2NCLA

Solution structure of bola3 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
ATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA-like protein 3
publication title Mitochondrial Bol1 and Bol3 function as assembly factors for specific iron-sulfur proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2016-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2nclA00
1NY8A 2DHMA 3O2EA 2MCQA 2NCLA 3TR3A 1XS3A 2MM9A 5LCIA 4PUHA 1V60A 4PUIA 2MMAB 2KZ0A 4PUGA 2KDNA
chains in the Genus database with same CATH superfamily
2HJGA 2D1RA 1O9TA 4LE5A 4B3SC 4NXNC 1ZB8A 3O2EA 1ML8A 3CW9A 1XNRC 4JI6C 3GKUA 4KTVA 3VNQA 3PESA 3S82A 3IEUA 1WCJA 3GR0A 4RM2A 5LMNC 4YHHC 4X65C 2YWBA 1M6XA 3UZ0A 1V25A 1FLOA 4L7IA 3R9WA 3I07A 1IBMC 2VZEA 3CQ3A 5H9UA 1XNQC 4JI2C 4R1MA 3H2TA 4FTFA 1IBLC 4KTTA 1NYEA 3UX3A 5BSVA 1KKGA 4DV3C 1PG3A 4B3RC 4DV6C 3A25A 1HNXC 3N54B 4RLQA 1XRCA 2M5HA 4RLFA 2AYAA 3TR3A 1N32C 2P20A 4LFCC 3TUFA 2DPLA 1XRAA 4ZJZA 3A26A 2EGTA 4OYCA 3RG2A 3EERA 4RMNA 2HHHC 2UUCC 4LF5C 4L4QA 4RVNA 1UKKA 4DV4C 3UX2A 1FUGA 4D4GA 2QVYX 4B3MC 2KZFA 1PG4A 2ASBA 1PA4A 4DCUA 4D57A 5A1IA 1ULTA 1PU1A 3A9UA 5A2QD 1UWDA 4GXRA 4NDNA 2P02A 4GKKC 4XX2A 1RY2A 2Y4NA 2YX1A 4NXMC 1HNZC 4DR6C 2OPLB 1ZB9A 5KEIA 2E0GA 4DR4C 3PBKA 4DUYC 3R44A 4JYAC 5JRHA 4BBYA 1MDBA 4JI7C 4K0KC 5CZXA 2QL8A 5LMUC 4DR7C 5AE3A 1LCIA 5AE2A 4B3TC 4HPVA 1XMQC 4G37A 2E5LC 4X64C 4FUQA 4RM3A 2ZM6C 4OXIA 4DR5C 4R1LA 1MDFA 1AMUA 3IPLA 2VQFC 3PROC 3OTOC 3DAYA 4GXQA 1P7LA 1VLAA 1LQLA 1XHJA 2P2JA 3B7WA 4KHPC 4GS5A 3NI2A 2VQEC 5BUQA 2E8FA 5KYVA 3NYRA 1N2FA 3K6RA 1O90A 1TH5A 3AF6A 4DR2C 2E8EA 3DLPX 2BJOA 4G36A 2P2MA 1N33C 3LNOA 1GPMA 2OO4A 4DV5C 2DYJA 5T8SA 2UU9C 1WH9A 2JNVA 2UUAC 2Y27A 4DV0C 2E7GA 2JMPA 1T5HX 4PHTA 2MM9A 3ETCA 4G1IA 3AF5A 1T5DX 4X66C 1P4EA 1P4EC 2PN2A 2CY1A 5ADZA 2KZ0A 3RV2A 1YJ7A 3CQ2A 4LF6C 4JV5C 1HNWC 4BC7A 1O93A 3ETOA 4BSZA 2BH1X 1N36C 3E7WA 2UXCC 2QW0X 2KDNA 2P2QA 1J5EC 2QVZX 4DCSA 4WV3A 4JI3C 4DCTA 4WS9A 2ATWA 2ONFA 3E7XA 1USPB 3CQ1A 4TPSB 1I94C 3GR1A 1QM4A 1RG9A 3CW8X 5DV9A 5BSUA 1FJGC 1MD9A 4JI4C 5FLXD 4IZ6A 5LCIA 5BSWA 1XMOC 2YWCA 4DV1C 2PROA 3VNRA 3IEVA 2UXBC 2PT7G 2WD9A 4I9FA 4I9GA 5BSTA 4D56A 2M5OA 3J80D 2CXCA 4GKJC 1MXCA 4PUIA 3UOWA 5A1GA 4DV2C 4DCVA 2D27A 2Z51A 3N2QA 2ZZMA 3A9VA 3CJEA 5IWAC 2D7VA 3AY0A 1MXBA 1XRBA 5BUSA 5KYTA 2Y4OA 2V7BA 2XR1A 5BR8C 3L95X 5E7QA 2MMAB 2ZZNA 2MCQA 1HH2P 3DHVA 1MXAA 2QVXX 1N34C 4OX9C 4DUZC 5IFIA 4IR7A 4MH4A 4U5YD 1QWIA 2CU6A 1EGAA 5K85A 3JAMD 2UXDC 4BC9A 2P2FA 3VNSA 4K0BA 5T8TA 5K8FA 2D1TA 3KXWA 1L2FA 4PZPA 4DG9A 4LF8C 2D1SA 2OBVA 4ODJA 3TDEA 3FCEA 4DR1C 3A4IA 2VSQA 4LF4C 3NPDA 4RVOA 1MKYA 1M6XC 3TQIA 1NY8A 4PUHA 4MTNA 4AQYC 3LAXA 1JOSA 2P2BA 4PUGA 2E8CA 3I08A 4JM1A 3LGXA 3J81D 3L8CA 4YY3C 2F4VC 4D4IA 2DHMA 4ZLPA 3G7SA 4LF7C 5IT9D 4LF9C 3UEBA 4EATA 2WP0C 5CZVA 1WF3A 5BSRA 4X62C 3SO4A 4JI1C 2D1QA 4NOZA 3IMLA 4JI0C 1HR0C 3T1YC 3LNVA 1VEHA 2D28C 2UUBC 1V26A 4PROC 3LUSA 4DG8A 1XS3A 4BCAA 1IBKC 3FCCA 4DV7C 3T1HC 4DR3C 3NYQA 1O92A 1K0RA 1USPA 5A19A 2NCLA 4LFAC 4LFBC 4FUTA 5GTDA 4ISBA 5BURA 1V60A 2YCBA 5BSMA 4R0MA 1IB8A 3GPCA 2OPLA 4L2ZA 3R9XA 3EQ6A 3C5EA 1BA3A 5AE1A 4JI5C 4JI8C
chains in the Genus database with same CATH topology
1NY8A 2DHMA 3O2EA 2MCQA 2NCLA 3TR3A 1XS3A 2MM9A 5LCIA 4PUHA 1V60A 4PUIA 2MMAB 2KZ0A 4PUGA 2KDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NY8 A;  2DHM A;  3O2E A;  2MCQ A;  2NCL A;  3TR3 A;  1XS3 A;  2MM9 A;  5LCI A;  4PUH A;  1V60 A;  4PUI A;  2MMA B;  2KZ0 A;  4PUG A;  2KDN A; 
#chains in the Genus database with same CATH topology
 2HJG A;  2D1R A;  1O9T A;  4LE5 A;  4B3S C;  4NXN C;  1ZB8 A;  3O2E A;  1ML8 A;  3CW9 A;  1XNR C;  4JI6 C;  3GKU A;  4KTV A;  3VNQ A;  3PES A;  3S82 A;  3IEU A;  1WCJ A;  3GR0 A;  4RM2 A;  5LMN C;  4YHH C;  4X65 C;  2YWB A;  1M6X A;  3UZ0 A;  1V25 A;  1FLO A;  4L7I A;  3R9W A;  3I07 A;  1IBM C;  2VZE A;  3CQ3 A;  5H9U A;  1XNQ C;  4JI2 C;  4R1M A;  3H2T A;  4FTF A;  1IBL C;  4KTT A;  1NYE A;  3UX3 A;  5BSV A;  1KKG A;  4DV3 C;  1PG3 A;  4B3R C;  4DV6 C;  3A25 A;  1HNX C;  3N54 B;  4RLQ A;  1XRC A;  2M5H A;  4RLF A;  2AYA A;  3TR3 A;  1N32 C;  2P20 A;  4LFC C;  3TUF A;  2DPL A;  1XRA A;  4ZJZ A;  3A26 A;  2EGT A;  4OYC A;  3RG2 A;  3EER A;  4RMN A;  2HHH C;  2UUC C;  4LF5 C;  4L4Q A;  4RVN A;  1UKK A;  4DV4 C;  3UX2 A;  1FUG A;  4D4G A;  2QVY X;  4B3M C;  2KZF A;  1PG4 A;  2ASB A;  1PA4 A;  4DCU A;  4D57 A;  5A1I A;  1ULT A;  1PU1 A;  3A9U A;  5A2Q D;  1UWD A;  4GXR A;  4NDN A;  2P02 A;  4GKK C;  4XX2 A;  1RY2 A;  2Y4N A;  2YX1 A;  4NXM C;  1HNZ C;  4DR6 C;  2OPL B;  1ZB9 A;  5KEI A;  2E0G A;  4DR4 C;  3PBK A;  4DUY C;  3R44 A;  4JYA C;  5JRH A;  4BBY A;  1MDB A;  4JI7 C;  4K0K C;  5CZX A;  2QL8 A;  5LMU C;  4DR7 C;  5AE3 A;  1LCI A;  5AE2 A;  4B3T C;  4HPV A;  1XMQ C;  4G37 A;  2E5L C;  4X64 C;  4FUQ A;  4RM3 A;  2ZM6 C;  4OXI A;  4DR5 C;  4R1L A;  1MDF A;  1AMU A;  3IPL A;  2VQF C;  3PRO C;  3OTO C;  3DAY A;  4GXQ A;  1P7L A;  1VLA A;  1LQL A;  1XHJ A;  2P2J A;  3B7W A;  4KHP C;  4GS5 A;  3NI2 A;  2VQE C;  5BUQ A;  2E8F A;  5KYV A;  3NYR A;  1N2F A;  3K6R A;  1O90 A;  1TH5 A;  3AF6 A;  4DR2 C;  2E8E A;  3DLP X;  2BJO A;  4G36 A;  2P2M A;  1N33 C;  3LNO A;  1GPM A;  2OO4 A;  4DV5 C;  2DYJ A;  5T8S A;  2UU9 C;  1WH9 A;  2JNV A;  2UUA C;  2Y27 A;  4DV0 C;  2E7G A;  2JMP A;  1T5H X;  4PHT A;  2MM9 A;  3ETC A;  4G1I A;  3AF5 A;  1T5D X;  4X66 C;  1P4E A;  1P4E C;  2PN2 A;  2CY1 A;  5ADZ A;  2KZ0 A;  3RV2 A;  1YJ7 A;  3CQ2 A;  4LF6 C;  4JV5 C;  1HNW C;  4BC7 A;  1O93 A;  3ETO A;  4BSZ A;  2BH1 X;  1N36 C;  3E7W A;  2UXC C;  2QW0 X;  2KDN A;  2P2Q A;  1J5E C;  2QVZ X;  4DCS A;  4WV3 A;  4JI3 C;  4DCT A;  4WS9 A;  2ATW A;  2ONF A;  3E7X A;  1USP B;  3CQ1 A;  4TPS B;  1I94 C;  3GR1 A;  1QM4 A;  1RG9 A;  3CW8 X;  5DV9 A;  5BSU A;  1FJG C;  1MD9 A;  4JI4 C;  5FLX D;  4IZ6 A;  5LCI A;  5BSW A;  1XMO C;  2YWC A;  4DV1 C;  2PRO A;  3VNR A;  3IEV A;  2UXB C;  2PT7 G;  2WD9 A;  4I9F A;  4I9G A;  5BST A;  4D56 A;  2M5O A;  3J80 D;  2CXC A;  4GKJ C;  1MXC A;  4PUI A;  3UOW A;  5A1G A;  4DV2 C;  4DCV A;  2D27 A;  2Z51 A;  3N2Q A;  2ZZM A;  3A9V A;  3CJE A;  5IWA C;  2D7V A;  3AY0 A;  1MXB A;  1XRB A;  5BUS A;  5KYT A;  2Y4O A;  2V7B A;  2XR1 A;  5BR8 C;  3L95 X;  5E7Q A;  2MMA B;  2ZZN A;  2MCQ A;  1HH2 P;  3DHV A;  1MXA A;  2QVX X;  1N34 C;  4OX9 C;  4DUZ C;  5IFI A;  4IR7 A;  4MH4 A;  4U5Y D;  1QWI A;  2CU6 A;  1EGA A;  5K85 A;  3JAM D;  2UXD C;  4BC9 A;  2P2F A;  3VNS A;  4K0B A;  5T8T A;  5K8F A;  2D1T A;  3KXW A;  1L2F A;  4PZP A;  4DG9 A;  4LF8 C;  2D1S A;  2OBV A;  4ODJ A;  3TDE A;  3FCE A;  4DR1 C;  3A4I A;  2VSQ A;  4LF4 C;  3NPD A;  4RVO A;  1MKY A;  1M6X C;  3TQI A;  1NY8 A;  4PUH A;  4MTN A;  4AQY C;  3LAX A;  1JOS A;  2P2B A;  4PUG A;  2E8C A;  3I08 A;  4JM1 A;  3LGX A;  3J81 D;  3L8C A;  4YY3 C;  2F4V C;  4D4I A;  2DHM A;  4ZLP A;  3G7S A;  4LF7 C;  5IT9 D;  4LF9 C;  3UEB A;  4EAT A;  2WP0 C;  5CZV A;  1WF3 A;  5BSR A;  4X62 C;  3SO4 A;  4JI1 C;  2D1Q A;  4NOZ A;  3IML A;  4JI0 C;  1HR0 C;  3T1Y C;  3LNV A;  1VEH A;  2D28 C;  2UUB C;  1V26 A;  4PRO C;  3LUS A;  4DG8 A;  1XS3 A;  4BCA A;  1IBK C;  3FCC A;  4DV7 C;  3T1H C;  4DR3 C;  3NYQ A;  1O92 A;  1K0R A;  1USP A;  5A19 A;  2NCL A;  4LFA C;  4LFB C;  4FUT A;  5GTD A;  4ISB A;  5BUR A;  1V60 A;  2YCB A;  5BSM A;  4R0M A;  1IB8 A;  3GPC A;  2OPL A;  4L2Z A;  3R9X A;  3EQ6 A;  3C5E A;  1BA3 A;  5AE1 A;  4JI5 C;  4JI8 C; 
#chains in the Genus database with same CATH homology
 1NY8 A;  2DHM A;  3O2E A;  2MCQ A;  2NCL A;  3TR3 A;  1XS3 A;  2MM9 A;  5LCI A;  4PUH A;  1V60 A;  4PUI A;  2MMA B;  2KZ0 A;  4PUG A;  2KDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...