2E0GA

Dnaa n-terminal domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
107
structure length
107
Chain Sequence
SLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQTQPQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Chromosomal replication initiator protein dnaA
publication title Structure and Function of DnaA N-Terminal Domains: Specific Sites and Mechanisms in Inter-DnaA Interaction and in DnaB Helicase Loading on oriC
rcsb
source organism Escherichia coli k12
total genus 17
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11638 DnaA_N DnaA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.180 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e0gA00
2E0GA 2WP0C 4TPSB
chains in the Genus database with same CATH superfamily
3G7SA 5K85A 1PU1A 3GR1A 4LFCC 2D1RA 3PESA 4NOZA 5T8SA 5A2QD 2D1TA 1P7LA 2OO4A 1KKGA 4OX9C 4X66C 4ISBA 1UWDA 5KEIA 3CQ2A 4DUYC 1V26A 1ULTA 1XRCA 2P2FA 2YCBA 5IT9D 4R0MA 4R1MA 1WH9A 4R1LA 1WCJA 2YWBA 5T8TA 4YHHC 5E7QA 4AQYC 2MMAB 3L95X 3L8CA 3SO4A 1HH2P 1XNQC 5BSWA 4RM3A 4RLFA 4NXNC 3UEBA 4JYAC 2OPLA 4JI8C 2QVXX 2OPLB 3RV2A 2ZM6C 3A9VA 3EQ6A 4GS5A 1O9TA 5GTDA 2P2JA 2QVYX 3GPCA 3B7WA 4RLQA 2YX1A 3LUSA 4LF8C 4RVOA 3LNOA 3A9UA 4XX2A 3TUFA 4DV0C 4MTNA 1QM4A 3NYRA 4LF4C 5BSUA 3R9XA 4DV6C 2VQEC 2WP0C 2Y4NA 4I9FA 4JV5C 4DR7C 4ZLPA 4FUQA 3TDEA 5BR8C 4DV3C 4WS9A 1LCIA 1O93A 4LF9C 1LQLA 1L2FA 1XS3A 1ML8A 5LMNC 4TPSB 3IMLA 4PHTA 5BSTA 3I07A 4BCAA 4DUZC 4BC9A 4DV2C 4YY3C 3J81D 2PN2A 4U5YD 4DR2C 4DV4C 4JI7C 2VQFC 2JMPA 2CU6A 4DV1C 3NPDA 1IB8A 2ASBA 3CQ1A 2EGTA 4G36A 4LE5A 4D4GA 4D57A 1IBLC 1TH5A 2PROA 2HHHC 4RVNA 4LFAC 4KHPC 1GPMA 3IPLA 2UU9C 4JI2C 4BSZA 3LGXA 3VNSA 2MM9A 5LMUC 4DR1C 3FCEA 2E7GA 2D1QA 4PUIA 4K0KC 1HNWC 5AE3A 1NY8A 4BBYA 5FLXD 3ETOA 4BC7A 4L2ZA 2E8CA 2KZ0A 5A1GA 3PROC 4L4QA 1ZB8A 5BURA 2VZEA 1XMQC 4GXRA 4JI3C 1MDFA 3OTOC 5AE1A 3T1YC 5CZXA 1IBMC 2P2BA 3J80D 1QWIA 4B3MC 1XRBA 1XRAA 4X64C 4G37A 2CY1A 4MH4A 4PUHA 2DPLA 3CJEA 5BUQA 2M5HA 5ADZA 2UXCC 2P2MA 1N2FA 2QW0X 4G1IA 4ODJA 2ZZNA 2UUCC 2XR1A 5A19A 2P2QA 4NDNA 2ATWA 3A26A 4RMNA 4B3TC 1IBKC 4D4IA 4LFBC 3DHVA 4LF7C 5BSMA 1NYEA 4NXMC 3AY0A 3FCCA 3LNVA 4D56A 2P20A 2AYAA 4DV5C 1N32C 2KZFA 2D1SA 4PZPA 2Z51A 3ETCA 4KTVA 1MXBA 2HJGA 3R44A 2BJOA 4ZJZA 5BSRA 3E7WA 3IEVA 4OYCA 1MDBA 2E8FA 1M6XC 4LF5C 3VNRA 1M6XA 3GKUA 3DLPX 1P4EC 5JRHA 5A1IA 3NYQA 2Y27A 2D27A 1V25A 1VEHA 3N54B 5KYTA 1FJGC 2WD9A 1N33C 1XHJA 1JOSA 1UKKA 1MKYA 1BA3A 3EERA 1HNXC 4DR6C 5AE2A 4X65C 3K6RA 3UX3A 3PBKA 2E5LC 3T1HC 4IZ6A 1N34C 3JAMD 2NCLA 1O90A 4OXIA 3N2QA 4I9GA 3O2EA 1MXAA 4DG8A 4PUGA 2ZZMA 2DYJA 2E8EA 4GKKC 4DV7C 2E0GA 5BSVA 2UXDC 2MCQA 1MXCA 4RM2A 1VLAA 1HNZC 4EATA 1PG4A 1PG3A 2DHMA 4DCSA 2Y4OA 3TR3A 3UX2A 2QL8A 2F4VC 2CXCA 3H2TA 1EGAA 1O92A 2BH1X 3TQIA 1FLOA 1ZB9A 3UOWA 4JI4C 5BUSA 1AMUA 3CW8X 1XNRC 4DR3C 3NI2A 4JM1A 1PA4A 4IR7A 4K0BA 3CQ3A 1T5HX 3A25A 2VSQA 5DV9A 3LAXA 4JI6C 2ONFA 5IFIA 1N36C 4GKJC 4LF6C 3RG2A 1RY2A 4DCVA 4JI1C 4KTTA 1J5EC 4DR5C 2UUAC 3UZ0A 1RG9A 3GR0A 4FUTA 3R9WA 4L7IA 1I94C 1HR0C 4WV3A 4DG9A 3A4IA 1MD9A 4DCTA 1T5DX 3VNQA 1USPA 4FTFA 2V7BA 4PROC 1FUGA 1USPB 2P02A 4GXQA 4JI0C 5K8FA 2QVZX 4B3SC 5IWAC 2D7VA 5KYVA 1WF3A 5LCIA 2KDNA 3AF6A 5H9UA 3IEUA 1YJ7A 2D28C 2JNVA 2M5OA 4DR4C 3KXWA 3CW9A 3S82A 3C5EA 2OBVA 4B3RC 1P4EA 2YWCA 1V60A 3E7XA 5CZVA 3AF5A 4X62C 2UUBC 4JI5C 4HPVA 4DCUA 1XMOC 2UXBC 1K0RA 2PT7G 3DAYA 3I08A
chains in the Genus database with same CATH topology
3G7SA 5K85A 3GR1A 4LFCC 2D1RA 3PESA 4NOZA 5T8SA 5A2QD 2D1TA 1P7LA 2OO4A 1KKGA 4OX9C 4X66C 4ISBA 5KEIA 4DUYC 1V26A 1ULTA 1XRCA 2P2FA 2YCBA 5IT9D 4R0MA 4R1MA 1WH9A 4R1LA 2YWBA 5T8TA 4YHHC 5E7QA 4AQYC 3L95X 3L8CA 3SO4A 1HH2P 1XNQC 5BSWA 4RM3A 4RLFA 4NXNC 4JYAC 2OPLA 4JI8C 2QVXX 2OPLB 3RV2A 2ZM6C 3A9VA 3EQ6A 4GS5A 1O9TA 5GTDA 2P2JA 2QVYX 3GPCA 3B7WA 4RLQA 4LF8C 3LUSA 4RVOA 3A9UA 4XX2A 3TUFA 4DV0C 4MTNA 1QM4A 3NYRA 4LF4C 5BSUA 3R9XA 4DV6C 2VQEC 2WP0C 2Y4NA 4I9FA 4JV5C 4DR7C 4ZLPA 4FUQA 3TDEA 5BR8C 4DV3C 4WS9A 1LCIA 1O93A 4LF9C 1LQLA 1L2FA 1ML8A 5LMNC 4TPSB 3IMLA 4PHTA 5BSTA 3I07A 4BCAA 4DUZC 4BC9A 4DV2C 4YY3C 3J81D 2PN2A 4U5YD 4DR2C 4DV4C 4JI7C 2VQFC 2JMPA 4DV1C 3NPDA 2ASBA 2EGTA 4G36A 4LE5A 4D4GA 4D57A 1IBLC 2PROA 2HHHC 4RVNA 4LFAC 4KHPC 1GPMA 3IPLA 2UU9C 4JI2C 4BSZA 3LGXA 3VNSA 5LMUC 4DR1C 3FCEA 2E7GA 2D1QA 4K0KC 1HNWC 5AE3A 4BBYA 5FLXD 3ETOA 4BC7A 4L2ZA 2E8CA 5A1GA 3PROC 4L4QA 1ZB8A 5BURA 2VZEA 1XMQC 4GXRA 4JI3C 1MDFA 3OTOC 5AE1A 3T1YC 5CZXA 1IBMC 2P2BA 3J80D 1QWIA 4B3MC 1XRBA 1XRAA 4X64C 4G37A 2CY1A 4MH4A 2DPLA 3CJEA 5BUQA 5ADZA 2UXCC 2P2MA 1N2FA 2QW0X 4G1IA 4ODJA 2UUCC 2XR1A 5A19A 2P2QA 4NDNA 2ATWA 4RMNA 4B3TC 1IBKC 4D4IA 4LFBC 3DHVA 4LF7C 5BSMA 1NYEA 4NXMC 3FCCA 3LNVA 4D56A 2P20A 2AYAA 4DV5C 1N32C 2KZFA 2D1SA 4PZPA 3ETCA 4KTVA 1MXBA 2HJGA 3R44A 2BJOA 4ZJZA 5BSRA 3E7WA 3IEVA 4OYCA 1MDBA 2E8FA 4LF5C 3VNRA 3GKUA 3DLPX 5JRHA 5A1IA 3NYQA 2Y27A 2D27A 1V25A 3N54B 5KYTA 1FJGC 2WD9A 1N33C 1JOSA 1UKKA 1MKYA 1BA3A 3EERA 1HNXC 4DR6C 5AE2A 4X65C 3PBKA 2E5LC 3T1HC 4IZ6A 1N34C 3JAMD 1O90A 4OXIA 3N2QA 4I9GA 1MXAA 4DG8A 2DYJA 2E8EA 4GKKC 4DV7C 2E0GA 5BSVA 2UXDC 1MXCA 4RM2A 1VLAA 1HNZC 4EATA 1PG4A 1PG3A 4DCSA 2Y4OA 2QL8A 2F4VC 2CXCA 3H2TA 1EGAA 1O92A 2BH1X 3TQIA 1ZB9A 3UOWA 4JI4C 5BUSA 1AMUA 3CW8X 1XNRC 4DR3C 3NI2A 4JM1A 1PA4A 4IR7A 4K0BA 1T5HX 2VSQA 5DV9A 3LAXA 4JI6C 2ONFA 5IFIA 1N36C 4GKJC 4LF6C 3RG2A 1RY2A 4DCVA 4JI1C 4KTTA 1J5EC 4DR5C 2UUAC 3UZ0A 1RG9A 3GR0A 4FUTA 3R9WA 4L7IA 1I94C 1HR0C 4WV3A 4DG9A 3A4IA 1MD9A 4DCTA 1T5DX 3VNQA 1USPA 4FTFA 2V7BA 4PROC 1FUGA 1USPB 2P02A 4GXQA 4JI0C 5K8FA 2QVZX 4B3SC 5IWAC 2D7VA 5KYVA 1WF3A 3AF6A 5H9UA 3IEUA 1YJ7A 2D28C 4DR4C 3KXWA 3CW9A 3S82A 3C5EA 2OBVA 4B3RC 2YWCA 3E7XA 5CZVA 3AF5A 4X62C 2UUBC 4JI5C 4HPVA 4DCUA 1XMOC 2UXBC 1K0RA 2PT7G 3DAYA 3I08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0G A;  2WP0 C;  4TPS B; 
#chains in the Genus database with same CATH topology
 3G7S A;  5K85 A;  1PU1 A;  3GR1 A;  4LFC C;  2D1R A;  3PES A;  4NOZ A;  5T8S A;  5A2Q D;  2D1T A;  1P7L A;  2OO4 A;  1KKG A;  4OX9 C;  4X66 C;  4ISB A;  1UWD A;  5KEI A;  3CQ2 A;  4DUY C;  1V26 A;  1ULT A;  1XRC A;  2P2F A;  2YCB A;  5IT9 D;  4R0M A;  4R1M A;  1WH9 A;  4R1L A;  1WCJ A;  2YWB A;  5T8T A;  4YHH C;  5E7Q A;  4AQY C;  2MMA B;  3L95 X;  3L8C A;  3SO4 A;  1HH2 P;  1XNQ C;  5BSW A;  4RM3 A;  4RLF A;  4NXN C;  3UEB A;  4JYA C;  2OPL A;  4JI8 C;  2QVX X;  2OPL B;  3RV2 A;  2ZM6 C;  3A9V A;  3EQ6 A;  4GS5 A;  1O9T A;  5GTD A;  2P2J A;  2QVY X;  3GPC A;  3B7W A;  4RLQ A;  2YX1 A;  3LUS A;  4LF8 C;  4RVO A;  3LNO A;  3A9U A;  4XX2 A;  3TUF A;  4DV0 C;  4MTN A;  1QM4 A;  3NYR A;  4LF4 C;  5BSU A;  3R9X A;  4DV6 C;  2VQE C;  2WP0 C;  2Y4N A;  4I9F A;  4JV5 C;  4DR7 C;  4ZLP A;  4FUQ A;  3TDE A;  5BR8 C;  4DV3 C;  4WS9 A;  1LCI A;  1O93 A;  4LF9 C;  1LQL A;  1L2F A;  1XS3 A;  1ML8 A;  5LMN C;  4TPS B;  3IML A;  4PHT A;  5BST A;  3I07 A;  4BCA A;  4DUZ C;  4BC9 A;  4DV2 C;  4YY3 C;  3J81 D;  2PN2 A;  4U5Y D;  4DR2 C;  4DV4 C;  4JI7 C;  2VQF C;  2JMP A;  2CU6 A;  4DV1 C;  3NPD A;  1IB8 A;  2ASB A;  3CQ1 A;  2EGT A;  4G36 A;  4LE5 A;  4D4G A;  4D57 A;  1IBL C;  1TH5 A;  2PRO A;  2HHH C;  4RVN A;  4LFA C;  4KHP C;  1GPM A;  3IPL A;  2UU9 C;  4JI2 C;  4BSZ A;  3LGX A;  3VNS A;  2MM9 A;  5LMU C;  4DR1 C;  3FCE A;  2E7G A;  2D1Q A;  4PUI A;  4K0K C;  1HNW C;  5AE3 A;  1NY8 A;  4BBY A;  5FLX D;  3ETO A;  4BC7 A;  4L2Z A;  2E8C A;  2KZ0 A;  5A1G A;  3PRO C;  4L4Q A;  1ZB8 A;  5BUR A;  2VZE A;  1XMQ C;  4GXR A;  4JI3 C;  1MDF A;  3OTO C;  5AE1 A;  3T1Y C;  5CZX A;  1IBM C;  2P2B A;  3J80 D;  1QWI A;  4B3M C;  1XRB A;  1XRA A;  4X64 C;  4G37 A;  2CY1 A;  4MH4 A;  4PUH A;  2DPL A;  3CJE A;  5BUQ A;  2M5H A;  5ADZ A;  2UXC C;  2P2M A;  1N2F A;  2QW0 X;  4G1I A;  4ODJ A;  2ZZN A;  2UUC C;  2XR1 A;  5A19 A;  2P2Q A;  4NDN A;  2ATW A;  3A26 A;  4RMN A;  4B3T C;  1IBK C;  4D4I A;  4LFB C;  3DHV A;  4LF7 C;  5BSM A;  1NYE A;  4NXM C;  3AY0 A;  3FCC A;  3LNV A;  4D56 A;  2P20 A;  2AYA A;  4DV5 C;  1N32 C;  2KZF A;  2D1S A;  4PZP A;  2Z51 A;  3ETC A;  4KTV A;  1MXB A;  2HJG A;  3R44 A;  2BJO A;  4ZJZ A;  5BSR A;  3E7W A;  3IEV A;  4OYC A;  1MDB A;  2E8F A;  1M6X C;  4LF5 C;  3VNR A;  1M6X A;  3GKU A;  3DLP X;  1P4E C;  5JRH A;  5A1I A;  3NYQ A;  2Y27 A;  2D27 A;  1V25 A;  1VEH A;  3N54 B;  5KYT A;  1FJG C;  2WD9 A;  1N33 C;  1XHJ A;  1JOS A;  1UKK A;  1MKY A;  1BA3 A;  3EER A;  1HNX C;  4DR6 C;  5AE2 A;  4X65 C;  3K6R A;  3UX3 A;  3PBK A;  2E5L C;  3T1H C;  4IZ6 A;  1N34 C;  3JAM D;  2NCL A;  1O90 A;  4OXI A;  3N2Q A;  4I9G A;  3O2E A;  1MXA A;  4DG8 A;  4PUG A;  2ZZM A;  2DYJ A;  2E8E A;  4GKK C;  4DV7 C;  2E0G A;  5BSV A;  2UXD C;  2MCQ A;  1MXC A;  4RM2 A;  1VLA A;  1HNZ C;  4EAT A;  1PG4 A;  1PG3 A;  2DHM A;  4DCS A;  2Y4O A;  3TR3 A;  3UX2 A;  2QL8 A;  2F4V C;  2CXC A;  3H2T A;  1EGA A;  1O92 A;  2BH1 X;  3TQI A;  1FLO A;  1ZB9 A;  3UOW A;  4JI4 C;  5BUS A;  1AMU A;  3CW8 X;  1XNR C;  4DR3 C;  3NI2 A;  4JM1 A;  1PA4 A;  4IR7 A;  4K0B A;  3CQ3 A;  1T5H X;  3A25 A;  2VSQ A;  5DV9 A;  3LAX A;  4JI6 C;  2ONF A;  5IFI A;  1N36 C;  4GKJ C;  4LF6 C;  3RG2 A;  1RY2 A;  4DCV A;  4JI1 C;  4KTT A;  1J5E C;  4DR5 C;  2UUA C;  3UZ0 A;  1RG9 A;  3GR0 A;  4FUT A;  3R9W A;  4L7I A;  1I94 C;  1HR0 C;  4WV3 A;  4DG9 A;  3A4I A;  1MD9 A;  4DCT A;  1T5D X;  3VNQ A;  1USP A;  4FTF A;  2V7B A;  4PRO C;  1FUG A;  1USP B;  2P02 A;  4GXQ A;  4JI0 C;  5K8F A;  2QVZ X;  4B3S C;  5IWA C;  2D7V A;  5KYV A;  1WF3 A;  5LCI A;  2KDN A;  3AF6 A;  5H9U A;  3IEU A;  1YJ7 A;  2D28 C;  2JNV A;  2M5O A;  4DR4 C;  3KXW A;  3CW9 A;  3S82 A;  3C5E A;  2OBV A;  4B3R C;  1P4E A;  2YWC A;  1V60 A;  3E7X A;  5CZV A;  3AF5 A;  4X62 C;  2UUB C;  4JI5 C;  4HPV A;  4DCU A;  1XMO C;  2UXB C;  1K0R A;  2PT7 G;  3DAY A;  3I08 A; 
#chains in the Genus database with same CATH homology
 3G7S A;  5K85 A;  3GR1 A;  4LFC C;  2D1R A;  3PES A;  4NOZ A;  5T8S A;  5A2Q D;  2D1T A;  1P7L A;  2OO4 A;  1KKG A;  4OX9 C;  4X66 C;  4ISB A;  5KEI A;  4DUY C;  1V26 A;  1ULT A;  1XRC A;  2P2F A;  2YCB A;  5IT9 D;  4R0M A;  4R1M A;  1WH9 A;  4R1L A;  2YWB A;  5T8T A;  4YHH C;  5E7Q A;  4AQY C;  3L95 X;  3L8C A;  3SO4 A;  1HH2 P;  1XNQ C;  5BSW A;  4RM3 A;  4RLF A;  4NXN C;  4JYA C;  2OPL A;  4JI8 C;  2QVX X;  2OPL B;  3RV2 A;  2ZM6 C;  3A9V A;  3EQ6 A;  4GS5 A;  1O9T A;  5GTD A;  2P2J A;  2QVY X;  3GPC A;  3B7W A;  4RLQ A;  4LF8 C;  3LUS A;  4RVO A;  3A9U A;  4XX2 A;  3TUF A;  4DV0 C;  4MTN A;  1QM4 A;  3NYR A;  4LF4 C;  5BSU A;  3R9X A;  4DV6 C;  2VQE C;  2WP0 C;  2Y4N A;  4I9F A;  4JV5 C;  4DR7 C;  4ZLP A;  4FUQ A;  3TDE A;  5BR8 C;  4DV3 C;  4WS9 A;  1LCI A;  1O93 A;  4LF9 C;  1LQL A;  1L2F A;  1ML8 A;  5LMN C;  4TPS B;  3IML A;  4PHT A;  5BST A;  3I07 A;  4BCA A;  4DUZ C;  4BC9 A;  4DV2 C;  4YY3 C;  3J81 D;  2PN2 A;  4U5Y D;  4DR2 C;  4DV4 C;  4JI7 C;  2VQF C;  2JMP A;  4DV1 C;  3NPD A;  2ASB A;  2EGT A;  4G36 A;  4LE5 A;  4D4G A;  4D57 A;  1IBL C;  2PRO A;  2HHH C;  4RVN A;  4LFA C;  4KHP C;  1GPM A;  3IPL A;  2UU9 C;  4JI2 C;  4BSZ A;  3LGX A;  3VNS A;  5LMU C;  4DR1 C;  3FCE A;  2E7G A;  2D1Q A;  4K0K C;  1HNW C;  5AE3 A;  4BBY A;  5FLX D;  3ETO A;  4BC7 A;  4L2Z A;  2E8C A;  5A1G A;  3PRO C;  4L4Q A;  1ZB8 A;  5BUR A;  2VZE A;  1XMQ C;  4GXR A;  4JI3 C;  1MDF A;  3OTO C;  5AE1 A;  3T1Y C;  5CZX A;  1IBM C;  2P2B A;  3J80 D;  1QWI A;  4B3M C;  1XRB A;  1XRA A;  4X64 C;  4G37 A;  2CY1 A;  4MH4 A;  2DPL A;  3CJE A;  5BUQ A;  5ADZ A;  2UXC C;  2P2M A;  1N2F A;  2QW0 X;  4G1I A;  4ODJ A;  2UUC C;  2XR1 A;  5A19 A;  2P2Q A;  4NDN A;  2ATW A;  4RMN A;  4B3T C;  1IBK C;  4D4I A;  4LFB C;  3DHV A;  4LF7 C;  5BSM A;  1NYE A;  4NXM C;  3FCC A;  3LNV A;  4D56 A;  2P20 A;  2AYA A;  4DV5 C;  1N32 C;  2KZF A;  2D1S A;  4PZP A;  3ETC A;  4KTV A;  1MXB A;  2HJG A;  3R44 A;  2BJO A;  4ZJZ A;  5BSR A;  3E7W A;  3IEV A;  4OYC A;  1MDB A;  2E8F A;  4LF5 C;  3VNR A;  3GKU A;  3DLP X;  5JRH A;  5A1I A;  3NYQ A;  2Y27 A;  2D27 A;  1V25 A;  3N54 B;  5KYT A;  1FJG C;  2WD9 A;  1N33 C;  1JOS A;  1UKK A;  1MKY A;  1BA3 A;  3EER A;  1HNX C;  4DR6 C;  5AE2 A;  4X65 C;  3PBK A;  2E5L C;  3T1H C;  4IZ6 A;  1N34 C;  3JAM D;  1O90 A;  4OXI A;  3N2Q A;  4I9G A;  1MXA A;  4DG8 A;  2DYJ A;  2E8E A;  4GKK C;  4DV7 C;  2E0G A;  5BSV A;  2UXD C;  1MXC A;  4RM2 A;  1VLA A;  1HNZ C;  4EAT A;  1PG4 A;  1PG3 A;  4DCS A;  2Y4O A;  2QL8 A;  2F4V C;  2CXC A;  3H2T A;  1EGA A;  1O92 A;  2BH1 X;  3TQI A;  1ZB9 A;  3UOW A;  4JI4 C;  5BUS A;  1AMU A;  3CW8 X;  1XNR C;  4DR3 C;  3NI2 A;  4JM1 A;  1PA4 A;  4IR7 A;  4K0B A;  1T5H X;  2VSQ A;  5DV9 A;  3LAX A;  4JI6 C;  2ONF A;  5IFI A;  1N36 C;  4GKJ C;  4LF6 C;  3RG2 A;  1RY2 A;  4DCV A;  4JI1 C;  4KTT A;  1J5E C;  4DR5 C;  2UUA C;  3UZ0 A;  1RG9 A;  3GR0 A;  4FUT A;  3R9W A;  4L7I A;  1I94 C;  1HR0 C;  4WV3 A;  4DG9 A;  3A4I A;  1MD9 A;  4DCT A;  1T5D X;  3VNQ A;  1USP A;  4FTF A;  2V7B A;  4PRO C;  1FUG A;  1USP B;  2P02 A;  4GXQ A;  4JI0 C;  5K8F A;  2QVZ X;  4B3S C;  5IWA C;  2D7V A;  5KYV A;  1WF3 A;  3AF6 A;  5H9U A;  3IEU A;  1YJ7 A;  2D28 C;  4DR4 C;  3KXW A;  3CW9 A;  3S82 A;  3C5E A;  2OBV A;  4B3R C;  2YWC A;  3E7X A;  5CZV A;  3AF5 A;  4X62 C;  2UUB C;  4JI5 C;  4HPV A;  4DCU A;  1XMO C;  2UXB C;  1K0R A;  2PT7 G;  3DAY A;  3I08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...