2E0GA

Dnaa n-terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
SLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQTQPQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosomal replication initiator protein dnaA
publication title Structure and Function of DnaA N-Terminal Domains: Specific Sites and Mechanisms in Inter-DnaA Interaction and in DnaB Helicase Loading on oriC
rcsb
source organism Escherichia coli k12
molecule tags Replication
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e0gA00
4TPSB 2E0GA 2WP0C
chains in the Genus database with same CATH superfamily
2ATWA 3EQ6A 2YCBA 3RV2A 2MCQA 4DV0C 5BSVA 1O93A 2E0GA 5BSTA 1ZB9A 3CW8X 3ETCA 4JI7C 1MDBA 3NPDA 4JV5C 1O90A 4X66C 4DV5C 3NYRA 5LCIA 5BSMA 5H9UA 1V25A 1FUGA 4GXRA 1M6XA 5IWAC 4DCSA 3UEBA 3AY0A 4NDNA 1VLAA 3T1HC 2D1TA 4NXNC 4LF5C 3L95X 2E8FA 4JI3C 2Y4NA 4RM2A 4PHTA 1P4EA 2UUBC 4WV3A 2Z51A 1HH2P 4LF8C 4FUTA 3IEUA 3FCCA 3A26A 4I9GA 2E5LC 2MM9A 3IPLA 4BBYA 1RG9A 4DUYC 5AE1A 4JI8C 3E7XA 4LF9C 4ISBA 4LFBC 4MH4A 1K0RA 2QVXX 2MMAB 5CZXA 3A4IA 1M6XC 2QL8A 1AMUA 5K85A 3PESA 1MDFA 4HPVA 4BCAA 3ETOA 4D4IA 2OBVA 5FLXD 3H2TA 1VEHA 2CXCA 4DCTA 1J5EC 3GR1A 1N2FA 3CJEA 2DPLA 3PBKA 4L2ZA 3JAMD 1PG3A 2NCLA 4DR2C 3TUFA 3TDEA 4JI4C 2D28C 5BR8C 1XHJA 4LF6C 3DHVA 1XMOC 2ASBA 4JM1A 1KKGA 1IBLC 5A19A 1ML8A 2Y27A 1WH9A 2WD9A 1WCJA 4GKJC 4DV4C 1PG4A 5JRHA 3FCEA 2OPLA 4K0KC 4DV7C 5K8FA 3IEVA 3I08A 4G1IA 4D4GA 2ZZNA 3J81D 1MXCA 4R1LA 3UZ0A 4G37A 2VZEA 3AF5A 1EGAA 4FTFA 3C5EA 4PUHA 1MXAA 1PA4A 2P2QA 4RMNA 3AF6A 5LMUC 1HR0C 4BC9A 5A1IA 5DV9A 4NOZA 1V26A 1I94C 5T8TA 2VQFC 5AE2A 5A2QD 1NY8A 5CZVA 4K0BA 3DLPX 1IBKC 5BUQA 4PROC 4G36A 1NYEA 4B3TC 2YWCA 3LNOA 1T5HX 2D1SA 1V60A 1ZB8A 1LQLA 2CY1A 3TR3A 4B3RC 4YHHC 3VNSA 2HHHC 1N33C 2P20A 4LFAC 4DG8A 4RVOA 4JI1C 4RLQA 2XR1A 2M5OA 4WS9A 4NXMC 3TQIA 1MD9A 2P02A 3SO4A 5BUSA 1BA3A 4OYCA 4LE5A 4GS5A 2KZ0A 2VSQA 4JI5C 2QVZX 2V7BA 5KYTA 4DR6C 1USPB 3K6RA 3G7SA 4MTNA 2ZM6C 2WP0C 3IMLA 3J80D 4DUZC 1N36C 1JOSA 1TH5A 2D7VA 2PN2A 4ODJA 3A9VA 1IBMC 2DYJA 4GXQA 1P7LA 3CQ3A 1T5DX 4L4QA 1UWDA 2D27A 4DR7C 4LFCC 3I07A 1UKKA 4I9FA 4PUIA 1P4EC 2P2FA 2QVYX 1XNQC 2VQEC 3GKUA 2QW0X 4DR1C 4D57A 4KTVA 2JMPA 5BSUA 1XNRC 2UXCC 2Y4OA 4EATA 4U5YD 4KTTA 3N2QA 3LAXA 4YY3C 4FUQA 5KEIA 3UX2A 2AYAA 1L2FA 3VNQA 3OTOC 1WF3A 4DV1C 3B7WA 2PROA 4LF4C 2E8CA 2ZZMA 5KYVA 2E7GA 2BJOA 3KXWA 2KDNA 3UOWA 3EERA 2P2JA 2M5HA 2D1QA 2ONFA 4PZPA 1HNXC 5IFIA 4OXIA 2OO4A 4TPSB 3A25A 2KZFA 5BSRA 3R44A 4IR7A 4DG9A 4B3MC 5BURA 4DV3C 4DR4C 3L8CA 1MKYA 3DAYA 2UUCC 2UXDC 4GKKC 3LGXA 1YJ7A 3CQ2A 4DV6C 2UU9C 4DCUA 1XRAA 5AE3A 2YWBA 5LMNC 1FJGC 4R0MA 5GTDA 4JI0C 4AQYC 1N34C 3GPCA 4DCVA 1HNWC 1XMQC 4OX9C 1FLOA 2JNVA 1N32C 1O92A 4JI6C 4JI2C 1QWIA 4DV2C 3CQ1A 2P2BA 3O2EA 3S82A 4PUGA 4LF7C 3LNVA 3R9XA 2DHMA 3NI2A 1XRCA 2BH1X 5ADZA 2HJGA 3LUSA 4DR5C 2OPLB 3R9WA 4RVNA 5E7QA 2UXBC 1USPA 4R1MA 1O9TA 4D56A 4KHPC 1IB8A 2F4VC 2E8EA 5IT9D 4ZJZA 5T8SA 3NYQA 3CW9A 5A1GA 2EGTA 4RM3A 1XS3A 3GR0A 4XX2A 4X62C 4RLFA 1QM4A 1XRBA 2YX1A 4ZLPA 4JYAC 2CU6A 1HNZC 4L7IA 3N54B 5BSWA 4BSZA 3T1YC 1GPMA 4IZ6A 3UX3A 2P2MA 2PT7G 1MXBA 4X64C 1RY2A 2D1RA 1LCIA 3E7WA 3PROC 3RG2A 4B3SC 4BC7A 3A9UA 2UUAC 1ULTA 4DR3C 1PU1A 4X65C 3VNRA
chains in the Genus database with same CATH topology
2ATWA 3EQ6A 2YCBA 3RV2A 4DV0C 5BSVA 1O93A 2E0GA 5BSTA 1ZB9A 3CW8X 3ETCA 4JI7C 1MDBA 3NPDA 4JV5C 1O90A 4X66C 4DV5C 3NYRA 5BSMA 5H9UA 1V25A 1FUGA 4GXRA 5IWAC 4DCSA 4NDNA 1VLAA 3T1HC 2D1TA 4NXNC 4LF5C 3L95X 2E8FA 4JI3C 2Y4NA 4RM2A 4PHTA 2UUBC 4WV3A 1HH2P 4LF8C 4FUTA 3IEUA 3FCCA 4I9GA 2E5LC 3IPLA 4BBYA 1RG9A 4DUYC 5AE1A 4JI8C 3E7XA 4LF9C 4ISBA 4LFBC 4MH4A 1K0RA 2QVXX 5CZXA 3A4IA 2QL8A 1AMUA 5K85A 3PESA 1MDFA 4HPVA 4BCAA 3ETOA 4D4IA 2OBVA 5FLXD 3H2TA 2CXCA 4DCTA 1J5EC 3GR1A 1N2FA 3CJEA 2DPLA 3PBKA 4L2ZA 3JAMD 1PG3A 4DR2C 3TUFA 3TDEA 4JI4C 2D28C 5BR8C 4LF6C 3DHVA 1XMOC 2ASBA 4JM1A 1KKGA 1IBLC 5A19A 1ML8A 2Y27A 1WH9A 2WD9A 4GKJC 4DV4C 1PG4A 5JRHA 3FCEA 2OPLA 4K0KC 4DV7C 5K8FA 3IEVA 3I08A 4G1IA 4D4GA 3J81D 1MXCA 4R1LA 3UZ0A 4G37A 2VZEA 3AF5A 1EGAA 4FTFA 3C5EA 5LMUC 1MXAA 1PA4A 2P2QA 4RMNA 3AF6A 1HR0C 4BC9A 5A1IA 5DV9A 4NOZA 1V26A 1I94C 5T8TA 2VQFC 5AE2A 5A2QD 5CZVA 4K0BA 3DLPX 1IBKC 5BUQA 4PROC 4G36A 1NYEA 4B3TC 2YWCA 1T5HX 2D1SA 1ZB8A 1LQLA 2CY1A 4B3RC 4YHHC 3VNSA 2HHHC 1N33C 2P20A 4LFAC 4DG8A 4RVOA 4JI1C 4RLQA 2XR1A 4WS9A 4NXMC 3TQIA 1MD9A 2P02A 3SO4A 5BUSA 1BA3A 4OYCA 4LE5A 4GS5A 2VSQA 4JI5C 2QVZX 2V7BA 5KYTA 4DR6C 1USPB 3G7SA 4MTNA 2ZM6C 2WP0C 3IMLA 3J80D 4DUZC 1N36C 1JOSA 2D7VA 2PN2A 4ODJA 3A9VA 1IBMC 2DYJA 4GXQA 1P7LA 1T5DX 4L4QA 2D27A 4DR7C 4LFCC 3I07A 1UKKA 4I9FA 2P2FA 2QVYX 1XNQC 2VQEC 3GKUA 2QW0X 4DR1C 4D57A 4KTVA 2JMPA 5BSUA 1XNRC 2UXCC 2Y4OA 4EATA 4U5YD 4KTTA 3N2QA 3LAXA 4YY3C 4FUQA 5KEIA 2AYAA 1L2FA 3VNQA 3OTOC 1WF3A 4DV1C 3B7WA 2PROA 4LF4C 2E8CA 5KYVA 2E7GA 2BJOA 3KXWA 3UOWA 3EERA 2P2JA 2D1QA 2ONFA 4PZPA 1HNXC 5IFIA 4OXIA 2OO4A 4TPSB 2KZFA 5BSRA 3R44A 4IR7A 4DG9A 4B3MC 5BURA 4DV3C 4DR4C 3L8CA 1MKYA 3DAYA 2UUCC 2UXDC 4GKKC 3LGXA 1YJ7A 4DV6C 2UU9C 4DCUA 1XRAA 5AE3A 2YWBA 5LMNC 1FJGC 4R0MA 5GTDA 4JI0C 4AQYC 1N34C 3GPCA 4DCVA 1HNWC 1XMQC 4OX9C 1N32C 1O92A 4JI6C 4JI2C 1QWIA 4DV2C 2P2BA 3S82A 4LF7C 3LNVA 3R9XA 3NI2A 1XRCA 2BH1X 5ADZA 2HJGA 3LUSA 4DR5C 2OPLB 3R9WA 4RVNA 5E7QA 2UXBC 1USPA 4R1MA 1O9TA 4D56A 4KHPC 2F4VC 2E8EA 5IT9D 4ZJZA 5T8SA 3NYQA 3CW9A 5A1GA 2EGTA 4RM3A 3GR0A 4XX2A 4X62C 4RLFA 1QM4A 1XRBA 4ZLPA 4JYAC 1HNZC 4L7IA 3N54B 5BSWA 4BSZA 3T1YC 1GPMA 4IZ6A 2P2MA 2PT7G 1MXBA 4X64C 1RY2A 2D1RA 1LCIA 3E7WA 3PROC 3RG2A 4B3SC 4BC7A 3A9UA 2UUAC 1ULTA 4DR3C 4X65C 3VNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TPS B;  2E0G A;  2WP0 C; 
#chains in the Genus database with same CATH topology
 2ATW A;  3EQ6 A;  2YCB A;  3RV2 A;  2MCQ A;  4DV0 C;  5BSV A;  1O93 A;  2E0G A;  5BST A;  1ZB9 A;  3CW8 X;  3ETC A;  4JI7 C;  1MDB A;  3NPD A;  4JV5 C;  1O90 A;  4X66 C;  4DV5 C;  3NYR A;  5LCI A;  5BSM A;  5H9U A;  1V25 A;  1FUG A;  4GXR A;  1M6X A;  5IWA C;  4DCS A;  3UEB A;  3AY0 A;  4NDN A;  1VLA A;  3T1H C;  2D1T A;  4NXN C;  4LF5 C;  3L95 X;  2E8F A;  4JI3 C;  2Y4N A;  4RM2 A;  4PHT A;  1P4E A;  2UUB C;  4WV3 A;  2Z51 A;  1HH2 P;  4LF8 C;  4FUT A;  3IEU A;  3FCC A;  3A26 A;  4I9G A;  2E5L C;  2MM9 A;  3IPL A;  4BBY A;  1RG9 A;  4DUY C;  5AE1 A;  4JI8 C;  3E7X A;  4LF9 C;  4ISB A;  4LFB C;  4MH4 A;  1K0R A;  2QVX X;  2MMA B;  5CZX A;  3A4I A;  1M6X C;  2QL8 A;  1AMU A;  5K85 A;  3PES A;  1MDF A;  4HPV A;  4BCA A;  3ETO A;  4D4I A;  2OBV A;  5FLX D;  3H2T A;  1VEH A;  2CXC A;  4DCT A;  1J5E C;  3GR1 A;  1N2F A;  3CJE A;  2DPL A;  3PBK A;  4L2Z A;  3JAM D;  1PG3 A;  2NCL A;  4DR2 C;  3TUF A;  3TDE A;  4JI4 C;  2D28 C;  5BR8 C;  1XHJ A;  4LF6 C;  3DHV A;  1XMO C;  2ASB A;  4JM1 A;  1KKG A;  1IBL C;  5A19 A;  1ML8 A;  2Y27 A;  1WH9 A;  2WD9 A;  1WCJ A;  4GKJ C;  4DV4 C;  1PG4 A;  5JRH A;  3FCE A;  2OPL A;  4K0K C;  4DV7 C;  5K8F A;  3IEV A;  3I08 A;  4G1I A;  4D4G A;  2ZZN A;  3J81 D;  1MXC A;  4R1L A;  3UZ0 A;  4G37 A;  2VZE A;  3AF5 A;  1EGA A;  4FTF A;  3C5E A;  4PUH A;  1MXA A;  1PA4 A;  2P2Q A;  4RMN A;  3AF6 A;  5LMU C;  1HR0 C;  4BC9 A;  5A1I A;  5DV9 A;  4NOZ A;  1V26 A;  1I94 C;  5T8T A;  2VQF C;  5AE2 A;  5A2Q D;  1NY8 A;  5CZV A;  4K0B A;  3DLP X;  1IBK C;  5BUQ A;  4PRO C;  4G36 A;  1NYE A;  4B3T C;  2YWC A;  3LNO A;  1T5H X;  2D1S A;  1V60 A;  1ZB8 A;  1LQL A;  2CY1 A;  3TR3 A;  4B3R C;  4YHH C;  3VNS A;  2HHH C;  1N33 C;  2P20 A;  4LFA C;  4DG8 A;  4RVO A;  4JI1 C;  4RLQ A;  2XR1 A;  2M5O A;  4WS9 A;  4NXM C;  3TQI A;  1MD9 A;  2P02 A;  3SO4 A;  5BUS A;  1BA3 A;  4OYC A;  4LE5 A;  4GS5 A;  2KZ0 A;  2VSQ A;  4JI5 C;  2QVZ X;  2V7B A;  5KYT A;  4DR6 C;  1USP B;  3K6R A;  3G7S A;  4MTN A;  2ZM6 C;  2WP0 C;  3IML A;  3J80 D;  4DUZ C;  1N36 C;  1JOS A;  1TH5 A;  2D7V A;  2PN2 A;  4ODJ A;  3A9V A;  1IBM C;  2DYJ A;  4GXQ A;  1P7L A;  3CQ3 A;  1T5D X;  4L4Q A;  1UWD A;  2D27 A;  4DR7 C;  4LFC C;  3I07 A;  1UKK A;  4I9F A;  4PUI A;  1P4E C;  2P2F A;  2QVY X;  1XNQ C;  2VQE C;  3GKU A;  2QW0 X;  4DR1 C;  4D57 A;  4KTV A;  2JMP A;  5BSU A;  1XNR C;  2UXC C;  2Y4O A;  4EAT A;  4U5Y D;  4KTT A;  3N2Q A;  3LAX A;  4YY3 C;  4FUQ A;  5KEI A;  3UX2 A;  2AYA A;  1L2F A;  3VNQ A;  3OTO C;  1WF3 A;  4DV1 C;  3B7W A;  2PRO A;  4LF4 C;  2E8C A;  2ZZM A;  5KYV A;  2E7G A;  2BJO A;  3KXW A;  2KDN A;  3UOW A;  3EER A;  2P2J A;  2M5H A;  2D1Q A;  2ONF A;  4PZP A;  1HNX C;  5IFI A;  4OXI A;  2OO4 A;  4TPS B;  3A25 A;  2KZF A;  5BSR A;  3R44 A;  4IR7 A;  4DG9 A;  4B3M C;  5BUR A;  4DV3 C;  4DR4 C;  3L8C A;  1MKY A;  3DAY A;  2UUC C;  2UXD C;  4GKK C;  3LGX A;  1YJ7 A;  3CQ2 A;  4DV6 C;  2UU9 C;  4DCU A;  1XRA A;  5AE3 A;  2YWB A;  5LMN C;  1FJG C;  4R0M A;  5GTD A;  4JI0 C;  4AQY C;  1N34 C;  3GPC A;  4DCV A;  1HNW C;  1XMQ C;  4OX9 C;  1FLO A;  2JNV A;  1N32 C;  1O92 A;  4JI6 C;  4JI2 C;  1QWI A;  4DV2 C;  3CQ1 A;  2P2B A;  3O2E A;  3S82 A;  4PUG A;  4LF7 C;  3LNV A;  3R9X A;  2DHM A;  3NI2 A;  1XRC A;  2BH1 X;  5ADZ A;  2HJG A;  3LUS A;  4DR5 C;  2OPL B;  3R9W A;  4RVN A;  5E7Q A;  2UXB C;  1USP A;  4R1M A;  1O9T A;  4D56 A;  4KHP C;  1IB8 A;  2F4V C;  2E8E A;  5IT9 D;  4ZJZ A;  5T8S A;  3NYQ A;  3CW9 A;  5A1G A;  2EGT A;  4RM3 A;  1XS3 A;  3GR0 A;  4XX2 A;  4X62 C;  4RLF A;  1QM4 A;  1XRB A;  2YX1 A;  4ZLP A;  4JYA C;  2CU6 A;  1HNZ C;  4L7I A;  3N54 B;  5BSW A;  4BSZ A;  3T1Y C;  1GPM A;  4IZ6 A;  3UX3 A;  2P2M A;  2PT7 G;  1MXB A;  4X64 C;  1RY2 A;  2D1R A;  1LCI A;  3E7W A;  3PRO C;  3RG2 A;  4B3S C;  4BC7 A;  3A9U A;  2UUA C;  1ULT A;  4DR3 C;  1PU1 A;  4X65 C;  3VNR A; 
#chains in the Genus database with same CATH homology
 2ATW A;  3EQ6 A;  2YCB A;  3RV2 A;  4DV0 C;  5BSV A;  1O93 A;  2E0G A;  5BST A;  1ZB9 A;  3CW8 X;  3ETC A;  4JI7 C;  1MDB A;  3NPD A;  4JV5 C;  1O90 A;  4X66 C;  4DV5 C;  3NYR A;  5BSM A;  5H9U A;  1V25 A;  1FUG A;  4GXR A;  5IWA C;  4DCS A;  4NDN A;  1VLA A;  3T1H C;  2D1T A;  4NXN C;  4LF5 C;  3L95 X;  2E8F A;  4JI3 C;  2Y4N A;  4RM2 A;  4PHT A;  2UUB C;  4WV3 A;  1HH2 P;  4LF8 C;  4FUT A;  3IEU A;  3FCC A;  4I9G A;  2E5L C;  3IPL A;  4BBY A;  1RG9 A;  4DUY C;  5AE1 A;  4JI8 C;  3E7X A;  4LF9 C;  4ISB A;  4LFB C;  4MH4 A;  1K0R A;  2QVX X;  5CZX A;  3A4I A;  2QL8 A;  1AMU A;  5K85 A;  3PES A;  1MDF A;  4HPV A;  4BCA A;  3ETO A;  4D4I A;  2OBV A;  5FLX D;  3H2T A;  2CXC A;  4DCT A;  1J5E C;  3GR1 A;  1N2F A;  3CJE A;  2DPL A;  3PBK A;  4L2Z A;  3JAM D;  1PG3 A;  4DR2 C;  3TUF A;  3TDE A;  4JI4 C;  2D28 C;  5BR8 C;  4LF6 C;  3DHV A;  1XMO C;  2ASB A;  4JM1 A;  1KKG A;  1IBL C;  5A19 A;  1ML8 A;  2Y27 A;  1WH9 A;  2WD9 A;  4GKJ C;  4DV4 C;  1PG4 A;  5JRH A;  3FCE A;  2OPL A;  4K0K C;  4DV7 C;  5K8F A;  3IEV A;  3I08 A;  4G1I A;  4D4G A;  3J81 D;  1MXC A;  4R1L A;  3UZ0 A;  4G37 A;  2VZE A;  3AF5 A;  1EGA A;  4FTF A;  3C5E A;  5LMU C;  1MXA A;  1PA4 A;  2P2Q A;  4RMN A;  3AF6 A;  1HR0 C;  4BC9 A;  5A1I A;  5DV9 A;  4NOZ A;  1V26 A;  1I94 C;  5T8T A;  2VQF C;  5AE2 A;  5A2Q D;  5CZV A;  4K0B A;  3DLP X;  1IBK C;  5BUQ A;  4PRO C;  4G36 A;  1NYE A;  4B3T C;  2YWC A;  1T5H X;  2D1S A;  1ZB8 A;  1LQL A;  2CY1 A;  4B3R C;  4YHH C;  3VNS A;  2HHH C;  1N33 C;  2P20 A;  4LFA C;  4DG8 A;  4RVO A;  4JI1 C;  4RLQ A;  2XR1 A;  4WS9 A;  4NXM C;  3TQI A;  1MD9 A;  2P02 A;  3SO4 A;  5BUS A;  1BA3 A;  4OYC A;  4LE5 A;  4GS5 A;  2VSQ A;  4JI5 C;  2QVZ X;  2V7B A;  5KYT A;  4DR6 C;  1USP B;  3G7S A;  4MTN A;  2ZM6 C;  2WP0 C;  3IML A;  3J80 D;  4DUZ C;  1N36 C;  1JOS A;  2D7V A;  2PN2 A;  4ODJ A;  3A9V A;  1IBM C;  2DYJ A;  4GXQ A;  1P7L A;  1T5D X;  4L4Q A;  2D27 A;  4DR7 C;  4LFC C;  3I07 A;  1UKK A;  4I9F A;  2P2F A;  2QVY X;  1XNQ C;  2VQE C;  3GKU A;  2QW0 X;  4DR1 C;  4D57 A;  4KTV A;  2JMP A;  5BSU A;  1XNR C;  2UXC C;  2Y4O A;  4EAT A;  4U5Y D;  4KTT A;  3N2Q A;  3LAX A;  4YY3 C;  4FUQ A;  5KEI A;  2AYA A;  1L2F A;  3VNQ A;  3OTO C;  1WF3 A;  4DV1 C;  3B7W A;  2PRO A;  4LF4 C;  2E8C A;  5KYV A;  2E7G A;  2BJO A;  3KXW A;  3UOW A;  3EER A;  2P2J A;  2D1Q A;  2ONF A;  4PZP A;  1HNX C;  5IFI A;  4OXI A;  2OO4 A;  4TPS B;  2KZF A;  5BSR A;  3R44 A;  4IR7 A;  4DG9 A;  4B3M C;  5BUR A;  4DV3 C;  4DR4 C;  3L8C A;  1MKY A;  3DAY A;  2UUC C;  2UXD C;  4GKK C;  3LGX A;  1YJ7 A;  4DV6 C;  2UU9 C;  4DCU A;  1XRA A;  5AE3 A;  2YWB A;  5LMN C;  1FJG C;  4R0M A;  5GTD A;  4JI0 C;  4AQY C;  1N34 C;  3GPC A;  4DCV A;  1HNW C;  1XMQ C;  4OX9 C;  1N32 C;  1O92 A;  4JI6 C;  4JI2 C;  1QWI A;  4DV2 C;  2P2B A;  3S82 A;  4LF7 C;  3LNV A;  3R9X A;  3NI2 A;  1XRC A;  2BH1 X;  5ADZ A;  2HJG A;  3LUS A;  4DR5 C;  2OPL B;  3R9W A;  4RVN A;  5E7Q A;  2UXB C;  1USP A;  4R1M A;  1O9T A;  4D56 A;  4KHP C;  2F4V C;  2E8E A;  5IT9 D;  4ZJZ A;  5T8S A;  3NYQ A;  3CW9 A;  5A1G A;  2EGT A;  4RM3 A;  3GR0 A;  4XX2 A;  4X62 C;  4RLF A;  1QM4 A;  1XRB A;  4ZLP A;  4JYA C;  1HNZ C;  4L7I A;  3N54 B;  5BSW A;  4BSZ A;  3T1Y C;  1GPM A;  4IZ6 A;  2P2M A;  2PT7 G;  1MXB A;  4X64 C;  1RY2 A;  2D1R A;  1LCI A;  3E7W A;  3PRO C;  3RG2 A;  4B3S C;  4BC7 A;  3A9U A;  2UUA C;  1ULT A;  4DR3 C;  4X65 C;  3VNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...