3I08A

Crystal structure of the s1-cleaved notch1 negative regulatory region (nrr)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
ACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Effects of S1 cleavage on the structure, surface export, and signaling activity of human Notch1 and Notch2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neurogenic locus notch homolog protein 1
total genus 42
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A01
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A02
3I08A
chains in the Genus database with same CATH superfamily
4X66C 2DYJA 1MXAA 1ZB8A 1P4EA 4BBYA 2P20A 3IMLA 4RVNA 2VQFC 4D4GA 4MTNA 4JM1A 1O92A 2OPLB 2UXBC 5E7QA 5A1GA 3NI2A 5LMNC 2E8EA 3OTOC 3N2QA 4LFCC 1RY2A 2PROA 4KTVA 5A19A 3LNOA 4DV5C 4RLFA 2VZEA 3LUSA 3N54B 5KYVA 2KDNA 3AF5A 3AF6A 3LGXA 4ZJZA 3CQ3A 4WV3A 4BCAA 2BJOA 2UU9C 1O90A 4LF5C 2EGTA 3CW8X 5AE3A 1I94C 5KYTA 3TDEA 2DPLA 4WS9A 4B3SC 4DR6C 3GR0A 1O9TA 4DV1C 1IBKC 4NXNC 4HPVA 2D1RA 4NOZA 2PN2A 4BSZA 5A1IA 1MDFA 4L2ZA 3CJEA 4B3TC 3UZ0A 4DCTA 1XRCA 3VNRA 4GKJC 2ATWA 3DAYA 2PT7G 5BR8C 2D1QA 2P2QA 4BC7A 2OO4A 1FLOA 4LF7C 1GPMA 3E7XA 4JI7C 4JI3C 4K0BA 5A2QD 4L4QA 2QL8A 4DV4C 1IBLC 4LF9C 4AQYC 4DV7C 2D1SA 4EATA 2QVYX 1TH5A 4JI5C 4D57A 3B7WA 4I9FA 5AE1A 1V25A 2Y4NA 1WH9A 2KZ0A 2V7BA 2YWBA 2NCLA 2VQEC 3RV2A 1HNXC 4LF4C 4DV0C 3I08A 1HR0C 2P2FA 1UWDA 3NPDA 1UKKA 4RVOA 1LQLA 3PESA 4U5YD 2VSQA 4DV3C 3T1HC 3R9WA 2E8FA 1WF3A 5ADZA 3UEBA 1HH2P 4TPSB 4XX2A 4JI2C 5BSRA 2M5HA 3J80D 1USPB 3T1YC 2P2JA 1XRBA 4LFBC 3IEUA 3KXWA 1IBMC 3NYRA 1XS3A 4B3MC 4JV5C 4YY3C 3R9XA 1N36C 1XMQC 1PU1A 4BC9A 1MXBA 4LFAC 2ASBA 2MM9A 2CU6A 3EQ6A 1JOSA 3E7WA 4G37A 4DR2C 4KHPC 4GXRA 4R1LA 3RG2A 3J81D 4L7IA 2P2MA 4DV2C 2QVZX 1XRAA 4LE5A 2D28C 3CQ1A 3H2TA 5IT9D 2UUCC 1YJ7A 4DCUA 1AMUA 5JRHA 4PHTA 3IEVA 2P2BA 1QWIA 4RLQA 2Y4OA 4RM3A 4JI0C 1MDBA 5GTDA 4OX9C 1V26A 3A4IA 1L2FA 3L95X 4DR5C 3O2EA 3G7SA 2UUBC 1VEHA 4GXQA 4GS5A 2E0GA 4OYCA 4K0KC 5BURA 4X65C 2E8CA 3GR1A 1V60A 1RG9A 2WP0C 2QW0X 2AYAA 4ZLPA 2Z51A 2XR1A 4I9GA 4B3RC 1LCIA 1PG3A 4YHHC 1N34C 3GPCA 4DG8A 3LNVA 5BUSA 1XNQC 1HNZC 2OBVA 3EERA 3R44A 4JI6C 4LF6C 4FUQA 1BA3A 4DR4C 1USPA 2YX1A 3S82A 2BH1X 2E7GA 4KTTA 4X64C 3VNQA 5CZVA 2E5LC 2F4VC 4PZPA 5LCIA 1NY8A 2DHMA 5IFIA 1MD9A 3FCCA 3TQIA 2ZZNA 5DV9A 1EGAA 5BSUA 2D7VA 1N2FA 4X62C 3ETOA 2ZZMA 2YWCA 3VNSA 4G1IA 4D4IA 2UXCC 4IZ6A 1ZB9A 3DLPX 5H9UA 4R0MA 4PUGA 3A9UA 3PBKA 4GKKC 1MKYA 2MMAB 4DUZC 2JNVA 2CXCA 1HNWC 5LMUC 4DR1C 3AY0A 2MCQA 1QM4A 3A26A 2UXDC 3TUFA 5BSTA 3I07A 5T8TA 4RMNA 3NYQA 1N33C 4DCVA 5BSMA 4LF8C 3UX2A 4JYAC 1PG4A 2JMPA 4DV6C 1NYEA 2HHHC 5BSWA 5K85A 3PROC 4ODJA 3FCEA 3A9VA 2ONFA 3GKUA 1VLAA 4DG9A 4DCSA 4RM2A 5KEIA 1FJGC 4G36A 4JI4C 3LAXA 4FUTA 1MXCA 1P7LA 1T5HX 1J5EC 1XNRC 3ETCA 1ULTA 5T8SA 5IWAC 4FTFA 2UUAC 3UX3A 1XMOC 5FLXD 2D1TA 3TR3A 2D27A 2ZM6C 4R1MA 2YCBA 2CY1A 5CZXA 4JI1C 4ISBA 3JAMD 1KKGA 4DUYC 2Y27A 1XHJA 1T5DX 1IB8A 5BUQA 5AE2A 1K0RA 3A25A 1O93A 3CW9A 4PUHA 3DHVA 4MH4A 4DR3C 4D56A 4DR7C 1M6XA 1WCJA 2HJGA 1PA4A 3CQ2A 4JI8C 4PUIA 1M6XC 5BSVA 5K8FA 2M5OA 2QVXX 2P02A 3L8CA 4NXMC 1N32C 2KZFA 2WD9A 3K6RA 1ML8A 3IPLA 3SO4A 1P4EC 3UOWA 4NDNA 2OPLA 1FUGA 4OXIA 4PROC 4IR7A 3C5EA
chains in the Genus database with same CATH topology
4X66C 2DYJA 1MXAA 1ZB8A 4BBYA 2P20A 3IMLA 4RVNA 2VQFC 4D4GA 4MTNA 4JM1A 1O92A 2OPLB 2UXBC 5E7QA 5A1GA 3NI2A 5LMNC 2E8EA 3OTOC 3N2QA 4LFCC 1RY2A 2PROA 4KTVA 5A19A 4DV5C 4RLFA 2VZEA 3LUSA 3N54B 5KYVA 3AF5A 3AF6A 3LGXA 4ZJZA 4WV3A 4BCAA 2BJOA 2UU9C 1O90A 4LF5C 2EGTA 3CW8X 5AE3A 1I94C 5KYTA 3TDEA 2DPLA 4WS9A 4B3SC 4DR6C 3GR0A 1O9TA 4DV1C 1IBKC 4NXNC 4HPVA 2D1RA 4NOZA 2PN2A 4BSZA 5A1IA 1MDFA 4L2ZA 3CJEA 4B3TC 3UZ0A 4DCTA 1XRCA 3VNRA 4GKJC 2ATWA 3DAYA 2PT7G 5BR8C 2D1QA 2P2QA 4BC7A 2OO4A 4LF7C 1GPMA 3E7XA 4JI7C 4JI3C 4K0BA 5A2QD 4L4QA 2QL8A 4DV4C 1IBLC 4LF9C 4AQYC 4DV7C 2D1SA 4EATA 2QVYX 4JI5C 4D57A 3B7WA 4I9FA 5AE1A 1V25A 2Y4NA 1WH9A 2V7BA 2YWBA 2VQEC 3RV2A 1HNXC 4LF4C 4DV0C 3I08A 1HR0C 2P2FA 3NPDA 1UKKA 4RVOA 1LQLA 3PESA 4U5YD 2VSQA 4DV3C 3T1HC 3R9WA 2E8FA 1WF3A 5ADZA 1HH2P 4TPSB 4XX2A 4JI2C 5BSRA 3J80D 1USPB 3T1YC 2P2JA 1XRBA 4LFBC 3IEUA 3KXWA 1IBMC 3NYRA 4B3MC 4JV5C 4YY3C 3R9XA 1N36C 1XMQC 4BC9A 1MXBA 4LFAC 2ASBA 3EQ6A 1JOSA 3E7WA 4G37A 4DR2C 4KHPC 4GXRA 4R1LA 3RG2A 3J81D 4L7IA 2P2MA 4DV2C 2QVZX 1XRAA 4LE5A 2D28C 3H2TA 5IT9D 2UUCC 1YJ7A 4DCUA 1AMUA 5JRHA 4PHTA 3IEVA 2P2BA 1QWIA 4RLQA 2Y4OA 4RM3A 4JI0C 1MDBA 5GTDA 4OX9C 1V26A 3A4IA 1L2FA 3L95X 4DR5C 3G7SA 2UUBC 4GXQA 4GS5A 2E0GA 4OYCA 4K0KC 5BURA 4X65C 2E8CA 3GR1A 1RG9A 2WP0C 2QW0X 2AYAA 4ZLPA 2XR1A 4I9GA 4B3RC 1LCIA 1PG3A 4YHHC 1N34C 3GPCA 4DG8A 3LNVA 5BUSA 1XNQC 1HNZC 2OBVA 3EERA 3R44A 4JI6C 4LF6C 4FUQA 1BA3A 4DR4C 1USPA 3S82A 2BH1X 2E7GA 4KTTA 4X64C 3VNQA 5CZVA 2E5LC 2F4VC 4PZPA 5IFIA 1MD9A 3FCCA 3TQIA 5DV9A 1EGAA 5BSUA 2D7VA 1N2FA 4X62C 3ETOA 2YWCA 3VNSA 4G1IA 4D4IA 2UXCC 4IZ6A 1ZB9A 3DLPX 5H9UA 4R0MA 3A9UA 3PBKA 4GKKC 1MKYA 4DUZC 2CXCA 1HNWC 5LMUC 4DR1C 1QM4A 2UXDC 3TUFA 5BSTA 3I07A 5T8TA 4RMNA 3NYQA 1N33C 4DCVA 5BSMA 4LF8C 4JYAC 1PG4A 2JMPA 4DV6C 1NYEA 2HHHC 5BSWA 5K85A 3PROC 4ODJA 3FCEA 3A9VA 2ONFA 3GKUA 1VLAA 4DG9A 4DCSA 4RM2A 5KEIA 1FJGC 4G36A 4JI4C 3LAXA 4FUTA 1MXCA 1P7LA 1T5HX 1J5EC 1XNRC 3ETCA 1ULTA 5T8SA 5IWAC 4FTFA 2UUAC 1XMOC 5FLXD 2D1TA 2D27A 2ZM6C 4R1MA 2YCBA 2CY1A 5CZXA 4JI1C 4ISBA 3JAMD 1KKGA 4DUYC 2Y27A 1T5DX 5BUQA 5AE2A 1K0RA 1O93A 3CW9A 3DHVA 4MH4A 4DR3C 4D56A 4DR7C 2HJGA 1PA4A 4JI8C 5BSVA 5K8FA 2QVXX 4NXMC 2P02A 3L8CA 1N32C 2KZFA 2WD9A 1ML8A 3IPLA 3SO4A 3UOWA 4NDNA 2OPLA 1FUGA 4OXIA 4PROC 4IR7A 3C5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I08 A; 
#chains in the Genus database with same CATH topology
 4X66 C;  2DYJ A;  1MXA A;  1ZB8 A;  1P4E A;  4BBY A;  2P20 A;  3IML A;  4RVN A;  2VQF C;  4D4G A;  4MTN A;  4JM1 A;  1O92 A;  2OPL B;  2UXB C;  5E7Q A;  5A1G A;  3NI2 A;  5LMN C;  2E8E A;  3OTO C;  3N2Q A;  4LFC C;  1RY2 A;  2PRO A;  4KTV A;  5A19 A;  3LNO A;  4DV5 C;  4RLF A;  2VZE A;  3LUS A;  3N54 B;  5KYV A;  2KDN A;  3AF5 A;  3AF6 A;  3LGX A;  4ZJZ A;  3CQ3 A;  4WV3 A;  4BCA A;  2BJO A;  2UU9 C;  1O90 A;  4LF5 C;  2EGT A;  3CW8 X;  5AE3 A;  1I94 C;  5KYT A;  3TDE A;  2DPL A;  4WS9 A;  4B3S C;  4DR6 C;  3GR0 A;  1O9T A;  4DV1 C;  1IBK C;  4NXN C;  4HPV A;  2D1R A;  4NOZ A;  2PN2 A;  4BSZ A;  5A1I A;  1MDF A;  4L2Z A;  3CJE A;  4B3T C;  3UZ0 A;  4DCT A;  1XRC A;  3VNR A;  4GKJ C;  2ATW A;  3DAY A;  2PT7 G;  5BR8 C;  2D1Q A;  2P2Q A;  4BC7 A;  2OO4 A;  1FLO A;  4LF7 C;  1GPM A;  3E7X A;  4JI7 C;  4JI3 C;  4K0B A;  5A2Q D;  4L4Q A;  2QL8 A;  4DV4 C;  1IBL C;  4LF9 C;  4AQY C;  4DV7 C;  2D1S A;  4EAT A;  2QVY X;  1TH5 A;  4JI5 C;  4D57 A;  3B7W A;  4I9F A;  5AE1 A;  1V25 A;  2Y4N A;  1WH9 A;  2KZ0 A;  2V7B A;  2YWB A;  2NCL A;  2VQE C;  3RV2 A;  1HNX C;  4LF4 C;  4DV0 C;  3I08 A;  1HR0 C;  2P2F A;  1UWD A;  3NPD A;  1UKK A;  4RVO A;  1LQL A;  3PES A;  4U5Y D;  2VSQ A;  4DV3 C;  3T1H C;  3R9W A;  2E8F A;  1WF3 A;  5ADZ A;  3UEB A;  1HH2 P;  4TPS B;  4XX2 A;  4JI2 C;  5BSR A;  2M5H A;  3J80 D;  1USP B;  3T1Y C;  2P2J A;  1XRB A;  4LFB C;  3IEU A;  3KXW A;  1IBM C;  3NYR A;  1XS3 A;  4B3M C;  4JV5 C;  4YY3 C;  3R9X A;  1N36 C;  1XMQ C;  1PU1 A;  4BC9 A;  1MXB A;  4LFA C;  2ASB A;  2MM9 A;  2CU6 A;  3EQ6 A;  1JOS A;  3E7W A;  4G37 A;  4DR2 C;  4KHP C;  4GXR A;  4R1L A;  3RG2 A;  3J81 D;  4L7I A;  2P2M A;  4DV2 C;  2QVZ X;  1XRA A;  4LE5 A;  2D28 C;  3CQ1 A;  3H2T A;  5IT9 D;  2UUC C;  1YJ7 A;  4DCU A;  1AMU A;  5JRH A;  4PHT A;  3IEV A;  2P2B A;  1QWI A;  4RLQ A;  2Y4O A;  4RM3 A;  4JI0 C;  1MDB A;  5GTD A;  4OX9 C;  1V26 A;  3A4I A;  1L2F A;  3L95 X;  4DR5 C;  3O2E A;  3G7S A;  2UUB C;  1VEH A;  4GXQ A;  4GS5 A;  2E0G A;  4OYC A;  4K0K C;  5BUR A;  4X65 C;  2E8C A;  3GR1 A;  1V60 A;  1RG9 A;  2WP0 C;  2QW0 X;  2AYA A;  4ZLP A;  2Z51 A;  2XR1 A;  4I9G A;  4B3R C;  1LCI A;  1PG3 A;  4YHH C;  1N34 C;  3GPC A;  4DG8 A;  3LNV A;  5BUS A;  1XNQ C;  1HNZ C;  2OBV A;  3EER A;  3R44 A;  4JI6 C;  4LF6 C;  4FUQ A;  1BA3 A;  4DR4 C;  1USP A;  2YX1 A;  3S82 A;  2BH1 X;  2E7G A;  4KTT A;  4X64 C;  3VNQ A;  5CZV A;  2E5L C;  2F4V C;  4PZP A;  5LCI A;  1NY8 A;  2DHM A;  5IFI A;  1MD9 A;  3FCC A;  3TQI A;  2ZZN A;  5DV9 A;  1EGA A;  5BSU A;  2D7V A;  1N2F A;  4X62 C;  3ETO A;  2ZZM A;  2YWC A;  3VNS A;  4G1I A;  4D4I A;  2UXC C;  4IZ6 A;  1ZB9 A;  3DLP X;  5H9U A;  4R0M A;  4PUG A;  3A9U A;  3PBK A;  4GKK C;  1MKY A;  2MMA B;  4DUZ C;  2JNV A;  2CXC A;  1HNW C;  5LMU C;  4DR1 C;  3AY0 A;  2MCQ A;  1QM4 A;  3A26 A;  2UXD C;  3TUF A;  5BST A;  3I07 A;  5T8T A;  4RMN A;  3NYQ A;  1N33 C;  4DCV A;  5BSM A;  4LF8 C;  3UX2 A;  4JYA C;  1PG4 A;  2JMP A;  4DV6 C;  1NYE A;  2HHH C;  5BSW A;  5K85 A;  3PRO C;  4ODJ A;  3FCE A;  3A9V A;  2ONF A;  3GKU A;  1VLA A;  4DG9 A;  4DCS A;  4RM2 A;  5KEI A;  1FJG C;  4G36 A;  4JI4 C;  3LAX A;  4FUT A;  1MXC A;  1P7L A;  1T5H X;  1J5E C;  1XNR C;  3ETC A;  1ULT A;  5T8S A;  5IWA C;  4FTF A;  2UUA C;  3UX3 A;  1XMO C;  5FLX D;  2D1T A;  3TR3 A;  2D27 A;  2ZM6 C;  4R1M A;  2YCB A;  2CY1 A;  5CZX A;  4JI1 C;  4ISB A;  3JAM D;  1KKG A;  4DUY C;  2Y27 A;  1XHJ A;  1T5D X;  1IB8 A;  5BUQ A;  5AE2 A;  1K0R A;  3A25 A;  1O93 A;  3CW9 A;  4PUH A;  3DHV A;  4MH4 A;  4DR3 C;  4D56 A;  4DR7 C;  1M6X A;  1WCJ A;  2HJG A;  1PA4 A;  3CQ2 A;  4JI8 C;  4PUI A;  1M6X C;  5BSV A;  5K8F A;  2M5O A;  2QVX X;  2P02 A;  3L8C A;  4NXM C;  1N32 C;  2KZF A;  2WD9 A;  3K6R A;  1ML8 A;  3IPL A;  3SO4 A;  1P4E C;  3UOW A;  4NDN A;  2OPL A;  1FUG A;  4OXI A;  4PRO C;  4IR7 A;  3C5E A; 
#chains in the Genus database with same CATH homology
 4X66 C;  2DYJ A;  1MXA A;  1ZB8 A;  4BBY A;  2P20 A;  3IML A;  4RVN A;  2VQF C;  4D4G A;  4MTN A;  4JM1 A;  1O92 A;  2OPL B;  2UXB C;  5E7Q A;  5A1G A;  3NI2 A;  5LMN C;  2E8E A;  3OTO C;  3N2Q A;  4LFC C;  1RY2 A;  2PRO A;  4KTV A;  5A19 A;  4DV5 C;  4RLF A;  2VZE A;  3LUS A;  3N54 B;  5KYV A;  3AF5 A;  3AF6 A;  3LGX A;  4ZJZ A;  4WV3 A;  4BCA A;  2BJO A;  2UU9 C;  1O90 A;  4LF5 C;  2EGT A;  3CW8 X;  5AE3 A;  1I94 C;  5KYT A;  3TDE A;  2DPL A;  4WS9 A;  4B3S C;  4DR6 C;  3GR0 A;  1O9T A;  4DV1 C;  1IBK C;  4NXN C;  4HPV A;  2D1R A;  4NOZ A;  2PN2 A;  4BSZ A;  5A1I A;  1MDF A;  4L2Z A;  3CJE A;  4B3T C;  3UZ0 A;  4DCT A;  1XRC A;  3VNR A;  4GKJ C;  2ATW A;  3DAY A;  2PT7 G;  5BR8 C;  2D1Q A;  2P2Q A;  4BC7 A;  2OO4 A;  4LF7 C;  1GPM A;  3E7X A;  4JI7 C;  4JI3 C;  4K0B A;  5A2Q D;  4L4Q A;  2QL8 A;  4DV4 C;  1IBL C;  4LF9 C;  4AQY C;  4DV7 C;  2D1S A;  4EAT A;  2QVY X;  4JI5 C;  4D57 A;  3B7W A;  4I9F A;  5AE1 A;  1V25 A;  2Y4N A;  1WH9 A;  2V7B A;  2YWB A;  2VQE C;  3RV2 A;  1HNX C;  4LF4 C;  4DV0 C;  3I08 A;  1HR0 C;  2P2F A;  3NPD A;  1UKK A;  4RVO A;  1LQL A;  3PES A;  4U5Y D;  2VSQ A;  4DV3 C;  3T1H C;  3R9W A;  2E8F A;  1WF3 A;  5ADZ A;  1HH2 P;  4TPS B;  4XX2 A;  4JI2 C;  5BSR A;  3J80 D;  1USP B;  3T1Y C;  2P2J A;  1XRB A;  4LFB C;  3IEU A;  3KXW A;  1IBM C;  3NYR A;  4B3M C;  4JV5 C;  4YY3 C;  3R9X A;  1N36 C;  1XMQ C;  4BC9 A;  1MXB A;  4LFA C;  2ASB A;  3EQ6 A;  1JOS A;  3E7W A;  4G37 A;  4DR2 C;  4KHP C;  4GXR A;  4R1L A;  3RG2 A;  3J81 D;  4L7I A;  2P2M A;  4DV2 C;  2QVZ X;  1XRA A;  4LE5 A;  2D28 C;  3H2T A;  5IT9 D;  2UUC C;  1YJ7 A;  4DCU A;  1AMU A;  5JRH A;  4PHT A;  3IEV A;  2P2B A;  1QWI A;  4RLQ A;  2Y4O A;  4RM3 A;  4JI0 C;  1MDB A;  5GTD A;  4OX9 C;  1V26 A;  3A4I A;  1L2F A;  3L95 X;  4DR5 C;  3G7S A;  2UUB C;  4GXQ A;  4GS5 A;  2E0G A;  4OYC A;  4K0K C;  5BUR A;  4X65 C;  2E8C A;  3GR1 A;  1RG9 A;  2WP0 C;  2QW0 X;  2AYA A;  4ZLP A;  2XR1 A;  4I9G A;  4B3R C;  1LCI A;  1PG3 A;  4YHH C;  1N34 C;  3GPC A;  4DG8 A;  3LNV A;  5BUS A;  1XNQ C;  1HNZ C;  2OBV A;  3EER A;  3R44 A;  4JI6 C;  4LF6 C;  4FUQ A;  1BA3 A;  4DR4 C;  1USP A;  3S82 A;  2BH1 X;  2E7G A;  4KTT A;  4X64 C;  3VNQ A;  5CZV A;  2E5L C;  2F4V C;  4PZP A;  5IFI A;  1MD9 A;  3FCC A;  3TQI A;  5DV9 A;  1EGA A;  5BSU A;  2D7V A;  1N2F A;  4X62 C;  3ETO A;  2YWC A;  3VNS A;  4G1I A;  4D4I A;  2UXC C;  4IZ6 A;  1ZB9 A;  3DLP X;  5H9U A;  4R0M A;  3A9U A;  3PBK A;  4GKK C;  1MKY A;  4DUZ C;  2CXC A;  1HNW C;  5LMU C;  4DR1 C;  1QM4 A;  2UXD C;  3TUF A;  5BST A;  3I07 A;  5T8T A;  4RMN A;  3NYQ A;  1N33 C;  4DCV A;  5BSM A;  4LF8 C;  4JYA C;  1PG4 A;  2JMP A;  4DV6 C;  1NYE A;  2HHH C;  5BSW A;  5K85 A;  3PRO C;  4ODJ A;  3FCE A;  3A9V A;  2ONF A;  3GKU A;  1VLA A;  4DG9 A;  4DCS A;  4RM2 A;  5KEI A;  1FJG C;  4G36 A;  4JI4 C;  3LAX A;  4FUT A;  1MXC A;  1P7L A;  1T5H X;  1J5E C;  1XNR C;  3ETC A;  1ULT A;  5T8S A;  5IWA C;  4FTF A;  2UUA C;  1XMO C;  5FLX D;  2D1T A;  2D27 A;  2ZM6 C;  4R1M A;  2YCB A;  2CY1 A;  5CZX A;  4JI1 C;  4ISB A;  3JAM D;  1KKG A;  4DUY C;  2Y27 A;  1T5D X;  5BUQ A;  5AE2 A;  1K0R A;  1O93 A;  3CW9 A;  3DHV A;  4MH4 A;  4DR3 C;  4D56 A;  4DR7 C;  2HJG A;  1PA4 A;  4JI8 C;  5BSV A;  5K8F A;  2QVX X;  4NXM C;  2P02 A;  3L8C A;  1N32 C;  2KZF A;  2WD9 A;  1ML8 A;  3IPL A;  3SO4 A;  3UOW A;  4NDN A;  2OPL A;  1FUG A;  4OXI A;  4PRO C;  4IR7 A;  3C5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...