS5A 4DV4C 1J5EC 4HPVA 2BJOA 2E8FA 1V26A 5IWAC 5IT9D 1MD9A 1FUGA 2HJGA 5KYTA 4NDNA 2NCLA 3NI2A 2XR1A 1USPA 3GPCA 4RVNA 4DCTA 4KTTA 4DG9A 4DCUA 4DV1C 1JOSA 2E5LC 4BC7A 4DR5C 1USPB 4AQYC 4L2ZA 4LF4C 4LE5A 5A1IA 2DYJA 4D56A 4PUGA 4DCSA 3GR0A 4ZJZA 4D57A 4G1IA 1FJGC 4K0BA 4G37A 3LNOA 3CQ2A 4JI0C 4JYAC 1HNWC 4B3MC 4JI5C 4NXNC 5FLXD 4PZPA 4OXIA 1XNQC 4GKKC 2YCBA 3A9VA 5BUQA 2CY1A 2VQEC 2ONFA 3JAMD 1GPMA 5BSUA 1N2FA 2WD9A 3LUSA 4DR4C 5AE1A 4R1MA 4X66C 1P4EC 2QVXX 3CQ1A 3N2QA 1LCIA 2CU6A 4OYCA 1O9TA 1PG4A 3CW9A 4PUHA 3B7WA 1T5HX 2YX1A 2M5HA 5CZXA 1UWDA 3H2TA 4LFAC 4X65C 2Z51A 2MCQA 2F4VC 3UZ0A 2UU9C 3CJEA 3C5EA 4GXQA 3EQ6A 2OBVA 1BA3A 4G36A 5GTDA 3NYQA 3T1YC 1XMOC 5LMUC 3ETCA 4L7IA 3CW8X 2ZM6C 3A4IA 2VZEA 2VQFC 1IBMC 2BH1X 2P2MA
chains in the Genus database with same CATH topology
1QWIA 3L8CA 5BUSA 4MTNA 2D1SA 2WP0C 4ZLPA 1XRCA 1ZB8A 3S82A 4RLQA 1XNRC 1YJ7A 4X62C 1HNXC 1V25A 4YY3C 3I07A 2UUAC 2CXCA 4XX2A 3RV2A 2Y4OA 4ODJA 3R9WA 1RY2A 4BCAA 1IBKC 4DG8A 4LF5C 2VSQA 3FCCA 4BC9A 3ETOA 4LF8C 3DAYA 2PN2A 4RVOA 4EATA 3TDEA 4D4GA 5T8SA 1MXCA 1XMQC 5A2QD 1T5DX 2P20A 2V7BA 1HNZC 5AE3A 1UKKA 4FUTA 3VNRA 1IBLC 1KKGA 4NXMC 4DV2C 3AF6A 4OX9C 1AMUA 1MKYA 4K0KC 2YWBA 3TUFA 4LFBC 2AYAA 2D7VA 3VNSA 4JI4C 2DPLA 4RLFA 3T1HC 1MDBA 2D1RA 5AE2A 5T8TA 4BBYA 3E7WA 1K0RA 3LGXA 1MXBA 5IFIA 2P2QA 2HHHC 4GXRA 3PESA 2UUCC 5E7QA 4BSZA 1PA4A 2P2FA 4DR2C 4DV3C 4PROC 3KXWA 4RM3A 3PROC 4YHHC 2Y27A 3GR1A 4JI2C 2P2BA 1XRBA 5BR8C 1MDFA 5H9UA 4R0MA 5BSVA 2ASBA 3FCEA 4RM2A 3EERA 3VNQA 4I9GA 4R1LA 4PHTA 4FTFA 4U5YD 1N32C 4JV5C 4B3SC 1O93A 3PBKA 3UOWA 2QW0X 4L4QA 4NOZA 1WF3A 1QM4A 1LQLA 4MH4A 3RG2A 2YWCA 2D28C 2QVYX 5DV9A 3I08A 3A9UA 4TPSB 5BSRA 2ATWA 1VLAA 1HR0C 4DV0C 1EGAA 5K85A 2E8EA 3G7SA 3IPLA 3IEUA 3GKUA 5A19A 1RG9A 1N34C 5A1GA 3J81D 1HH2P 2P02A 3NPDA 1MXAA 4KTVA 1XRAA 4WS9A 3IMLA 4LF6C 4LF9C 1ZB9A 2UUBC 3OTOC 1O90A 1PG3A 5ADZA 2JMPA 3E7XA 3DLPX 2E0GA 2PT7G 1P7LA 2PROA 4LF7C 2OPLA 1N36C 4D4IA 1NYEA 4DUYC 5KEIA 5CZVA 3R9XA 3L95X 4FUQA 4JI8C 4KHPC 5JRHA 4DR1C 2OPLB 4DCVA 2OO4A 3LNVA 4WV3A 5BURA 3N54B 1WH9A 4DR7C 2E8CA 4IZ6A 4DR3C 3R44A 1N33C 2UXBC 5BSTA 5BSMA 2D1TA 3TQIA 2Y4NA 4B3TC 3AF5A 1L2FA 2KZFA 2UXDC 3J80D 1I94C 5LMNC 4B3RC 4JI1C 5KYVA 4LFCC 2QL8A 4JI3C 4RMNA 3IEVA 1ML8A 4DV7C 5BSWA 4JI7C 4JI6C 4GKJC 4ISBA 2D1QA 3DHVA 4I9FA 4DV5C 4DV6C 4X64C 2QVZX 2D27A 4IR7A 5K8FA 4DUZC 4DR6C 3SO4A 2E7GA 2UXCC 3LAXA 2P2JA 1ULTA 3NYRA 2EGTA 4JM1A 1O92A 4GS5A 4DV4C 1J5EC 4HPVA 2BJOA 2E8FA 1V26A 5IWAC 5IT9D 1MD9A 1FUGA 2HJGA 5KYTA 4NDNA 3NI2A 2XR1A 1USPA 3GPCA 4RVNA 4DCTA 4KTTA 4DG9A 4DCUA 4DV1C 1JOSA 2E5LC 4BC7A 4DR5C 1USPB 4AQYC 4L2ZA 4LF4C 4LE5A 5A1IA 2DYJA 4D56A 4DCSA 3GR0A 4ZJZA 4D57A 4G1IA 1FJGC 4K0BA 4G37A 4JI0C 4JYAC 1HNWC 4B3MC 4JI5C 4NXNC 5FLXD 4PZPA 4OXIA 1XNQC 4GKKC 2YCBA 3A9VA 5BUQA 2CY1A 2VQEC 2ONFA 3JAMD 1GPMA 5BSUA 1N2FA 2WD9A 3LUSA 4DR4C 5AE1A 4R1MA 4X66C 2QVXX 3N2QA 1LCIA 4OYCA 1O9TA 1PG4A 3CW9A 3B7WA 1T5HX 5CZXA 3H2TA 4LFAC 4X65C 2F4VC 3UZ0A 2UU9C 3CJEA 3C5EA 4GXQA 3EQ6A 2OBVA 1BA3A 4G36A 5GTDA 3NYQA 3T1YC 1XMOC 5LMUC 3ETCA 4L7IA 3CW8X 2ZM6C 3A4IA 2VZEA 2VQFC 1IBMC 2BH1X 2P2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTV A;  1O92 A;  1XRA A;  4L4Q A;  1MXB A;  1XRB A;  4HPV A;  4L2Z A;  3IML A;  4WS9 A;  1XRC A;  3S82 A;  4LE5 A;  5H9U A;  5A1I A;  3TDE A;  1QM4 A;  1FUG A;  1O90 A;  4NDN A;  2YWB A;  5T8S A;  2OBV A;  1MXC A;  3SO4 A;  1O9T A;  2YWC A;  2DPL A;  4KTT A;  1P7L A;  5A19 A;  1RG9 A;  4K0B A;  4L7I A;  1GPM A;  3RV2 A;  5A1G A;  4ODJ A;  1O93 A;  2P02 A;  3TQI A;  5T8T A;  3UOW A;  3A4I A;  1MXA A; 
#chains in the Genus database with same CATH topology
 1QWI A;  3L8C A;  5BUS A;  4MTN A;  2D1S A;  2WP0 C;  4ZLP A;  1XRC A;  1ZB8 A;  3S82 A;  2MMA B;  3A26 A;  4RLQ A;  1M6X A;  1XNR C;  1YJ7 A;  3UEB A;  4X62 C;  1HNX C;  1V25 A;  4YY3 C;  3I07 A;  2UUA C;  2CXC A;  4XX2 A;  3RV2 A;  2Y4O A;  4ODJ A;  3R9W A;  1RY2 A;  4BCA A;  1IBK C;  4DG8 A;  1IB8 A;  2VSQ A;  4LF5 C;  3FCC A;  4BC9 A;  3ETO A;  4LF8 C;  3DAY A;  2PN2 A;  4RVO A;  4EAT A;  3TDE A;  4D4G A;  2ZZM A;  5T8S A;  1MXC A;  1XMQ C;  5A2Q D;  1T5D X;  2P20 A;  2V7B A;  1HNZ C;  5AE3 A;  1UKK A;  4FUT A;  3VNR A;  1IBL C;  1KKG A;  4NXM C;  4DV2 C;  3AF6 A;  4OX9 C;  1AMU A;  1MKY A;  4K0K C;  1FLO A;  2YWB A;  3TUF A;  4LFB C;  2AYA A;  2D7V A;  3VNS A;  4JI4 C;  2DPL A;  4RLF A;  3TR3 A;  3T1H C;  1MDB A;  2D1R A;  5AE2 A;  5T8T A;  4BBY A;  3E7W A;  1K0R A;  3CQ3 A;  3LGX A;  1MXB A;  5IFI A;  2P2Q A;  2HHH C;  1XS3 A;  4GXR A;  3AY0 A;  3PES A;  2UUC C;  5E7Q A;  4BSZ A;  1PA4 A;  2P2F A;  4DR2 C;  4DV3 C;  4PRO C;  3KXW A;  4RM3 A;  3PRO C;  4YHH C;  2Y27 A;  3GR1 A;  1M6X C;  4JI2 C;  2P2B A;  1PU1 A;  1XRB A;  5BR8 C;  1MDF A;  5H9U A;  4R0M A;  3UX2 A;  5BSV A;  2ASB A;  1XHJ A;  5LCI A;  3FCE A;  4RM2 A;  3EER A;  3VNQ A;  4I9G A;  4R1L A;  4PHT A;  4FTF A;  4U5Y D;  1N32 C;  4JV5 C;  4B3S C;  1O93 A;  3PBK A;  3UOW A;  2QW0 X;  4L4Q A;  2KZ0 A;  1VEH A;  4NOZ A;  1WF3 A;  1QM4 A;  1LQL A;  4MH4 A;  3RG2 A;  2YWC A;  4PUI A;  2D28 C;  2QVY X;  5DV9 A;  2M5O A;  3I08 A;  3A9U A;  4TPS B;  2ZZN A;  5BSR A;  1TH5 A;  2ATW A;  1VLA A;  1HR0 C;  1NY8 A;  4DV0 C;  1EGA A;  5K85 A;  2E8E A;  2KDN A;  3G7S A;  3IPL A;  3IEU A;  3GKU A;  5A19 A;  1RG9 A;  1N34 C;  5A1G A;  3J81 D;  1HH2 P;  2P02 A;  3NPD A;  1MXA A;  4KTV A;  1XRA A;  4WS9 A;  3IML A;  4LF6 C;  4LF9 C;  1ZB9 A;  2UUB C;  3K6R A;  3OTO C;  1O90 A;  1PG3 A;  5ADZ A;  2JMP A;  3E7X A;  3DLP X;  2JNV A;  1V60 A;  2E0G A;  2PT7 G;  1P7L A;  2PRO A;  3A25 A;  4LF7 C;  2OPL A;  1N36 C;  4D4I A;  1NYE A;  4DUY C;  5KEI A;  5CZV A;  3R9X A;  3O2E A;  3L95 X;  4FUQ A;  4JI8 C;  4KHP C;  5JRH A;  4DR1 C;  2OPL B;  4DCV A;  2OO4 A;  3LNV A;  4WV3 A;  5BUR A;  3N54 B;  1WH9 A;  4DR7 C;  2E8C A;  4IZ6 A;  4DR3 C;  3R44 A;  1N33 C;  2UXB C;  5BST A;  5BSM A;  2D1T A;  3TQI A;  2Y4N A;  4B3T C;  3AF5 A;  1L2F A;  2KZF A;  2UXD C;  2DHM A;  3J80 D;  1I94 C;  5LMN C;  2MM9 A;  4B3R C;  4JI1 C;  5KYV A;  4LFC C;  2QL8 A;  4JI3 C;  4RMN A;  3IEV A;  1ML8 A;  4DV7 C;  5BSW A;  4JI7 C;  4JI6 C;  4GKJ C;  4ISB A;  2D1Q A;  3DHV A;  4I9F A;  4DV5 C;  4DV6 C;  4X64 C;  2QVZ X;  1WCJ A;  3UX3 A;  2D27 A;  4IR7 A;  5K8F A;  4DUZ C;  4DR6 C;  3SO4 A;  2E7G A;  2UXC C;  3LAX A;  2P2J A;  1P4E A;  1ULT A;  3NYR A;  2EGT A;  4JM1 A;  1O92 A;  4GS5 A;  4DV4 C;  1J5E C;  4HPV A;  2BJO A;  2E8F A;  1V26 A;  5IWA C;  5IT9 D;  1MD9 A;  1FUG A;  2HJG A;  5KYT A;  4NDN A;  2NCL A;  3NI2 A;  2XR1 A;  1USP A;  3GPC A;  4RVN A;  4DCT A;  4KTT A;  4DG9 A;  4DCU A;  4DV1 C;  1JOS A;  2E5L C;  4BC7 A;  4DR5 C;  1USP B;  4AQY C;  4L2Z A;  4LF4 C;  4LE5 A;  5A1I A;  2DYJ A;  4D56 A;  4PUG A;  4DCS A;  3GR0 A;  4ZJZ A;  4D57 A;  4G1I A;  1FJG C;  4K0B A;  4G37 A;  3LNO A;  3CQ2 A;  4JI0 C;  4JYA C;  1HNW C;  4B3M C;  4JI5 C;  4NXN C;  5FLX D;  4PZP A;  4OXI A;  1XNQ C;  4GKK C;  2YCB A;  3A9V A;  5BUQ A;  2CY1 A;  2VQE C;  2ONF A;  3JAM D;  1GPM A;  5BSU A;  1N2F A;  2WD9 A;  3LUS A;  4DR4 C;  5AE1 A;  4R1M A;  4X66 C;  1P4E C;  2QVX X;  3CQ1 A;  3N2Q A;  1LCI A;  2CU6 A;  4OYC A;  1O9T A;  1PG4 A;  3CW9 A;  4PUH A;  3B7W A;  1T5H X;  2YX1 A;  2M5H A;  5CZX A;  1UWD A;  3H2T A;  4LFA C;  4X65 C;  2Z51 A;  2MCQ A;  2F4V C;  3UZ0 A;  2UU9 C;  3CJE A;  3C5E A;  4GXQ A;  3EQ6 A;  2OBV A;  1BA3 A;  4G36 A;  5GTD A;  3NYQ A;  3T1Y C;  1XMO C;  5LMU C;  3ETC A;  4L7I A;  3CW8 X;  2ZM6 C;  3A4I A;  2VZE A;  2VQF C;  1IBM C;  2BH1 X;  2P2M A; 
#chains in the Genus database with same CATH homology
 1QWI A;  3L8C A;  5BUS A;  4MTN A;  2D1S A;  2WP0 C;  4ZLP A;  1XRC A;  1ZB8 A;  3S82 A;  4RLQ A;  1XNR C;  1YJ7 A;  4X62 C;  1HNX C;  1V25 A;  4YY3 C;  3I07 A;  2UUA C;  2CXC A;  4XX2 A;  3RV2 A;  2Y4O A;  4ODJ A;  3R9W A;  1RY2 A;  4BCA A;  1IBK C;  4DG8 A;  4LF5 C;  2VSQ A;  3FCC A;  4BC9 A;  3ETO A;  4LF8 C;  3DAY A;  2PN2 A;  4RVO A;  4EAT A;  3TDE A;  4D4G A;  5T8S A;  1MXC A;  1XMQ C;  5A2Q D;  1T5D X;  2P20 A;  2V7B A;  1HNZ C;  5AE3 A;  1UKK A;  4FUT A;  3VNR A;  1IBL C;  1KKG A;  4NXM C;  4DV2 C;  3AF6 A;  4OX9 C;  1AMU A;  1MKY A;  4K0K C;  2YWB A;  3TUF A;  4LFB C;  2AYA A;  2D7V A;  3VNS A;  4JI4 C;  2DPL A;  4RLF A;  3T1H C;  1MDB A;  2D1R A;  5AE2 A;  5T8T A;  4BBY A;  3E7W A;  1K0R A;  3LGX A;  1MXB A;  5IFI A;  2P2Q A;  2HHH C;  4GXR A;  3PES A;  2UUC C;  5E7Q A;  4BSZ A;  1PA4 A;  2P2F A;  4DR2 C;  4DV3 C;  4PRO C;  3KXW A;  4RM3 A;  3PRO C;  4YHH C;  2Y27 A;  3GR1 A;  4JI2 C;  2P2B A;  1XRB A;  5BR8 C;  1MDF A;  5H9U A;  4R0M A;  5BSV A;  2ASB A;  3FCE A;  4RM2 A;  3EER A;  3VNQ A;  4I9G A;  4R1L A;  4PHT A;  4FTF A;  4U5Y D;  1N32 C;  4JV5 C;  4B3S C;  1O93 A;  3PBK A;  3UOW A;  2QW0 X;  4L4Q A;  4NOZ A;  1WF3 A;  1QM4 A;  1LQL A;  4MH4 A;  3RG2 A;  2YWC A;  2D28 C;  2QVY X;  5DV9 A;  3I08 A;  3A9U A;  4TPS B;  5BSR A;  2ATW A;  1VLA A;  1HR0 C;  4DV0 C;  1EGA A;  5K85 A;  2E8E A;  3G7S A;  3IPL A;  3IEU A;  3GKU A;  5A19 A;  1RG9 A;  1N34 C;  5A1G A;  3J81 D;  1HH2 P;  2P02 A;  3NPD A;  1MXA A;  4KTV A;  1XRA A;  4WS9 A;  3IML A;  4LF6 C;  4LF9 C;  1ZB9 A;  2UUB C;  3OTO C;  1O90 A;  1PG3 A;  5ADZ A;  2JMP A;  3E7X A;  3DLP X;  2E0G A;  2PT7 G;  1P7L A;  2PRO A;  4LF7 C;  2OPL A;  1N36 C;  4D4I A;  1NYE A;  4DUY C;  5KEI A;  5CZV A;  3R9X A;  3L95 X;  4FUQ A;  4JI8 C;  4KHP C;  5JRH A;  4DR1 C;  2OPL B;  4DCV A;  2OO4 A;  3LNV A;  4WV3 A;  5BUR A;  3N54 B;  1WH9 A;  4DR7 C;  2E8C A;  4IZ6 A;  4DR3 C;  3R44 A;  1N33 C;  2UXB C;  5BST A;  5BSM A;  2D1T A;  3TQI A;  2Y4N A;  4B3T C;  3AF5 A;  1L2F A;  2KZF A;  2UXD C;  3J80 D;  1I94 C;  5LMN C;  4B3R C;  4JI1 C;  5KYV A;  4LFC C;  2QL8 A;  4JI3 C;  4RMN A;  3IEV A;  1ML8 A;  4DV7 C;  5BSW A;  4JI7 C;  4JI6 C;  4GKJ C;  4ISB A;  2D1Q A;  3DHV A;  4I9F A;  4DV5 C;  4DV6 C;  4X64 C;  2QVZ X;  2D27 A;  4IR7 A;  5K8F A;  4DUZ C;  4DR6 C;  3SO4 A;  2E7G A;  2UXC C;  3LAX A;  2P2J A;  1ULT A;  3NYR A;  2EGT A;  4JM1 A;  1O92 A;  4GS5 A;  4DV4 C;  1J5E C;  4HPV A;  2BJO A;  2E8F A;  1V26 A;  5IWA C;  5IT9 D;  1MD9 A;  1FUG A;  2HJG A;  5KYT A;  4NDN A;  3NI2 A;  2XR1 A;  1USP A;  3GPC A;  4RVN A;  4DCT A;  4KTT A;  4DG9 A;  4DCU A;  4DV1 C;  1JOS A;  2E5L C;  4BC7 A;  4DR5 C;  1USP B;  4AQY C;  4L2Z A;  4LF4 C;  4LE5 A;  5A1I A;  2DYJ A;  4D56 A;  4DCS A;  3GR0 A;  4ZJZ A;  4D57 A;  4G1I A;  1FJG C;  4K0B A;  4G37 A;  4JI0 C;  4JYA C;  1HNW C;  4B3M C;  4JI5 C;  4NXN C;  5FLX D;  4PZP A;  4OXI A;  1XNQ C;  4GKK C;  2YCB A;  3A9V A;  5BUQ A;  2CY1 A;  2VQE C;  2ONF A;  3JAM D;  1GPM A;  5BSU A;  1N2F A;  2WD9 A;  3LUS A;  4DR4 C;  5AE1 A;  4R1M A;  4X66 C;  2QVX X;  3N2Q A;  1LCI A;  4OYC A;  1O9T A;  1PG4 A;  3CW9 A;  3B7W A;  1T5H X;  5CZX A;  3H2T A;  4LFA C;  4X65 C;  2F4V C;  3UZ0 A;  2UU9 C;  3CJE A;  3C5E A;  4GXQ A;  3EQ6 A;  2OBV A;  1BA3 A;  4G36 A;  5GTD A;  3NYQ A;  3T1Y C;  1XMO C;  5LMU C;  3ETC A;  4L7I A;  3CW8 X;  2ZM6 C;  3A4I A;  2VZE A;  2VQF C;  1IBM C;  2BH1 X;  2P2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...