2NCLA

Solution structure of bola3 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
ATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mitochondrial Bol1 and Bol3 function as assembly factors for specific iron-sulfur proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords BolA-like protein 3
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2nclA00
2MCQA 1NY8A 1XS3A 3TR3A 1V60A 2MMAB 3O2EA 5LCIA 2KZ0A 2NCLA 4PUHA 2DHMA 4PUGA 4PUIA 2KDNA 2MM9A
chains in the Genus database with same CATH superfamily
2P2BA 2MCQA 5BUQA 3TUFA 3C5EA 3T1YC 3GKUA 3NI2A 2PROA 4NOZA 5FLXD 3J81D 1ZB8A 4ISBA 2D1QA 3IMLA 4LFAC 3A25A 1FJGC 5A1IA 3A9VA 2E8FA 4DR3C 1MXBA 4LF9C 4G1IA 1USPB 5T8TA 4DV5C 4PUGA 4JYAC 3NPDA 1LQLA 1MDBA 1XS3A 4DG9A 2Z51A 2DHMA 4LFCC 4B3MC 1MD9A 4GXQA 3CW8X 3CW9A 4DCVA 2Y4NA 4PHTA 4JI0C 1ML8A 4LE5A 1JOSA 2M5HA 4OX9C 2MM9A 2Y4OA 1MXCA 2E8CA 4RVOA 4DR1C 1IBLC 3TR3A 2WP0C 2UUBC 1M6XC 4DV1C 2D27A 4LF6C 5A19A 4DV6C 5T8SA 3N54B 4LFBC 3E7XA 5LMUC 1V25A 4AQYC 3RG2A 3RV2A 4L4QA 2WD9A 4X62C 3IPLA 1XMOC 2P2MA 1T5DX 3B7WA 3IEUA 1MDFA 5E7QA 2JNVA 1PG4A 3A26A 4DV2C 1MXAA 4BC7A 2UU9C 4DV0C 1VLAA 5AE3A 2CXCA 1L2FA 1IB8A 4PROC 2YWBA 4KTTA 1HNWC 2JMPA 2HJGA 4DR5C 2DYJA 3FCCA 2ATWA 4JI6C 4ZJZA 2D1SA 1O92A 3VNRA 1WCJA 3PESA 5LMNC 4DR6C 2P2FA 2OBVA 2KDNA 4DUZC 2QVYX 1NY8A 1TH5A 2AYAA 4G36A 2E5LC 1LCIA 3LUSA 2YWCA 4JI2C 2P2JA 2KZ0A 5JRHA 2MMAB 4BSZA 1I94C 3R9WA 4R1LA 1VEHA 5KEIA 4RMNA 5KYTA 5BSRA 3IEVA 1USPA 2UUAC 3NYQA 4X66C 4DR7C 5BSTA 3I08A 4DCTA 4FUTA 4L2ZA 4DR2C 1XNRC 3AY0A 5LCIA 3DAYA 4GKJC 1XRBA 3J80D 4X65C 5K85A 1HR0C 2PT7G 5BSWA 3ETOA 3VNSA 2BH1X 4WS9A 3H2TA 4WV3A 1N2FA 4BBYA 5IFIA 5IWAC 2D1TA 1K0RA 4XX2A 3I07A 4OYCA 4G37A 2QW0X 3TQIA 2VZEA 4JI1C 3FCEA 3JAMD 1N33C 5H9UA 2KZFA 1O90A 3N2QA 4GKKC 1XRAA 4DV4C 1IBKC 1AMUA 2D7VA 4LF8C 3TDEA 2OO4A 3OTOC 2VQFC 2ASBA 2PN2A 4LF7C 2UUCC 3G7SA 1J5EC 1HNZC 4K0KC 1P4EA 2YX1A 1N36C 4R1MA 2ZZMA 4JM1A 1IBMC 2ZM6C 1V26A 3LNVA 5K8FA 2YCBA 4YHHC 1ZB9A 1QWIA 3LAXA 3GPCA 1NYEA 5AE2A 5A1GA 1O93A 4U5YD 1T5HX 3L95X 3L8CA 4KHPC 2P20A 4DUYC 2CY1A 1UWDA 3AF5A 1P4EC 3A9UA 4PZPA 4NXNC 4DCSA 3T1HC 4JI5C 4IR7A 2D1RA 1YJ7A 3DLPX 4DG8A 5KYVA 3K6RA 1HNXC 2ZZNA 1XHJA 4DV3C 4PUIA 4NDNA 5CZXA 5DV9A 1PG3A 1ULTA 1BA3A 1QM4A 2VSQA 5CZVA 1XMQC 3VNQA 2EGTA 2E0GA 4MTNA 4RLFA 3DHVA 2QVZX 5BUSA 1XRCA 2VQEC 2ONFA 5GTDA 5BSMA 2P2QA 3AF6A 2OPLA 2V7BA 4NXMC 1UKKA 3GR1A 4BC9A 4B3TC 1PU1A 4BCAA 4LF5C 2P02A 4ZLPA 4DR4C 4DCUA 3E7WA 3UEBA 4D57A 1WH9A 2QVXX 5IT9D 3R44A 5A2QD 2E7GA 2D28C 4L7IA 1O9TA 4FUQA 2QL8A 3UOWA 1HH2P 4YY3C 2UXCC 1FUGA 1MKYA 1RG9A 5AE1A 4HPVA 1P7LA 4ODJA 1GPMA 3EERA 4JI8C 4B3RC 3SO4A 2Y27A 1XNQC 3A4IA 4OXIA 3UX3A 2XR1A 3O2EA 4IZ6A 2NCLA 2UXDC 4EATA 3CJEA 4I9GA 3PROC 3CQ2A 2UXBC 1WF3A 3CQ3A 3S82A 3EQ6A 4R0MA 1PA4A 4JV5C 3CQ1A 5BSUA 4RM3A 2BJOA 4K0BA 5BURA 2DPLA 4D56A 4D4GA 3R9XA 4RVNA 4LF4C 3NYRA 3UZ0A 4PUHA 4D4IA 3KXWA 3LNOA 4DV7C 4MH4A 5ADZA 3ETCA 3LGXA 1EGAA 1N34C 4FTFA 4KTVA 4RLQA 1N32C 1M6XA 1KKGA 2E8EA 1V60A 4B3SC 2F4VC 2OPLB 4X64C 4RM2A 2M5OA 4TPSB 5BSVA 4I9FA 3GR0A 4JI4C 3UX2A 3PBKA 4JI3C 1FLOA 4GS5A 4GXRA 2HHHC 2CU6A 1RY2A 4JI7C 5BR8C
chains in the Genus database with same CATH topology
2MCQA 1NY8A 1XS3A 3TR3A 1V60A 2MMAB 3O2EA 5LCIA 2KZ0A 2NCLA 4PUHA 2DHMA 4PUGA 4PUIA 2KDNA 2MM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MCQ A;  1NY8 A;  1XS3 A;  3TR3 A;  1V60 A;  2MMA B;  3O2E A;  5LCI A;  2KZ0 A;  2NCL A;  4PUH A;  2DHM A;  4PUG A;  4PUI A;  2KDN A;  2MM9 A; 
#chains in the Genus database with same CATH topology
 2P2B A;  2MCQ A;  5BUQ A;  3TUF A;  3C5E A;  3T1Y C;  3GKU A;  3NI2 A;  2PRO A;  4NOZ A;  5FLX D;  3J81 D;  1ZB8 A;  4ISB A;  2D1Q A;  3IML A;  4LFA C;  3A25 A;  1FJG C;  5A1I A;  3A9V A;  2E8F A;  4DR3 C;  1MXB A;  4LF9 C;  4G1I A;  1USP B;  5T8T A;  4DV5 C;  4PUG A;  4JYA C;  3NPD A;  1LQL A;  1MDB A;  1XS3 A;  4DG9 A;  2Z51 A;  2DHM A;  4LFC C;  4B3M C;  1MD9 A;  4GXQ A;  3CW8 X;  3CW9 A;  4DCV A;  2Y4N A;  4PHT A;  4JI0 C;  1ML8 A;  4LE5 A;  1JOS A;  2M5H A;  4OX9 C;  2MM9 A;  2Y4O A;  1MXC A;  2E8C A;  4RVO A;  4DR1 C;  1IBL C;  3TR3 A;  2WP0 C;  2UUB C;  1M6X C;  4DV1 C;  2D27 A;  4LF6 C;  5A19 A;  4DV6 C;  5T8S A;  3N54 B;  4LFB C;  3E7X A;  5LMU C;  1V25 A;  4AQY C;  3RG2 A;  3RV2 A;  4L4Q A;  2WD9 A;  4X62 C;  3IPL A;  1XMO C;  2P2M A;  1T5D X;  3B7W A;  3IEU A;  1MDF A;  5E7Q A;  2JNV A;  1PG4 A;  3A26 A;  4DV2 C;  1MXA A;  4BC7 A;  2UU9 C;  4DV0 C;  1VLA A;  5AE3 A;  2CXC A;  1L2F A;  1IB8 A;  4PRO C;  2YWB A;  4KTT A;  1HNW C;  2JMP A;  2HJG A;  4DR5 C;  2DYJ A;  3FCC A;  2ATW A;  4JI6 C;  4ZJZ A;  2D1S A;  1O92 A;  3VNR A;  1WCJ A;  3PES A;  5LMN C;  4DR6 C;  2P2F A;  2OBV A;  2KDN A;  4DUZ C;  2QVY X;  1NY8 A;  1TH5 A;  2AYA A;  4G36 A;  2E5L C;  1LCI A;  3LUS A;  2YWC A;  4JI2 C;  2P2J A;  2KZ0 A;  5JRH A;  2MMA B;  4BSZ A;  1I94 C;  3R9W A;  4R1L A;  1VEH A;  5KEI A;  4RMN A;  5KYT A;  5BSR A;  3IEV A;  1USP A;  2UUA C;  3NYQ A;  4X66 C;  4DR7 C;  5BST A;  3I08 A;  4DCT A;  4FUT A;  4L2Z A;  4DR2 C;  1XNR C;  3AY0 A;  5LCI A;  3DAY A;  4GKJ C;  1XRB A;  3J80 D;  4X65 C;  5K85 A;  1HR0 C;  2PT7 G;  5BSW A;  3ETO A;  3VNS A;  2BH1 X;  4WS9 A;  3H2T A;  4WV3 A;  1N2F A;  4BBY A;  5IFI A;  5IWA C;  2D1T A;  1K0R A;  4XX2 A;  3I07 A;  4OYC A;  4G37 A;  2QW0 X;  3TQI A;  2VZE A;  4JI1 C;  3FCE A;  3JAM D;  1N33 C;  5H9U A;  2KZF A;  1O90 A;  3N2Q A;  4GKK C;  1XRA A;  4DV4 C;  1IBK C;  1AMU A;  2D7V A;  4LF8 C;  3TDE A;  2OO4 A;  3OTO C;  2VQF C;  2ASB A;  2PN2 A;  4LF7 C;  2UUC C;  3G7S A;  1J5E C;  1HNZ C;  4K0K C;  1P4E A;  2YX1 A;  1N36 C;  4R1M A;  2ZZM A;  4JM1 A;  1IBM C;  2ZM6 C;  1V26 A;  3LNV A;  5K8F A;  2YCB A;  4YHH C;  1ZB9 A;  1QWI A;  3LAX A;  3GPC A;  1NYE A;  5AE2 A;  5A1G A;  1O93 A;  4U5Y D;  1T5H X;  3L95 X;  3L8C A;  4KHP C;  2P20 A;  4DUY C;  2CY1 A;  1UWD A;  3AF5 A;  1P4E C;  3A9U A;  4PZP A;  4NXN C;  4DCS A;  3T1H C;  4JI5 C;  4IR7 A;  2D1R A;  1YJ7 A;  3DLP X;  4DG8 A;  5KYV A;  3K6R A;  1HNX C;  2ZZN A;  1XHJ A;  4DV3 C;  4PUI A;  4NDN A;  5CZX A;  5DV9 A;  1PG3 A;  1ULT A;  1BA3 A;  1QM4 A;  2VSQ A;  5CZV A;  1XMQ C;  3VNQ A;  2EGT A;  2E0G A;  4MTN A;  4RLF A;  3DHV A;  2QVZ X;  5BUS A;  1XRC A;  2VQE C;  2ONF A;  5GTD A;  5BSM A;  2P2Q A;  3AF6 A;  2OPL A;  2V7B A;  4NXM C;  1UKK A;  3GR1 A;  4BC9 A;  4B3T C;  1PU1 A;  4BCA A;  4LF5 C;  2P02 A;  4ZLP A;  4DR4 C;  4DCU A;  3E7W A;  3UEB A;  4D57 A;  1WH9 A;  2QVX X;  5IT9 D;  3R44 A;  5A2Q D;  2E7G A;  2D28 C;  4L7I A;  1O9T A;  4FUQ A;  2QL8 A;  3UOW A;  1HH2 P;  4YY3 C;  2UXC C;  1FUG A;  1MKY A;  1RG9 A;  5AE1 A;  4HPV A;  1P7L A;  4ODJ A;  1GPM A;  3EER A;  4JI8 C;  4B3R C;  3SO4 A;  2Y27 A;  1XNQ C;  3A4I A;  4OXI A;  3UX3 A;  2XR1 A;  3O2E A;  4IZ6 A;  2NCL A;  2UXD C;  4EAT A;  3CJE A;  4I9G A;  3PRO C;  3CQ2 A;  2UXB C;  1WF3 A;  3CQ3 A;  3S82 A;  3EQ6 A;  4R0M A;  1PA4 A;  4JV5 C;  3CQ1 A;  5BSU A;  4RM3 A;  2BJO A;  4K0B A;  5BUR A;  2DPL A;  4D56 A;  4D4G A;  3R9X A;  4RVN A;  4LF4 C;  3NYR A;  3UZ0 A;  4PUH A;  4D4I A;  3KXW A;  3LNO A;  4DV7 C;  4MH4 A;  5ADZ A;  3ETC A;  3LGX A;  1EGA A;  1N34 C;  4FTF A;  4KTV A;  4RLQ A;  1N32 C;  1M6X A;  1KKG A;  2E8E A;  1V60 A;  4B3S C;  2F4V C;  2OPL B;  4X64 C;  4RM2 A;  2M5O A;  4TPS B;  5BSV A;  4I9F A;  3GR0 A;  4JI4 C;  3UX2 A;  3PBK A;  4JI3 C;  1FLO A;  4GS5 A;  4GXR A;  2HHH C;  2CU6 A;  1RY2 A;  4JI7 C;  5BR8 C; 
#chains in the Genus database with same CATH homology
 2MCQ A;  1NY8 A;  1XS3 A;  3TR3 A;  1V60 A;  2MMA B;  3O2E A;  5LCI A;  2KZ0 A;  2NCL A;  4PUH A;  2DHM A;  4PUG A;  4PUI A;  2KDN A;  2MM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...