2E0GA

Dnaa n-terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
SLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQTQPQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of DnaA N-Terminal Domains: Specific Sites and Mechanisms in Inter-DnaA Interaction and in DnaB Helicase Loading on oriC
rcsb
source organism Escherichia coli k12
molecule tags Replication
molecule keywords Chromosomal replication initiator protein dnaA
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e0gA00
4TPSB 2WP0C 2E0GA
chains in the Genus database with same CATH superfamily
4JI0C 5BUSA 1N34C 4PZPA 4LF8C 4LF6C 2VSQA 4JM1A 3R9WA 4DR6C 2WP0C 2BH1X 4D4GA 5KYTA 2MMAB 3A9VA 1UKKA 4DG8A 3RG2A 2M5OA 1RY2A 3GR1A 3KXWA 3EERA 4BC9A 4RLQA 5A19A 2YCBA 3FCCA 3N2QA 5T8SA 4D4IA 1IBKC 1XS3A 5A1IA 3I07A 1NY8A 5BUQA 2P2BA 1MD9A 2VQEC 3PROC 5BURA 4DR1C 2ZM6C 4XX2A 3A4IA 3IPLA 1RG9A 2VZEA 4HPVA 4DUZC 4RVNA 2WD9A 2P2MA 1ZB9A 4I9GA 3N54B 3E7XA 3AY0A 4DR2C 1WCJA 4JI1C 2Y27A 1AMUA 2D27A 1P4EA 4DUYC 4B3SC 1MXCA 1PG3A 4B3MC 5ADZA 4JI8C 4DV7C 2D1SA 3CQ3A 3NYRA 1HH2P 4FUQA 2PROA 1JOSA 4LF4C 2OPLB 4PUGA 3I08A 1O9TA 4DCVA 5BR8C 1O90A 5T8TA 3NYQA 2PN2A 5CZXA 4BCAA 2CY1A 4JI7C 2VQFC 2UUBC 4YHHC 3TQIA 2NCLA 5BSRA 3L95X 2XR1A 1N2FA 4DR7C 1FUGA 4YY3C 3H2TA 3RV2A 1WF3A 2JMPA 4TPSB 2DHMA 4RM2A 4L7IA 1VEHA 4NDNA 3CW8X 2PT7G 2BJOA 4X64C 3GKUA 1MXAA 1N33C 1NYEA 4LF7C 4RVOA 3JAMD 4G36A 4MH4A 1ULTA 1IBLC 5K8FA 4B3RC 1UWDA 4NXMC 4DV4C 4DV5C 5LMNC 5AE2A 2P20A 1HNWC 3AF5A 4K0BA 2P2FA 4IZ6A 3B7WA 4AQYC 2MM9A 3J81D 1BA3A 3IMLA 4MTNA 4BC7A 2OO4A 4U5YD 2V7BA 2UXBC 4ISBA 5BSWA 2D28C 1PU1A 1HR0C 2D1RA 4DR5C 2UU9C 3E7WA 4G37A 1PG4A 2D1QA 4R1LA 1ML8A 4RM3A 5K85A 3OTOC 5AE1A 4NOZA 5DV9A 3LNVA 4K0KC 4PUHA 4NXNC 4JYAC 1XRCA 3AF6A 3GR0A 1I94C 3GPCA 4X62C 2OBVA 2YWCA 5KYVA 1XRBA 1EGAA 1MDFA 3LAXA 4DCTA 5BSVA 4D56A 2E8CA 5JRHA 1N36C 3S82A 3J80D 2UXCC 4ZLPA 1KKGA 1USPA 4PROC 4RLFA 1ZB8A 4D57A 1T5HX 1P4EC 1QM4A 1V26A 1XMQC 4OXIA 4DV1C 4DR4C 1FJGC 4LFCC 4BSZA 5LCIA 3SO4A 2HHHC 3TUFA 1XHJA 3CQ2A 3NI2A 3TDEA 4KTTA 1XNQC 2ASBA 1O93A 1VLAA 3EQ6A 4KTVA 2DYJA 5BSMA 4LFAC 5BSTA 1QWIA 4EATA 4R0MA 2UUCC 2AYAA 4WS9A 3VNQA 5LMUC 4DG9A 1USPB 5AE3A 5A1GA 5FLXD 2QVZX 2EGTA 3K6RA 2E5LC 4B3TC 4DV0C 3T1YC 4JI4C 2Y4OA 1MKYA 5CZVA 3IEUA 3G7SA 1O92A 4ZJZA 4R1MA 2D1TA 4GXQA 1HNZC 1PA4A 2Y4NA 4LF9C 4DCUA 1HNXC 3A9UA 4X66C 1IB8A 3T1HC 4DV3C 2D7VA 2KZFA 2E7GA 3NPDA 3VNSA 3DHVA 3A25A 4JI3C 3LGXA 4OYCA 1XRAA 2HJGA 1WH9A 4X65C 3UOWA 4I9FA 4JI2C 5IT9D 2MCQA 1N32C 2M5HA 2ZZNA 3LNOA 3DLPX 4GS5A 4PUIA 5BSUA 2P2JA 1GPMA 1FLOA 4LFBC 1V25A 3CQ1A 5H9UA 1YJ7A 4GKKC 3ETOA 4KHPC 5IWAC 4DR3C 2QW0X 2KDNA 1K0RA 2ONFA 2Z51A 1MDBA 2CXCA 1V60A 3UX2A 3ETCA 5IFIA 2P02A 2E8EA 4PHTA 3PESA 4L4QA 2ZZMA 4OX9C 4FUTA 4G1IA 2QVYX 4DCSA 4BBYA 2ATWA 4GXRA 2DPLA 4RMNA 2YX1A 4DV2C 1T5DX 2F4VC 2QL8A 4FTFA 4LE5A 1M6XC 4L2ZA 2KZ0A 1L2FA 1P7LA 4DV6C 2QVXX 4GKJC 4IR7A 4JI6C 4LF5C 1XMOC 2UUAC 2JNVA 1TH5A 2E8FA 1LQLA 2YWBA 5A2QD 5KEIA 3A26A 3L8CA 2P2QA 4WV3A 3VNRA 3PBKA 1M6XA 3UEBA 3R9XA 3R44A 3UX3A 5GTDA 4JV5C 1MXBA 3CW9A 2CU6A 3FCEA 1LCIA 3UZ0A 3CJEA 3C5EA 1IBMC 2E0GA 3O2EA 3TR3A 5E7QA 3IEVA 4JI5C 2OPLA 4ODJA 1XNRC 3DAYA 3LUSA 2UXDC 1J5EC
chains in the Genus database with same CATH topology
4JI0C 5BUSA 1N34C 4PZPA 4LF8C 4LF6C 2VSQA 4JM1A 3R9WA 4DR6C 2WP0C 2BH1X 4D4GA 5KYTA 3A9VA 1UKKA 4DG8A 3RG2A 1RY2A 3GR1A 3KXWA 3EERA 4BC9A 4RLQA 5A19A 2YCBA 3FCCA 3N2QA 5T8SA 4D4IA 1IBKC 5A1IA 3I07A 5BUQA 2P2BA 1MD9A 2VQEC 3PROC 5BURA 4DR1C 2ZM6C 4XX2A 3A4IA 3IPLA 1RG9A 2VZEA 4HPVA 4DUZC 4RVNA 2WD9A 2P2MA 1ZB9A 4I9GA 3N54B 3E7XA 4DR2C 4JI1C 2Y27A 1AMUA 2D27A 4DUYC 4B3SC 1MXCA 1PG3A 4B3MC 5ADZA 4JI8C 4DV7C 2D1SA 3NYRA 1HH2P 4FUQA 2PROA 1JOSA 4LF4C 2OPLB 3I08A 1O9TA 4DCVA 5BR8C 1O90A 5T8TA 3NYQA 2PN2A 5CZXA 4BCAA 2CY1A 4JI7C 2VQFC 2UUBC 4YHHC 3TQIA 5BSRA 3L95X 2XR1A 1N2FA 4DR7C 1FUGA 4YY3C 3H2TA 3RV2A 1WF3A 2JMPA 4TPSB 4RM2A 4L7IA 4NDNA 3CW8X 2PT7G 2BJOA 4X64C 3GKUA 1MXAA 1N33C 1NYEA 4LF7C 4RVOA 3JAMD 4G36A 4MH4A 1ULTA 1IBLC 5K8FA 4B3RC 4NXMC 4DV4C 4DV5C 5LMNC 5AE2A 2P20A 1HNWC 3AF5A 4K0BA 2P2FA 4IZ6A 3B7WA 4AQYC 3J81D 1BA3A 3IMLA 4MTNA 4BC7A 2OO4A 4U5YD 2V7BA 2UXBC 4ISBA 5BSWA 2D28C 1HR0C 2D1RA 4DR5C 2UU9C 3E7WA 4G37A 1PG4A 2D1QA 4R1LA 1ML8A 4RM3A 5K85A 3OTOC 5AE1A 4NOZA 5DV9A 3LNVA 4K0KC 4NXNC 4JYAC 1XRCA 3AF6A 3GR0A 1I94C 3GPCA 4X62C 2OBVA 2YWCA 5KYVA 1XRBA 1EGAA 1MDFA 3LAXA 4DCTA 5BSVA 4D56A 2E8CA 5JRHA 1N36C 3S82A 3J80D 2UXCC 4ZLPA 1KKGA 1USPA 4PROC 4RLFA 1ZB8A 4D57A 1T5HX 1QM4A 1V26A 1XMQC 4OXIA 4DV1C 4DR4C 1FJGC 4LFCC 4BSZA 3SO4A 2HHHC 3TUFA 3NI2A 3TDEA 4KTTA 1XNQC 2ASBA 1O93A 1VLAA 3EQ6A 4KTVA 2DYJA 5BSMA 4LFAC 5BSTA 1QWIA 4EATA 4R0MA 2UUCC 2AYAA 4WS9A 3VNQA 5LMUC 4DG9A 1USPB 5AE3A 5A1GA 5FLXD 2QVZX 2EGTA 2E5LC 4B3TC 4DV0C 3T1YC 4JI4C 2Y4OA 1MKYA 5CZVA 3IEUA 3G7SA 1O92A 4ZJZA 4R1MA 2D1TA 4GXQA 1HNZC 1PA4A 2Y4NA 4LF9C 4DCUA 1HNXC 3A9UA 4X66C 3T1HC 4DV3C 2D7VA 2KZFA 2E7GA 3NPDA 3VNSA 3DHVA 4JI3C 3LGXA 4OYCA 1XRAA 2HJGA 1WH9A 4X65C 3UOWA 4I9FA 4JI2C 5IT9D 1N32C 3DLPX 4GS5A 5BSUA 2P2JA 1GPMA 4LFBC 1V25A 5H9UA 1YJ7A 4GKKC 3ETOA 4KHPC 5IWAC 4DR3C 2QW0X 1K0RA 2ONFA 1MDBA 2CXCA 3ETCA 5IFIA 2P02A 2E8EA 4PHTA 3PESA 4L4QA 4OX9C 4FUTA 4G1IA 2QVYX 4DCSA 4BBYA 2ATWA 4GXRA 2DPLA 4RMNA 4DV2C 1T5DX 2F4VC 2QL8A 4FTFA 4LE5A 4L2ZA 1L2FA 1P7LA 4DV6C 2QVXX 4GKJC 4IR7A 4JI6C 4LF5C 1XMOC 2UUAC 2E8FA 1LQLA 2YWBA 5A2QD 5KEIA 3L8CA 2P2QA 4WV3A 3VNRA 3PBKA 3R9XA 3R44A 5GTDA 4JV5C 1MXBA 3CW9A 3FCEA 1LCIA 3UZ0A 3CJEA 3C5EA 1IBMC 2E0GA 5E7QA 3IEVA 4JI5C 2OPLA 4ODJA 1XNRC 3DAYA 3LUSA 2UXDC 1J5EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TPS B;  2WP0 C;  2E0G A; 
#chains in the Genus database with same CATH topology
 4JI0 C;  5BUS A;  1N34 C;  4PZP A;  4LF8 C;  4LF6 C;  2VSQ A;  4JM1 A;  3R9W A;  4DR6 C;  2WP0 C;  2BH1 X;  4D4G A;  5KYT A;  2MMA B;  3A9V A;  1UKK A;  4DG8 A;  3RG2 A;  2M5O A;  1RY2 A;  3GR1 A;  3KXW A;  3EER A;  4BC9 A;  4RLQ A;  5A19 A;  2YCB A;  3FCC A;  3N2Q A;  5T8S A;  4D4I A;  1IBK C;  1XS3 A;  5A1I A;  3I07 A;  1NY8 A;  5BUQ A;  2P2B A;  1MD9 A;  2VQE C;  3PRO C;  5BUR A;  4DR1 C;  2ZM6 C;  4XX2 A;  3A4I A;  3IPL A;  1RG9 A;  2VZE A;  4HPV A;  4DUZ C;  4RVN A;  2WD9 A;  2P2M A;  1ZB9 A;  4I9G A;  3N54 B;  3E7X A;  3AY0 A;  4DR2 C;  1WCJ A;  4JI1 C;  2Y27 A;  1AMU A;  2D27 A;  1P4E A;  4DUY C;  4B3S C;  1MXC A;  1PG3 A;  4B3M C;  5ADZ A;  4JI8 C;  4DV7 C;  2D1S A;  3CQ3 A;  3NYR A;  1HH2 P;  4FUQ A;  2PRO A;  1JOS A;  4LF4 C;  2OPL B;  4PUG A;  3I08 A;  1O9T A;  4DCV A;  5BR8 C;  1O90 A;  5T8T A;  3NYQ A;  2PN2 A;  5CZX A;  4BCA A;  2CY1 A;  4JI7 C;  2VQF C;  2UUB C;  4YHH C;  3TQI A;  2NCL A;  5BSR A;  3L95 X;  2XR1 A;  1N2F A;  4DR7 C;  1FUG A;  4YY3 C;  3H2T A;  3RV2 A;  1WF3 A;  2JMP A;  4TPS B;  2DHM A;  4RM2 A;  4L7I A;  1VEH A;  4NDN A;  3CW8 X;  2PT7 G;  2BJO A;  4X64 C;  3GKU A;  1MXA A;  1N33 C;  1NYE A;  4LF7 C;  4RVO A;  3JAM D;  4G36 A;  4MH4 A;  1ULT A;  1IBL C;  5K8F A;  4B3R C;  1UWD A;  4NXM C;  4DV4 C;  4DV5 C;  5LMN C;  5AE2 A;  2P20 A;  1HNW C;  3AF5 A;  4K0B A;  2P2F A;  4IZ6 A;  3B7W A;  4AQY C;  2MM9 A;  3J81 D;  1BA3 A;  3IML A;  4MTN A;  4BC7 A;  2OO4 A;  4U5Y D;  2V7B A;  2UXB C;  4ISB A;  5BSW A;  2D28 C;  1PU1 A;  1HR0 C;  2D1R A;  4DR5 C;  2UU9 C;  3E7W A;  4G37 A;  1PG4 A;  2D1Q A;  4R1L A;  1ML8 A;  4RM3 A;  5K85 A;  3OTO C;  5AE1 A;  4NOZ A;  5DV9 A;  3LNV A;  4K0K C;  4PUH A;  4NXN C;  4JYA C;  1XRC A;  3AF6 A;  3GR0 A;  1I94 C;  3GPC A;  4X62 C;  2OBV A;  2YWC A;  5KYV A;  1XRB A;  1EGA A;  1MDF A;  3LAX A;  4DCT A;  5BSV A;  4D56 A;  2E8C A;  5JRH A;  1N36 C;  3S82 A;  3J80 D;  2UXC C;  4ZLP A;  1KKG A;  1USP A;  4PRO C;  4RLF A;  1ZB8 A;  4D57 A;  1T5H X;  1P4E C;  1QM4 A;  1V26 A;  1XMQ C;  4OXI A;  4DV1 C;  4DR4 C;  1FJG C;  4LFC C;  4BSZ A;  5LCI A;  3SO4 A;  2HHH C;  3TUF A;  1XHJ A;  3CQ2 A;  3NI2 A;  3TDE A;  4KTT A;  1XNQ C;  2ASB A;  1O93 A;  1VLA A;  3EQ6 A;  4KTV A;  2DYJ A;  5BSM A;  4LFA C;  5BST A;  1QWI A;  4EAT A;  4R0M A;  2UUC C;  2AYA A;  4WS9 A;  3VNQ A;  5LMU C;  4DG9 A;  1USP B;  5AE3 A;  5A1G A;  5FLX D;  2QVZ X;  2EGT A;  3K6R A;  2E5L C;  4B3T C;  4DV0 C;  3T1Y C;  4JI4 C;  2Y4O A;  1MKY A;  5CZV A;  3IEU A;  3G7S A;  1O92 A;  4ZJZ A;  4R1M A;  2D1T A;  4GXQ A;  1HNZ C;  1PA4 A;  2Y4N A;  4LF9 C;  4DCU A;  1HNX C;  3A9U A;  4X66 C;  1IB8 A;  3T1H C;  4DV3 C;  2D7V A;  2KZF A;  2E7G A;  3NPD A;  3VNS A;  3DHV A;  3A25 A;  4JI3 C;  3LGX A;  4OYC A;  1XRA A;  2HJG A;  1WH9 A;  4X65 C;  3UOW A;  4I9F A;  4JI2 C;  5IT9 D;  2MCQ A;  1N32 C;  2M5H A;  2ZZN A;  3LNO A;  3DLP X;  4GS5 A;  4PUI A;  5BSU A;  2P2J A;  1GPM A;  1FLO A;  4LFB C;  1V25 A;  3CQ1 A;  5H9U A;  1YJ7 A;  4GKK C;  3ETO A;  4KHP C;  5IWA C;  4DR3 C;  2QW0 X;  2KDN A;  1K0R A;  2ONF A;  2Z51 A;  1MDB A;  2CXC A;  1V60 A;  3UX2 A;  3ETC A;  5IFI A;  2P02 A;  2E8E A;  4PHT A;  3PES A;  4L4Q A;  2ZZM A;  4OX9 C;  4FUT A;  4G1I A;  2QVY X;  4DCS A;  4BBY A;  2ATW A;  4GXR A;  2DPL A;  4RMN A;  2YX1 A;  4DV2 C;  1T5D X;  2F4V C;  2QL8 A;  4FTF A;  4LE5 A;  1M6X C;  4L2Z A;  2KZ0 A;  1L2F A;  1P7L A;  4DV6 C;  2QVX X;  4GKJ C;  4IR7 A;  4JI6 C;  4LF5 C;  1XMO C;  2UUA C;  2JNV A;  1TH5 A;  2E8F A;  1LQL A;  2YWB A;  5A2Q D;  5KEI A;  3A26 A;  3L8C A;  2P2Q A;  4WV3 A;  3VNR A;  3PBK A;  1M6X A;  3UEB A;  3R9X A;  3R44 A;  3UX3 A;  5GTD A;  4JV5 C;  1MXB A;  3CW9 A;  2CU6 A;  3FCE A;  1LCI A;  3UZ0 A;  3CJE A;  3C5E A;  1IBM C;  2E0G A;  3O2E A;  3TR3 A;  5E7Q A;  3IEV A;  4JI5 C;  2OPL A;  4ODJ A;  1XNR C;  3DAY A;  3LUS A;  2UXD C;  1J5E C; 
#chains in the Genus database with same CATH homology
 4JI0 C;  5BUS A;  1N34 C;  4PZP A;  4LF8 C;  4LF6 C;  2VSQ A;  4JM1 A;  3R9W A;  4DR6 C;  2WP0 C;  2BH1 X;  4D4G A;  5KYT A;  3A9V A;  1UKK A;  4DG8 A;  3RG2 A;  1RY2 A;  3GR1 A;  3KXW A;  3EER A;  4BC9 A;  4RLQ A;  5A19 A;  2YCB A;  3FCC A;  3N2Q A;  5T8S A;  4D4I A;  1IBK C;  5A1I A;  3I07 A;  5BUQ A;  2P2B A;  1MD9 A;  2VQE C;  3PRO C;  5BUR A;  4DR1 C;  2ZM6 C;  4XX2 A;  3A4I A;  3IPL A;  1RG9 A;  2VZE A;  4HPV A;  4DUZ C;  4RVN A;  2WD9 A;  2P2M A;  1ZB9 A;  4I9G A;  3N54 B;  3E7X A;  4DR2 C;  4JI1 C;  2Y27 A;  1AMU A;  2D27 A;  4DUY C;  4B3S C;  1MXC A;  1PG3 A;  4B3M C;  5ADZ A;  4JI8 C;  4DV7 C;  2D1S A;  3NYR A;  1HH2 P;  4FUQ A;  2PRO A;  1JOS A;  4LF4 C;  2OPL B;  3I08 A;  1O9T A;  4DCV A;  5BR8 C;  1O90 A;  5T8T A;  3NYQ A;  2PN2 A;  5CZX A;  4BCA A;  2CY1 A;  4JI7 C;  2VQF C;  2UUB C;  4YHH C;  3TQI A;  5BSR A;  3L95 X;  2XR1 A;  1N2F A;  4DR7 C;  1FUG A;  4YY3 C;  3H2T A;  3RV2 A;  1WF3 A;  2JMP A;  4TPS B;  4RM2 A;  4L7I A;  4NDN A;  3CW8 X;  2PT7 G;  2BJO A;  4X64 C;  3GKU A;  1MXA A;  1N33 C;  1NYE A;  4LF7 C;  4RVO A;  3JAM D;  4G36 A;  4MH4 A;  1ULT A;  1IBL C;  5K8F A;  4B3R C;  4NXM C;  4DV4 C;  4DV5 C;  5LMN C;  5AE2 A;  2P20 A;  1HNW C;  3AF5 A;  4K0B A;  2P2F A;  4IZ6 A;  3B7W A;  4AQY C;  3J81 D;  1BA3 A;  3IML A;  4MTN A;  4BC7 A;  2OO4 A;  4U5Y D;  2V7B A;  2UXB C;  4ISB A;  5BSW A;  2D28 C;  1HR0 C;  2D1R A;  4DR5 C;  2UU9 C;  3E7W A;  4G37 A;  1PG4 A;  2D1Q A;  4R1L A;  1ML8 A;  4RM3 A;  5K85 A;  3OTO C;  5AE1 A;  4NOZ A;  5DV9 A;  3LNV A;  4K0K C;  4NXN C;  4JYA C;  1XRC A;  3AF6 A;  3GR0 A;  1I94 C;  3GPC A;  4X62 C;  2OBV A;  2YWC A;  5KYV A;  1XRB A;  1EGA A;  1MDF A;  3LAX A;  4DCT A;  5BSV A;  4D56 A;  2E8C A;  5JRH A;  1N36 C;  3S82 A;  3J80 D;  2UXC C;  4ZLP A;  1KKG A;  1USP A;  4PRO C;  4RLF A;  1ZB8 A;  4D57 A;  1T5H X;  1QM4 A;  1V26 A;  1XMQ C;  4OXI A;  4DV1 C;  4DR4 C;  1FJG C;  4LFC C;  4BSZ A;  3SO4 A;  2HHH C;  3TUF A;  3NI2 A;  3TDE A;  4KTT A;  1XNQ C;  2ASB A;  1O93 A;  1VLA A;  3EQ6 A;  4KTV A;  2DYJ A;  5BSM A;  4LFA C;  5BST A;  1QWI A;  4EAT A;  4R0M A;  2UUC C;  2AYA A;  4WS9 A;  3VNQ A;  5LMU C;  4DG9 A;  1USP B;  5AE3 A;  5A1G A;  5FLX D;  2QVZ X;  2EGT A;  2E5L C;  4B3T C;  4DV0 C;  3T1Y C;  4JI4 C;  2Y4O A;  1MKY A;  5CZV A;  3IEU A;  3G7S A;  1O92 A;  4ZJZ A;  4R1M A;  2D1T A;  4GXQ A;  1HNZ C;  1PA4 A;  2Y4N A;  4LF9 C;  4DCU A;  1HNX C;  3A9U A;  4X66 C;  3T1H C;  4DV3 C;  2D7V A;  2KZF A;  2E7G A;  3NPD A;  3VNS A;  3DHV A;  4JI3 C;  3LGX A;  4OYC A;  1XRA A;  2HJG A;  1WH9 A;  4X65 C;  3UOW A;  4I9F A;  4JI2 C;  5IT9 D;  1N32 C;  3DLP X;  4GS5 A;  5BSU A;  2P2J A;  1GPM A;  4LFB C;  1V25 A;  5H9U A;  1YJ7 A;  4GKK C;  3ETO A;  4KHP C;  5IWA C;  4DR3 C;  2QW0 X;  1K0R A;  2ONF A;  1MDB A;  2CXC A;  3ETC A;  5IFI A;  2P02 A;  2E8E A;  4PHT A;  3PES A;  4L4Q A;  4OX9 C;  4FUT A;  4G1I A;  2QVY X;  4DCS A;  4BBY A;  2ATW A;  4GXR A;  2DPL A;  4RMN A;  4DV2 C;  1T5D X;  2F4V C;  2QL8 A;  4FTF A;  4LE5 A;  4L2Z A;  1L2F A;  1P7L A;  4DV6 C;  2QVX X;  4GKJ C;  4IR7 A;  4JI6 C;  4LF5 C;  1XMO C;  2UUA C;  2E8F A;  1LQL A;  2YWB A;  5A2Q D;  5KEI A;  3L8C A;  2P2Q A;  4WV3 A;  3VNR A;  3PBK A;  3R9X A;  3R44 A;  5GTD A;  4JV5 C;  1MXB A;  3CW9 A;  3FCE A;  1LCI A;  3UZ0 A;  3CJE A;  3C5E A;  1IBM C;  2E0G A;  5E7Q A;  3IEV A;  4JI5 C;  2OPL A;  4ODJ A;  1XNR C;  3DAY A;  3LUS A;  2UXD C;  1J5E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...