1VEHA

Solution structure of rsgi ruh-018, a nifu-like domain of hirip5 protein from mouse cdna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
GSSGSSGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-018, a NifU-like domain of hirip5 protein from mouse cDNA
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords NifU-like protein HIRIP5
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1vehA01
3CQ1A 1WCJA 3CQ3A 2M5HA 1VEHA 3UX3A 1TH5A 2JNVA 2Z51A 1UWDA 3UX2A 3LNOA 2CU6A 1XHJA 2M5OA 3CQ2A
chains in the Genus database with same CATH superfamily
2Y4NA 1XRCA 5H9UA 1VLAA 1MXCA 3NYQA 1IBMC 1MXAA 4TPSB 2MM9A 2HJGA 1P4EC 4LFAC 2YX1A 1O90A 4JI8C 4DV1C 5IWAC 5BSUA 1O93A 4B3MC 1XRBA 1PA4A 4KTVA 2D1RA 3IMLA 4PHTA 4KTTA 4B3RC 1FUGA 4L4QA 1NYEA 4BCAA 3LGXA 5KYTA 4JI7C 4NDNA 2F4VC 2PROA 5K8FA 4JI0C 5BSWA 4DR4C 1BA3A 4R1MA 3SO4A 4DV3C 4B3TC 2UUCC 1M6XA 3IEVA 1V26A 2E7GA 3VNRA 5LMUC 1WF3A 1HNWC 4LFBC 1O9TA 2OBVA 4RLQA 1P7LA 2KZ0A 5BSVA 2E0GA 4DUZC 4EATA 2JMPA 4D57A 5A1GA 2MCQA 3DAYA 2DYJA 4D4GA 4KHPC 1PU1A 3CJEA 4X65C 5DV9A 5K85A 1IBLC 2AYAA 4BC9A 2M5OA 2UUAC 2ATWA 5IFIA 1HR0C 4LFCC 3TDEA 3G7SA 1XNQC 1L2FA 1VEHA 3EERA 4FTFA 2P2FA 3AY0A 3LAXA 2QVXX 1HNXC 2Y4OA 5BR8C 2P20A 3L8CA 3T1YC 4PROC 1USPB 4K0BA 2D7VA 5E7QA 2VQEC 1XRAA 1XMQC 4DV4C 3EQ6A 3N2QA 4WV3A 2VQFC 4DV5C 4DR2C 3PBKA 4L2ZA 4RVOA 2DHMA 2D1TA 3RG2A 1WCJA 4PUIA 3IEUA 4PUGA 3A4IA 3OTOC 2UXDC 3I08A 1ZB9A 3B7WA 1RG9A 3FCEA 1V60A 1EGAA 1NY8A 2CXCA 4BBYA 2PT7G 4DR1C 4R1LA 4DR3C 3FCCA 5LMNC 2VZEA 2P2BA 4MTNA 4X62C 4AQYC 4JI4C 2Z51A 1N2FA 3S82A 1N32C 2QW0X 1USPA 1UKKA 4DCTA 3LNOA 4X66C 3N54B 5A2QD 2UU9C 4LF9C 5T8SA 2YWCA 4JYAC 4JI3C 1HNZC 1K0RA 1N36C 3TR3A 2Y27A 2PN2A 4JV5C 4JI2C 3CQ3A 5JRHA 4YHHC 4OYCA 2D1QA 1AMUA 4DCVA 3UX2A 1JOSA 3GR1A 4PZPA 4JI6C 5IT9D 2QVYX 1M6XC 4JI5C 4RM3A 2VSQA 3RV2A 4IZ6A 3PESA 2WP0C 3IPLA 3NI2A 2QL8A 4BSZA 5BURA 4DR5C 4ZLPA 1T5DX 1XHJA 2HHHC 2ZZNA 3E7WA 4RVNA 3GR0A 2JNVA 1XNRC 4U5YD 5A1IA 4NXMC 4I9FA 3AF6A 4LF6C 3ETCA 3UOWA 1N33C 3O2EA 3E7XA 2UXCC 2BH1X 2WD9A 3I07A 4LF4C 4GXQA 4R0MA 1T5HX 2KZFA 2CU6A 1O92A 1YJ7A 3K6RA 5LCIA 3LUSA 4WS9A 3A26A 1PG4A 2ZZMA 2D28C 1P4EA 2E5LC 4LF8C 1MD9A 1I94C 3C5EA 3J81D 4YY3C 5T8TA 2ZM6C 2M5HA 2UXBC 4PUHA 3J80D 1ML8A 3GPCA 3UEBA 2D27A 3A9VA 4DCUA 3GKUA 1V25A 3VNSA 2P2JA 2ONFA 1XS3A 4X64C 2OO4A 3A25A 2DPLA 1MDBA 1HH2P 2CY1A 4JI1C 2E8CA 3DHVA 3KXWA 4GKKC 2OPLA 3LNVA 4DV0C 4K0KC 4DG8A 4G37A 4BC7A 4RM2A 4OX9C 4DV2C 2EGTA 4NOZA 4G36A 5BSRA 4GS5A 5BSTA 4DG9A 1N34C 3CW9A 4HPVA 3L95X 4D4IA 1J5EC 3TUFA 1IBKC 3PROC 4ZJZA 2YCBA 4DUYC 4B3SC 1MDFA 4ODJA 2XR1A 4FUQA 1UWDA 2P02A 3AF5A 3CW8X 2BJOA 2E8EA 5CZVA 5AE3A 4DV6C 2YWBA 4RMNA 3VNQA 5FLXD 1ZB8A 5A19A 4OXIA 4DV7C 1RY2A 3DLPX 5BSMA 2NCLA 3A9UA 4G1IA 5GTDA 3R44A 1WH9A 2KDNA 2P2MA 4I9GA 5KYVA 3T1HC 5KEIA 3JAMD 3R9XA 3ETOA 4ISBA 1MXBA 3NPDA 2E8FA 3CQ2A 2QVZX 1ULTA 4L7IA 5CZXA 3R9WA 1QWIA 1KKGA 3NYRA 1LCIA 4LF7C 1GPMA 5ADZA 2MMAB 1IB8A 4JM1A 4GXRA 1QM4A 1MKYA 5BUSA 5AE1A 1PG3A 4DR7C 4DR6C 1FLOA 2V7BA 2UUBC 4D56A 4GKJC 4MH4A 3H2TA 4IR7A 1LQLA 2OPLB 1XMOC 3CQ1A 2D1SA 2ASBA 4RLFA 4LF5C 4NXNC 2P2QA 1TH5A 5AE2A 4LE5A 4FUTA 5BUQA 1FJGC 3UZ0A 3TQIA 4DCSA 3UX3A 4XX2A
chains in the Genus database with same CATH topology
3CQ1A 1WCJA 3CQ3A 2M5HA 1VEHA 3UX3A 1TH5A 2JNVA 2Z51A 1UWDA 3UX2A 3LNOA 2CU6A 1XHJA 2M5OA 3CQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ1 A;  1WCJ A;  3CQ3 A;  2M5H A;  1VEH A;  3UX3 A;  1TH5 A;  2JNV A;  2Z51 A;  1UWD A;  3UX2 A;  3LNO A;  2CU6 A;  1XHJ A;  2M5O A;  3CQ2 A; 
#chains in the Genus database with same CATH topology
 2Y4N A;  1XRC A;  5H9U A;  1VLA A;  1MXC A;  3NYQ A;  1IBM C;  1MXA A;  4TPS B;  2MM9 A;  2HJG A;  1P4E C;  4LFA C;  2YX1 A;  1O90 A;  4JI8 C;  4DV1 C;  5IWA C;  5BSU A;  1O93 A;  4B3M C;  1XRB A;  1PA4 A;  4KTV A;  2D1R A;  3IML A;  4PHT A;  4KTT A;  4B3R C;  1FUG A;  4L4Q A;  1NYE A;  4BCA A;  3LGX A;  5KYT A;  4JI7 C;  4NDN A;  2F4V C;  2PRO A;  5K8F A;  4JI0 C;  5BSW A;  4DR4 C;  1BA3 A;  4R1M A;  3SO4 A;  4DV3 C;  4B3T C;  2UUC C;  1M6X A;  3IEV A;  1V26 A;  2E7G A;  3VNR A;  5LMU C;  1WF3 A;  1HNW C;  4LFB C;  1O9T A;  2OBV A;  4RLQ A;  1P7L A;  2KZ0 A;  5BSV A;  2E0G A;  4DUZ C;  4EAT A;  2JMP A;  4D57 A;  5A1G A;  2MCQ A;  3DAY A;  2DYJ A;  4D4G A;  4KHP C;  1PU1 A;  3CJE A;  4X65 C;  5DV9 A;  5K85 A;  1IBL C;  2AYA A;  4BC9 A;  2M5O A;  2UUA C;  2ATW A;  5IFI A;  1HR0 C;  4LFC C;  3TDE A;  3G7S A;  1XNQ C;  1L2F A;  1VEH A;  3EER A;  4FTF A;  2P2F A;  3AY0 A;  3LAX A;  2QVX X;  1HNX C;  2Y4O A;  5BR8 C;  2P20 A;  3L8C A;  3T1Y C;  4PRO C;  1USP B;  4K0B A;  2D7V A;  5E7Q A;  2VQE C;  1XRA A;  1XMQ C;  4DV4 C;  3EQ6 A;  3N2Q A;  4WV3 A;  2VQF C;  4DV5 C;  4DR2 C;  3PBK A;  4L2Z A;  4RVO A;  2DHM A;  2D1T A;  3RG2 A;  1WCJ A;  4PUI A;  3IEU A;  4PUG A;  3A4I A;  3OTO C;  2UXD C;  3I08 A;  1ZB9 A;  3B7W A;  1RG9 A;  3FCE A;  1V60 A;  1EGA A;  1NY8 A;  2CXC A;  4BBY A;  2PT7 G;  4DR1 C;  4R1L A;  4DR3 C;  3FCC A;  5LMN C;  2VZE A;  2P2B A;  4MTN A;  4X62 C;  4AQY C;  4JI4 C;  2Z51 A;  1N2F A;  3S82 A;  1N32 C;  2QW0 X;  1USP A;  1UKK A;  4DCT A;  3LNO A;  4X66 C;  3N54 B;  5A2Q D;  2UU9 C;  4LF9 C;  5T8S A;  2YWC A;  4JYA C;  4JI3 C;  1HNZ C;  1K0R A;  1N36 C;  3TR3 A;  2Y27 A;  2PN2 A;  4JV5 C;  4JI2 C;  3CQ3 A;  5JRH A;  4YHH C;  4OYC A;  2D1Q A;  1AMU A;  4DCV A;  3UX2 A;  1JOS A;  3GR1 A;  4PZP A;  4JI6 C;  5IT9 D;  2QVY X;  1M6X C;  4JI5 C;  4RM3 A;  2VSQ A;  3RV2 A;  4IZ6 A;  3PES A;  2WP0 C;  3IPL A;  3NI2 A;  2QL8 A;  4BSZ A;  5BUR A;  4DR5 C;  4ZLP A;  1T5D X;  1XHJ A;  2HHH C;  2ZZN A;  3E7W A;  4RVN A;  3GR0 A;  2JNV A;  1XNR C;  4U5Y D;  5A1I A;  4NXM C;  4I9F A;  3AF6 A;  4LF6 C;  3ETC A;  3UOW A;  1N33 C;  3O2E A;  3E7X A;  2UXC C;  2BH1 X;  2WD9 A;  3I07 A;  4LF4 C;  4GXQ A;  4R0M A;  1T5H X;  2KZF A;  2CU6 A;  1O92 A;  1YJ7 A;  3K6R A;  5LCI A;  3LUS A;  4WS9 A;  3A26 A;  1PG4 A;  2ZZM A;  2D28 C;  1P4E A;  2E5L C;  4LF8 C;  1MD9 A;  1I94 C;  3C5E A;  3J81 D;  4YY3 C;  5T8T A;  2ZM6 C;  2M5H A;  2UXB C;  4PUH A;  3J80 D;  1ML8 A;  3GPC A;  3UEB A;  2D27 A;  3A9V A;  4DCU A;  3GKU A;  1V25 A;  3VNS A;  2P2J A;  2ONF A;  1XS3 A;  4X64 C;  2OO4 A;  3A25 A;  2DPL A;  1MDB A;  1HH2 P;  2CY1 A;  4JI1 C;  2E8C A;  3DHV A;  3KXW A;  4GKK C;  2OPL A;  3LNV A;  4DV0 C;  4K0K C;  4DG8 A;  4G37 A;  4BC7 A;  4RM2 A;  4OX9 C;  4DV2 C;  2EGT A;  4NOZ A;  4G36 A;  5BSR A;  4GS5 A;  5BST A;  4DG9 A;  1N34 C;  3CW9 A;  4HPV A;  3L95 X;  4D4I A;  1J5E C;  3TUF A;  1IBK C;  3PRO C;  4ZJZ A;  2YCB A;  4DUY C;  4B3S C;  1MDF A;  4ODJ A;  2XR1 A;  4FUQ A;  1UWD A;  2P02 A;  3AF5 A;  3CW8 X;  2BJO A;  2E8E A;  5CZV A;  5AE3 A;  4DV6 C;  2YWB A;  4RMN A;  3VNQ A;  5FLX D;  1ZB8 A;  5A19 A;  4OXI A;  4DV7 C;  1RY2 A;  3DLP X;  5BSM A;  2NCL A;  3A9U A;  4G1I A;  5GTD A;  3R44 A;  1WH9 A;  2KDN A;  2P2M A;  4I9G A;  5KYV A;  3T1H C;  5KEI A;  3JAM D;  3R9X A;  3ETO A;  4ISB A;  1MXB A;  3NPD A;  2E8F A;  3CQ2 A;  2QVZ X;  1ULT A;  4L7I A;  5CZX A;  3R9W A;  1QWI A;  1KKG A;  3NYR A;  1LCI A;  4LF7 C;  1GPM A;  5ADZ A;  2MMA B;  1IB8 A;  4JM1 A;  4GXR A;  1QM4 A;  1MKY A;  5BUS A;  5AE1 A;  1PG3 A;  4DR7 C;  4DR6 C;  1FLO A;  2V7B A;  2UUB C;  4D56 A;  4GKJ C;  4MH4 A;  3H2T A;  4IR7 A;  1LQL A;  2OPL B;  1XMO C;  3CQ1 A;  2D1S A;  2ASB A;  4RLF A;  4LF5 C;  4NXN C;  2P2Q A;  1TH5 A;  5AE2 A;  4LE5 A;  4FUT A;  5BUQ A;  1FJG C;  3UZ0 A;  3TQI A;  4DCS A;  3UX3 A;  4XX2 A; 
#chains in the Genus database with same CATH homology
 3CQ1 A;  1WCJ A;  3CQ3 A;  2M5H A;  1VEH A;  3UX3 A;  1TH5 A;  2JNV A;  2Z51 A;  1UWD A;  3UX2 A;  3LNO A;  2CU6 A;  1XHJ A;  2M5O A;  3CQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...