2NCLA

Solution structure of bola3 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
ATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mitochondrial Bol1 and Bol3 function as assembly factors for specific iron-sulfur proteins.
pubmed doi rcsb
molecule keywords BolA-like protein 3
molecule tags Protein binding
source organism Homo sapiens
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2nclA00
4PUGA 5LCIA 4PUIA 1NY8A 2KZ0A 1XS3A 2NCLA 4PUHA 2MM9A 3TR3A 2DHMA 2KDNA 3O2EA 2MCQA 1V60A 2MMAB
chains in the Genus database with same CATH superfamily
2V7BA 3PROC 2M5OA 3I07A 4FUQA 1WF3A 3T1YC 3ETCA 4MH4A 2VSQA 2ZM6C 1MXCA 3PBKA 1YJ7A 4MTNA 1L2FA 4G37A 1XMQC 4DR6C 2UXBC 3IEVA 5LMUC 4RLFA 4JV5C 4PROC 3ETOA 1BA3A 5A19A 1P7LA 4GS5A 4ISBA 2OPLB 4JYAC 4BSZA 2M5HA 1V60A 2P02A 5A2QD 3LGXA 2YCBA 3LUSA 4DR1C 3UZ0A 4NXNC 2P2FA 3L95X 4TPSB 3CQ1A 1O92A 1XMOC 2P20A 4JI3C 4LFBC 5IFIA 4DV1C 4PZPA 5BR8C 5BSUA 4LF7C 1N34C 4RM2A 3GR1A 3TR3A 2D1SA 3TDEA 1MD9A 2Y27A 4JI7C 3EQ6A 4NXMC 4DCTA 1GPMA 2EGTA 3DAYA 5A1IA 3GPCA 4AQYC 2PROA 1PG3A 5BUQA 2E5LC 4RVOA 1PA4A 2P2BA 5K85A 5K8FA 1FJGC 3H2TA 4JI2C 5FLXD 4RM3A 1P4EA 1N2FA 2AYAA 4R0MA 3LNOA 1MDBA 4GXRA 2DHMA 4DR5C 4NDNA 4DUZC 4LF6C 4B3TC 4B3MC 5BSMA 2UU9C 3IEUA 2JNVA 1T5DX 2OBVA 1RY2A 1RG9A 1PG4A 1N33C 2D28C 3UX3A 2ZZNA 1NY8A 3B7WA 1USPA 3A25A 2NCLA 4U5YD 5H9UA 2YWCA 4G36A 2MM9A 4DG8A 3G7SA 4RMNA 1N32C 1MXBA 5BUSA 1KKGA 5BSWA 2HHHC 4IZ6A 2BH1X 1UWDA 4DCSA 4BC7A 2PN2A 4I9FA 4DG9A 3T1HC 3AY0A 1IBMC 3NPDA 4X64C 2WD9A 4X65C 4JI1C 3EERA 5GTDA 3NI2A 2CXCA 2P2JA 3GKUA 2CY1A 3GR0A 4OXIA 2QVXX 1XRAA 4K0KC 3VNSA 4JI6C 1HNXC 3VNRA 5KEIA 3IPLA 4KTVA 1MDFA 4R1LA 1V25A 1MXAA 1V26A 5BSTA 3A9VA 1ULTA 2YWBA 4ZJZA 3O2EA 4D56A 4KHPC 2CU6A 2UXCC 1K0RA 3OTOC 3E7WA 2UUBC 5A1GA 1P4EC 3RV2A 2D1TA 2JMPA 1I94C 1XNRC 1PU1A 4DR7C 4L2ZA 3NYRA 1XNQC 2XR1A 2QL8A 2UXDC 1QWIA 4NOZA 2P2QA 5ADZA 1J5EC 4X62C 3AF5A 2HJGA 3TUFA 1N36C 3IMLA 2VQEC 5DV9A 5IT9D 1O9TA 2KZFA 3UX2A 5IWAC 4D4IA 2MCQA 3SO4A 1USPB 4FTFA 4DV5C 4JI8C 4G1IA 3UOWA 4DV6C 4LF5C 4L7IA 4DV3C 4LE5A 3AF6A 2Y4NA 1ZB9A 1HH2P 1IB8A 2D1RA 2E0GA 4JI0C 1HNWC 5BSRA 3FCEA 2ZZMA 1T5HX 3NYQA 3E7XA 2VZEA 1EGAA 3CJEA 4KTTA 2ONFA 5E7QA 4JI5C 3R9XA 1ZB8A 1MKYA 1XHJA 2ATWA 4OYCA 4WV3A 1XRCA 4XX2A 4PUIA 2Z51A 5AE1A 4D4GA 2ASBA 2D27A 1IBKC 4DR3C 1QM4A 3L8CA 3R44A 4JI4C 3CQ2A 3LNVA 1LCIA 1TH5A 2KDNA 2E8CA 4FUTA 4ODJA 4WS9A 1XRBA 4I9GA 4B3SC 3I08A 2DPLA 2F4VC 3S82A 4DV2C 1NYEA 1XS3A 4BC9A 4GKJC 4DR2C 3DHVA 2VQFC 4OX9C 1FLOA 4EATA 3PESA 4L4QA 2Y4OA 1WH9A 4DV0C 1ML8A 3FCCA 4K0BA 1HNZC 2DYJA 3K6RA 3N2QA 4IR7A 3VNQA 4GXQA 4DUYC 4GKKC 3KXWA 4DR4C 4D57A 5T8SA 2UUCC 2QVZX 4DV4C 3A26A 4B3RC 3JAMD 3J80D 2OO4A 3A4IA 4PUHA 4YY3C 1HR0C 4LF4C 4R1MA 2E8FA 5LMNC 4RLQA 1IBLC 3CW8X 2PT7G 1O90A 4YHHC 3RG2A 2KZ0A 2E7GA 2OPLA 4DCUA 5CZXA 3J81D 5BURA 3N54B 4LF8C 5JRHA 1M6XC 2D7VA 4PUGA 4LFAC 4DCVA 3R9WA 3C5EA 5AE3A 4HPVA 3DLPX 3LAXA 1O93A 4PHTA 2E8EA 3CQ3A 5BSVA 1WCJA 2WP0C 2BJOA 4BBYA 2MMAB 4DV7C 5T8TA 5CZVA 4LF9C 4LFCC 5AE2A 3CW9A 1AMUA 2YX1A 3UEBA 4ZLPA 5LCIA 2D1QA 4RVNA 3TQIA 4JM1A 1JOSA 1VEHA 1LQLA 2QVYX 2P2MA 1M6XA 2QW0X 1FUGA 4BCAA 5KYTA 1VLAA 5KYVA 2UUAC 4X66C 1UKKA 3A9UA
chains in the Genus database with same CATH topology
4PUGA 5LCIA 4PUIA 1NY8A 2KZ0A 1XS3A 2NCLA 4PUHA 2MM9A 3TR3A 2DHMA 2KDNA 3O2EA 2MCQA 1V60A 2MMAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUG A;  5LCI A;  4PUI A;  1NY8 A;  2KZ0 A;  1XS3 A;  2NCL A;  4PUH A;  2MM9 A;  3TR3 A;  2DHM A;  2KDN A;  3O2E A;  2MCQ A;  1V60 A;  2MMA B; 
#chains in the Genus database with same CATH topology
 2V7B A;  3PRO C;  2M5O A;  3I07 A;  4FUQ A;  1WF3 A;  3T1Y C;  3ETC A;  4MH4 A;  2VSQ A;  2ZM6 C;  1MXC A;  3PBK A;  1YJ7 A;  4MTN A;  1L2F A;  4G37 A;  1XMQ C;  4DR6 C;  2UXB C;  3IEV A;  5LMU C;  4RLF A;  4JV5 C;  4PRO C;  3ETO A;  1BA3 A;  5A19 A;  1P7L A;  4GS5 A;  4ISB A;  2OPL B;  4JYA C;  4BSZ A;  2M5H A;  1V60 A;  2P02 A;  5A2Q D;  3LGX A;  2YCB A;  3LUS A;  4DR1 C;  3UZ0 A;  4NXN C;  2P2F A;  3L95 X;  4TPS B;  3CQ1 A;  1O92 A;  1XMO C;  2P20 A;  4JI3 C;  4LFB C;  5IFI A;  4DV1 C;  4PZP A;  5BR8 C;  5BSU A;  4LF7 C;  1N34 C;  4RM2 A;  3GR1 A;  3TR3 A;  2D1S A;  3TDE A;  1MD9 A;  2Y27 A;  4JI7 C;  3EQ6 A;  4NXM C;  4DCT A;  1GPM A;  2EGT A;  3DAY A;  5A1I A;  3GPC A;  4AQY C;  2PRO A;  1PG3 A;  5BUQ A;  2E5L C;  4RVO A;  1PA4 A;  2P2B A;  5K85 A;  5K8F A;  1FJG C;  3H2T A;  4JI2 C;  5FLX D;  4RM3 A;  1P4E A;  1N2F A;  2AYA A;  4R0M A;  3LNO A;  1MDB A;  4GXR A;  2DHM A;  4DR5 C;  4NDN A;  4DUZ C;  4LF6 C;  4B3T C;  4B3M C;  5BSM A;  2UU9 C;  3IEU A;  2JNV A;  1T5D X;  2OBV A;  1RY2 A;  1RG9 A;  1PG4 A;  1N33 C;  2D28 C;  3UX3 A;  2ZZN A;  1NY8 A;  3B7W A;  1USP A;  3A25 A;  2NCL A;  4U5Y D;  5H9U A;  2YWC A;  4G36 A;  2MM9 A;  4DG8 A;  3G7S A;  4RMN A;  1N32 C;  1MXB A;  5BUS A;  1KKG A;  5BSW A;  2HHH C;  4IZ6 A;  2BH1 X;  1UWD A;  4DCS A;  4BC7 A;  2PN2 A;  4I9F A;  4DG9 A;  3T1H C;  3AY0 A;  1IBM C;  3NPD A;  4X64 C;  2WD9 A;  4X65 C;  4JI1 C;  3EER A;  5GTD A;  3NI2 A;  2CXC A;  2P2J A;  3GKU A;  2CY1 A;  3GR0 A;  4OXI A;  2QVX X;  1XRA A;  4K0K C;  3VNS A;  4JI6 C;  1HNX C;  3VNR A;  5KEI A;  3IPL A;  4KTV A;  1MDF A;  4R1L A;  1V25 A;  1MXA A;  1V26 A;  5BST A;  3A9V A;  1ULT A;  2YWB A;  4ZJZ A;  3O2E A;  4D56 A;  4KHP C;  2CU6 A;  2UXC C;  1K0R A;  3OTO C;  3E7W A;  2UUB C;  5A1G A;  1P4E C;  3RV2 A;  2D1T A;  2JMP A;  1I94 C;  1XNR C;  1PU1 A;  4DR7 C;  4L2Z A;  3NYR A;  1XNQ C;  2XR1 A;  2QL8 A;  2UXD C;  1QWI A;  4NOZ A;  2P2Q A;  5ADZ A;  1J5E C;  4X62 C;  3AF5 A;  2HJG A;  3TUF A;  1N36 C;  3IML A;  2VQE C;  5DV9 A;  5IT9 D;  1O9T A;  2KZF A;  3UX2 A;  5IWA C;  4D4I A;  2MCQ A;  3SO4 A;  1USP B;  4FTF A;  4DV5 C;  4JI8 C;  4G1I A;  3UOW A;  4DV6 C;  4LF5 C;  4L7I A;  4DV3 C;  4LE5 A;  3AF6 A;  2Y4N A;  1ZB9 A;  1HH2 P;  1IB8 A;  2D1R A;  2E0G A;  4JI0 C;  1HNW C;  5BSR A;  3FCE A;  2ZZM A;  1T5H X;  3NYQ A;  3E7X A;  2VZE A;  1EGA A;  3CJE A;  4KTT A;  2ONF A;  5E7Q A;  4JI5 C;  3R9X A;  1ZB8 A;  1MKY A;  1XHJ A;  2ATW A;  4OYC A;  4WV3 A;  1XRC A;  4XX2 A;  4PUI A;  2Z51 A;  5AE1 A;  4D4G A;  2ASB A;  2D27 A;  1IBK C;  4DR3 C;  1QM4 A;  3L8C A;  3R44 A;  4JI4 C;  3CQ2 A;  3LNV A;  1LCI A;  1TH5 A;  2KDN A;  2E8C A;  4FUT A;  4ODJ A;  4WS9 A;  1XRB A;  4I9G A;  4B3S C;  3I08 A;  2DPL A;  2F4V C;  3S82 A;  4DV2 C;  1NYE A;  1XS3 A;  4BC9 A;  4GKJ C;  4DR2 C;  3DHV A;  2VQF C;  4OX9 C;  1FLO A;  4EAT A;  3PES A;  4L4Q A;  2Y4O A;  1WH9 A;  4DV0 C;  1ML8 A;  3FCC A;  4K0B A;  1HNZ C;  2DYJ A;  3K6R A;  3N2Q A;  4IR7 A;  3VNQ A;  4GXQ A;  4DUY C;  4GKK C;  3KXW A;  4DR4 C;  4D57 A;  5T8S A;  2UUC C;  2QVZ X;  4DV4 C;  3A26 A;  4B3R C;  3JAM D;  3J80 D;  2OO4 A;  3A4I A;  4PUH A;  4YY3 C;  1HR0 C;  4LF4 C;  4R1M A;  2E8F A;  5LMN C;  4RLQ A;  1IBL C;  3CW8 X;  2PT7 G;  1O90 A;  4YHH C;  3RG2 A;  2KZ0 A;  2E7G A;  2OPL A;  4DCU A;  5CZX A;  3J81 D;  5BUR A;  3N54 B;  4LF8 C;  5JRH A;  1M6X C;  2D7V A;  4PUG A;  4LFA C;  4DCV A;  3R9W A;  3C5E A;  5AE3 A;  4HPV A;  3DLP X;  3LAX A;  1O93 A;  4PHT A;  2E8E A;  3CQ3 A;  5BSV A;  1WCJ A;  2WP0 C;  2BJO A;  4BBY A;  2MMA B;  4DV7 C;  5T8T A;  5CZV A;  4LF9 C;  4LFC C;  5AE2 A;  3CW9 A;  1AMU A;  2YX1 A;  3UEB A;  4ZLP A;  5LCI A;  2D1Q A;  4RVN A;  3TQI A;  4JM1 A;  1JOS A;  1VEH A;  1LQL A;  2QVY X;  2P2M A;  1M6X A;  2QW0 X;  1FUG A;  4BCA A;  5KYT A;  1VLA A;  5KYV A;  2UUA C;  4X66 C;  1UKK A;  3A9U A; 
#chains in the Genus database with same CATH homology
 4PUG A;  5LCI A;  4PUI A;  1NY8 A;  2KZ0 A;  1XS3 A;  2NCL A;  4PUH A;  2MM9 A;  3TR3 A;  2DHM A;  2KDN A;  3O2E A;  2MCQ A;  1V60 A;  2MMA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...