1VEHA

Solution structure of rsgi ruh-018, a nifu-like domain of hirip5 protein from mouse cdna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
GSSGSSGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RSGI RUH-018, a NifU-like domain of hirip5 protein from mouse cDNA
rcsb
molecule keywords NifU-like protein HIRIP5
molecule tags Structural genomics, unknown function
source organism Mus musculus
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 1vehA01
1VEHA 2M5OA 3UX3A 2Z51A 1WCJA 3CQ1A 3CQ2A 1UWDA 3CQ3A 1TH5A 2M5HA 3LNOA 3UX2A 1XHJA 2CU6A 2JNVA
chains in the Genus database with same CATH superfamily
1K0RA 1TH5A 5A1IA 4DG8A 4NOZA 2NCLA 4DR7C 1IBMC 2AYAA 4TPSB 2UU9C 2P2QA 2QW0X 5LMNC 4B3SC 2E5LC 4X66C 4LF7C 3A9VA 5AE1A 5KEIA 1XMOC 2QVYX 3DLPX 4DR2C 1N33C 4X65C 1O9TA 2D1QA 4LF9C 3TQIA 2ZM6C 1MKYA 5CZVA 4FUTA 4I9GA 4DCUA 2PROA 4PUIA 3K6RA 1WCJA 3IPLA 1XRCA 1XS3A 1XRAA 1O90A 1NYEA 2EGTA 1USPB 1HH2P 4BBYA 4L4QA 1JOSA 3LNOA 4NXNC 3CQ2A 4U5YD 4JM1A 2M5HA 3E7WA 4PHTA 2KDNA 1ZB9A 3FCEA 4MH4A 4BC9A 3J81D 4RM2A 4IR7A 5CZXA 1QM4A 5E7QA 1XMQC 4RLFA 2CU6A 4BCAA 2Z51A 3L95X 1IBLC 4LF6C 4RM3A 4DUZC 2PT7G 3GPCA 2YWBA 3A26A 3A25A 3EQ6A 3UOWA 4FUQA 2MMAB 3ETCA 4EATA 5BURA 3CW8X 2MM9A 5BUSA 5JRHA 5KYTA 5BSVA 4ZJZA 1ML8A 3AF6A 1MD9A 4JI4C 5IT9D 1V25A 2ZZMA 2M5OA 3SO4A 3E7XA 1LCIA 5AE3A 2HJGA 5LCIA 3KXWA 4BC7A 4LFBC 1MDBA 4OX9C 1KKGA 5BSUA 4KTVA 2E8CA 3FCCA 2OO4A 3N2QA 2E8FA 1IBKC 1IB8A 5IWAC 4DR6C 3R9WA 5H9UA 1USPA 3R44A 3R9XA 4HPVA 5AE2A 1N34C 4LFCC 1MXAA 4PZPA 4DCSA 2DHMA 3VNSA 4DV5C 3DAYA 3UEBA 4NDNA 4OYCA 2DYJA 2ATWA 3TR3A 2BH1X 4JI8C 2UUBC 4LFAC 4D4GA 5IFIA 3OTOC 1T5HX 2CXCA 1XNRC 4LF5C 3B7WA 4L2ZA 1HR0C 2KZ0A 2UUAC 4DV3C 4DV4C 3IMLA 4WV3A 1FUGA 1ZB8A 1WH9A 1MXCA 4D56A 1L2FA 4DR1C 4GKKC 3A4IA 2ONFA 3AF5A 1P4EA 1O93A 2P2MA 3UZ0A 2Y27A 4JI1C 3J80D 2V7BA 1WF3A 3C5EA 5BSTA 3DHVA 5A2QD 3I07A 4DV7C 4R1MA 4ODJA 4D4IA 2D1SA 4R0MA 4K0BA 1M6XA 2P2FA 4IZ6A 2YCBA 2YWCA 3EERA 2DPLA 2VSQA 5FLXD 4KTTA 2MCQA 4JI7C 4L7IA 3RG2A 4B3TC 3GR1A 4JI6C 1RY2A 4FTFA 4DUYC 5A1GA 1MXBA 4DCTA 5BSRA 4DR4C 3N54B 4DG9A 3LAXA 5LMUC 1AMUA 3NI2A 5KYVA 3CW9A 4RMNA 2KZFA 2UXDC 2QVZX 3G7SA 3T1YC 2OPLA 2QL8A 4YY3C 3GR0A 1O92A 3CQ1A 2ASBA 4KHPC 3H2TA 5T8TA 2Y4OA 3GKUA 4MTNA 4X64C 2XR1A 4B3MC 1QWIA 4ZLPA 4LE5A 1FLOA 2P20A 1I94C 1N36C 2VQFC 4DR5C 1FJGC 3PESA 1P4EC 3ETOA 1ULTA 4GXRA 4X62C 2UUCC 4DV0C 1PG4A 3RV2A 2OPLB 2E0GA 4PUHA 3S82A 3IEVA 4JI3C 4DV6C 1VEHA 4LF8C 4GKJC 4DCVA 4DV2C 5GTDA 1T5DX 1M6XC 2UXBC 3O2EA 3A9UA 3TDEA 3VNQA 2E7GA 1V60A 2ZZNA 2BJOA 2VZEA 4G36A 4PROC 3LNVA 4DR3C 5BR8C 1XNQC 5K85A 4RVNA 4LF4C 3TUFA 3NYRA 1HNZC 2P2BA 2YX1A 3IEUA 3JAMD 4AQYC 4G37A 2UXCC 4JV5C 3NYQA 2D1TA 4WS9A 1J5EC 2OBVA 1XHJA 4R1LA 4G1IA 3NPDA 1RG9A 2P02A 4D57A 2D28C 3LGXA 1PU1A 4XX2A 1MDFA 3PBKA 5DV9A 5BSMA 5A19A 1PA4A 4PUGA 1XRBA 4JYAC 2F4VC 4BSZA 5K8FA 1UWDA 1VLAA 4B3RC 5ADZA 1P7LA 4GS5A 3T1HC 4YHHC 1HNWC 4DV1C 3VNRA 3CJEA 3UX2A 1NY8A 3I08A 2WD9A 2D27A 3CQ3A 1EGAA 2HHHC 2QVXX 3PROC 4NXMC 2VQEC 2CY1A 4K0KC 1HNXC 4I9FA 4JI0C 5T8SA 2P2JA 2Y4NA 1LQLA 1V26A 3UX3A 1GPMA 2PN2A 4JI2C 2D1RA 4RLQA 3L8CA 4OXIA 1N32C 3LUSA 1PG3A 2JMPA 1BA3A 3AY0A 1N2FA 1YJ7A 5BSWA 5BUQA 4GXQA 1UKKA 2D7VA 2WP0C 4JI5C 2E8EA 4ISBA 4RVOA 2JNVA
chains in the Genus database with same CATH topology
1VEHA 2M5OA 3UX3A 2Z51A 1WCJA 3CQ1A 3CQ2A 1UWDA 3CQ3A 1TH5A 2M5HA 3LNOA 3UX2A 1XHJA 2CU6A 2JNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VEH A;  2M5O A;  3UX3 A;  2Z51 A;  1WCJ A;  3CQ1 A;  3CQ2 A;  1UWD A;  3CQ3 A;  1TH5 A;  2M5H A;  3LNO A;  3UX2 A;  1XHJ A;  2CU6 A;  2JNV A; 
#chains in the Genus database with same CATH topology
 1K0R A;  1TH5 A;  5A1I A;  4DG8 A;  4NOZ A;  2NCL A;  4DR7 C;  1IBM C;  2AYA A;  4TPS B;  2UU9 C;  2P2Q A;  2QW0 X;  5LMN C;  4B3S C;  2E5L C;  4X66 C;  4LF7 C;  3A9V A;  5AE1 A;  5KEI A;  1XMO C;  2QVY X;  3DLP X;  4DR2 C;  1N33 C;  4X65 C;  1O9T A;  2D1Q A;  4LF9 C;  3TQI A;  2ZM6 C;  1MKY A;  5CZV A;  4FUT A;  4I9G A;  4DCU A;  2PRO A;  4PUI A;  3K6R A;  1WCJ A;  3IPL A;  1XRC A;  1XS3 A;  1XRA A;  1O90 A;  1NYE A;  2EGT A;  1USP B;  1HH2 P;  4BBY A;  4L4Q A;  1JOS A;  3LNO A;  4NXN C;  3CQ2 A;  4U5Y D;  4JM1 A;  2M5H A;  3E7W A;  4PHT A;  2KDN A;  1ZB9 A;  3FCE A;  4MH4 A;  4BC9 A;  3J81 D;  4RM2 A;  4IR7 A;  5CZX A;  1QM4 A;  5E7Q A;  1XMQ C;  4RLF A;  2CU6 A;  4BCA A;  2Z51 A;  3L95 X;  1IBL C;  4LF6 C;  4RM3 A;  4DUZ C;  2PT7 G;  3GPC A;  2YWB A;  3A26 A;  3A25 A;  3EQ6 A;  3UOW A;  4FUQ A;  2MMA B;  3ETC A;  4EAT A;  5BUR A;  3CW8 X;  2MM9 A;  5BUS A;  5JRH A;  5KYT A;  5BSV A;  4ZJZ A;  1ML8 A;  3AF6 A;  1MD9 A;  4JI4 C;  5IT9 D;  1V25 A;  2ZZM A;  2M5O A;  3SO4 A;  3E7X A;  1LCI A;  5AE3 A;  2HJG A;  5LCI A;  3KXW A;  4BC7 A;  4LFB C;  1MDB A;  4OX9 C;  1KKG A;  5BSU A;  4KTV A;  2E8C A;  3FCC A;  2OO4 A;  3N2Q A;  2E8F A;  1IBK C;  1IB8 A;  5IWA C;  4DR6 C;  3R9W A;  5H9U A;  1USP A;  3R44 A;  3R9X A;  4HPV A;  5AE2 A;  1N34 C;  4LFC C;  1MXA A;  4PZP A;  4DCS A;  2DHM A;  3VNS A;  4DV5 C;  3DAY A;  3UEB A;  4NDN A;  4OYC A;  2DYJ A;  2ATW A;  3TR3 A;  2BH1 X;  4JI8 C;  2UUB C;  4LFA C;  4D4G A;  5IFI A;  3OTO C;  1T5H X;  2CXC A;  1XNR C;  4LF5 C;  3B7W A;  4L2Z A;  1HR0 C;  2KZ0 A;  2UUA C;  4DV3 C;  4DV4 C;  3IML A;  4WV3 A;  1FUG A;  1ZB8 A;  1WH9 A;  1MXC A;  4D56 A;  1L2F A;  4DR1 C;  4GKK C;  3A4I A;  2ONF A;  3AF5 A;  1P4E A;  1O93 A;  2P2M A;  3UZ0 A;  2Y27 A;  4JI1 C;  3J80 D;  2V7B A;  1WF3 A;  3C5E A;  5BST A;  3DHV A;  5A2Q D;  3I07 A;  4DV7 C;  4R1M A;  4ODJ A;  4D4I A;  2D1S A;  4R0M A;  4K0B A;  1M6X A;  2P2F A;  4IZ6 A;  2YCB A;  2YWC A;  3EER A;  2DPL A;  2VSQ A;  5FLX D;  4KTT A;  2MCQ A;  4JI7 C;  4L7I A;  3RG2 A;  4B3T C;  3GR1 A;  4JI6 C;  1RY2 A;  4FTF A;  4DUY C;  5A1G A;  1MXB A;  4DCT A;  5BSR A;  4DR4 C;  3N54 B;  4DG9 A;  3LAX A;  5LMU C;  1AMU A;  3NI2 A;  5KYV A;  3CW9 A;  4RMN A;  2KZF A;  2UXD C;  2QVZ X;  3G7S A;  3T1Y C;  2OPL A;  2QL8 A;  4YY3 C;  3GR0 A;  1O92 A;  3CQ1 A;  2ASB A;  4KHP C;  3H2T A;  5T8T A;  2Y4O A;  3GKU A;  4MTN A;  4X64 C;  2XR1 A;  4B3M C;  1QWI A;  4ZLP A;  4LE5 A;  1FLO A;  2P20 A;  1I94 C;  1N36 C;  2VQF C;  4DR5 C;  1FJG C;  3PES A;  1P4E C;  3ETO A;  1ULT A;  4GXR A;  4X62 C;  2UUC C;  4DV0 C;  1PG4 A;  3RV2 A;  2OPL B;  2E0G A;  4PUH A;  3S82 A;  3IEV A;  4JI3 C;  4DV6 C;  1VEH A;  4LF8 C;  4GKJ C;  4DCV A;  4DV2 C;  5GTD A;  1T5D X;  1M6X C;  2UXB C;  3O2E A;  3A9U A;  3TDE A;  3VNQ A;  2E7G A;  1V60 A;  2ZZN A;  2BJO A;  2VZE A;  4G36 A;  4PRO C;  3LNV A;  4DR3 C;  5BR8 C;  1XNQ C;  5K85 A;  4RVN A;  4LF4 C;  3TUF A;  3NYR A;  1HNZ C;  2P2B A;  2YX1 A;  3IEU A;  3JAM D;  4AQY C;  4G37 A;  2UXC C;  4JV5 C;  3NYQ A;  2D1T A;  4WS9 A;  1J5E C;  2OBV A;  1XHJ A;  4R1L A;  4G1I A;  3NPD A;  1RG9 A;  2P02 A;  4D57 A;  2D28 C;  3LGX A;  1PU1 A;  4XX2 A;  1MDF A;  3PBK A;  5DV9 A;  5BSM A;  5A19 A;  1PA4 A;  4PUG A;  1XRB A;  4JYA C;  2F4V C;  4BSZ A;  5K8F A;  1UWD A;  1VLA A;  4B3R C;  5ADZ A;  1P7L A;  4GS5 A;  3T1H C;  4YHH C;  1HNW C;  4DV1 C;  3VNR A;  3CJE A;  3UX2 A;  1NY8 A;  3I08 A;  2WD9 A;  2D27 A;  3CQ3 A;  1EGA A;  2HHH C;  2QVX X;  3PRO C;  4NXM C;  2VQE C;  2CY1 A;  4K0K C;  1HNX C;  4I9F A;  4JI0 C;  5T8S A;  2P2J A;  2Y4N A;  1LQL A;  1V26 A;  3UX3 A;  1GPM A;  2PN2 A;  4JI2 C;  2D1R A;  4RLQ A;  3L8C A;  4OXI A;  1N32 C;  3LUS A;  1PG3 A;  2JMP A;  1BA3 A;  3AY0 A;  1N2F A;  1YJ7 A;  5BSW A;  5BUQ A;  4GXQ A;  1UKK A;  2D7V A;  2WP0 C;  4JI5 C;  2E8E A;  4ISB A;  4RVO A;  2JNV A; 
#chains in the Genus database with same CATH homology
 1VEH A;  2M5O A;  3UX3 A;  2Z51 A;  1WCJ A;  3CQ1 A;  3CQ2 A;  1UWD A;  3CQ3 A;  1TH5 A;  2M5H A;  3LNO A;  3UX2 A;  1XHJ A;  2CU6 A;  2JNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...