3I08A

Crystal structure of the s1-cleaved notch1 negative regulatory region (nrr)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
ACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Neurogenic locus notch homolog protein 1
publication title Effects of S1 cleavage on the structure, surface export, and signaling activity of human Notch1 and Notch2.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A01
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A02
3I08A
chains in the Genus database with same CATH superfamily
2CU6A 2Y4OA 1UKKA 1LQLA 5LMNC 3A26A 4R1MA 1MDBA 4L7IA 3GR0A 4IZ6A 1XRAA 2WD9A 4RM2A 2KZ0A 4ZLPA 4JI1C 5IWAC 2V7BA 1M6XA 4PUIA 4EATA 1MKYA 4LF6C 3CW8X 2E0GA 2MM9A 4DV6C 4LE5A 4G36A 5IFIA 1NYEA 4DG8A 5AE3A 2HJGA 1NY8A 1HR0C 2UU9C 1HH2P 4JM1A 1IB8A 2UUBC 1V26A 2PT7G 4GS5A 1HNXC 2D1TA 5JRHA 1N2FA 4JI4C 4RVOA 4MTNA 2BH1X 2D27A 4DV4C 1IBKC 2Y27A 5A19A 5T8SA 3UX2A 2Y4NA 1QM4A 4LFBC 1ZB9A 3IEVA 4LF5C 2UXBC 1JOSA 4PROC 4X66C 4DCUA 3LNOA 4KTTA 3GPCA 4JI5C 1ULTA 5T8TA 4YY3C 1GPMA 5BUQA 3NYRA 1XNQC 3AF6A 2JMPA 1PG4A 5KYVA 5A1IA 4PUHA 1P7LA 5BSRA 2XR1A 2CY1A 2E8CA 3GKUA 3B7WA 4L2ZA 3N2QA 2UUAC 1WCJA 4YHHC 5AE2A 2E8FA 4KHPC 2ZM6C 4JV5C 1XMQC 3T1HC 1RY2A 2DHMA 2VQFC 2UXDC 2WP0C 3A4IA 2M5OA 4LF7C 4GXRA 3R44A 1WF3A 4IR7A 4BCAA 2D7VA 1XRCA 5LCIA 4DR7C 2ASBA 1V25A 3RV2A 4D4IA 4OX9C 3T1YC 4LFAC 1MDFA 3CJEA 4PUGA 5CZXA 1N33C 1FUGA 1BA3A 1FJGC 3NPDA 4X62C 2YWBA 2OPLB 1V60A 3H2TA 4NOZA 2DPLA 2EGTA 2P2FA 3VNRA 2M5HA 4JI2C 5BSVA 1PG3A 4FUTA 5IT9D 1USPB 5BR8C 3A9UA 4TPSB 1PA4A 1N36C 1LCIA 4PZPA 3UEBA 3E7XA 1AMUA 4BC9A 3VNSA 4DV1C 3UX3A 3J81D 5K85A 2P2QA 4D57A 2E7GA 3LNVA 1ZB8A 5E7QA 3ETOA 3CQ2A 4R0MA 2ZZMA 4JI7C 1KKGA 1MD9A 4OXIA 2BJOA 3LUSA 4X64C 4LF9C 2HHHC 5K8FA 4DR6C 4D56A 4JI3C 3CQ1A 1K0RA 2AYAA 3FCEA 2D1SA 2NCLA 1ML8A 1HNZC 4B3MC 4DCTA 2QVYX 4U5YD 4DR3C 5BSTA 3GR1A 4DCVA 5GTDA 1XRBA 4LF8C 2ATWA 2D1QA 2PROA 1FLOA 3I08A 4R1LA 5A1GA 4HPVA 4DV2C 3NI2A 3RG2A 4KTVA 1O93A 2QVZX 3EERA 2DYJA 4DUZC 1PU1A 4D4GA 2QL8A 2P20A 2VZEA 4G37A 4JYAC 1YJ7A 4RLQA 3PROC 1QWIA 2KDNA 1J5EC 1MXCA 4NXNC 4BBYA 2OPLA 4RLFA 5KYTA 2UXCC 4OYCA 2P2MA 1O9TA 5KEIA 3IMLA 2Z51A 3CQ3A 4B3TC 1USPA 4ZJZA 2YX1A 3E7WA 3AF5A 1XS3A 3A9VA 3AY0A 5A2QD 1XNRC 2OBVA 3DHVA 4JI8C 1P4EC 3J80D 1T5DX 1N34C 3LAXA 4RVNA 5BURA 4RM3A 4K0KC 3TDEA 3DAYA 3DLPX 2D28C 4NXMC 2E8EA 3L95X 4L4QA 5DV9A 3JAMD 4ISBA 4GXQA 4X65C 3UZ0A 5BSUA 2VQEC 2P2BA 3IPLA 4PHTA 3UOWA 3R9WA 3PESA 2P2JA 4XX2A 5H9UA 3L8CA 3N54B 3TUFA 4MH4A 2MCQA 3K6RA 4DR1C 3TQIA 5BUSA 1XHJA 1M6XC 1MXAA 1T5HX 4DR5C 3ETCA 3A25A 3PBKA 3C5EA 3FCCA 2QVXX 3OTOC 4DCSA 3IEUA 2ZZNA 1UWDA 4BSZA 2VSQA 3SO4A 2QW0X 4DV7C 5AE1A 2P02A 2F4VC 2MMAB 5BSWA 4DR2C 4DV0C 2YCBA 4FTFA 2YWCA 3O2EA 3LGXA 4BC7A 4I9GA 1VEHA 4ODJA 5ADZA 1O92A 4DV5C 1TH5A 4LFCC 2D1RA 4WS9A 1MXBA 1VLAA 4GKKC 4K0BA 4WV3A 4B3SC 4DG9A 2JNVA 4NDNA 1XMOC 1N32C 5BSMA 2KZFA 4JI6C 3G7SA 1IBLC 2OO4A 3EQ6A 3NYQA 3R9XA 1L2FA 4AQYC 4GKJC 4DR4C 4LF4C 3CW9A 5LMUC 1WH9A 4I9FA 3KXWA 3VNQA 2ONFA 4DUYC 1EGAA 2CXCA 1RG9A 2PN2A 4B3RC 3S82A 4RMNA 1HNWC 5FLXD 4DV3C 4JI0C 2UUCC 3TR3A 3I07A 2E5LC 4G1IA 1IBMC 1P4EA 1I94C 4FUQA 5CZVA 1O90A
chains in the Genus database with same CATH topology
2Y4OA 1UKKA 1LQLA 5LMNC 4R1MA 1MDBA 4L7IA 3GR0A 4IZ6A 1XRAA 2WD9A 4RM2A 4ZLPA 4JI1C 5IWAC 2V7BA 4EATA 1MKYA 4LF6C 3CW8X 2E0GA 4DV6C 4LE5A 4G36A 5IFIA 1NYEA 4DG8A 5AE3A 2HJGA 1HR0C 2UU9C 1HH2P 4JM1A 2UUBC 1V26A 2PT7G 4GS5A 1HNXC 2D1TA 5JRHA 1N2FA 4JI4C 4RVOA 4MTNA 2BH1X 2D27A 4DV4C 1IBKC 2Y27A 5A19A 5T8SA 2Y4NA 1QM4A 4LFBC 1ZB9A 3IEVA 4LF5C 2UXBC 1JOSA 4PROC 4X66C 4DCUA 4KTTA 3GPCA 4JI5C 1ULTA 5T8TA 4YY3C 1GPMA 5BUQA 3NYRA 1XNQC 3AF6A 2JMPA 1PG4A 5KYVA 5A1IA 1P7LA 5BSRA 2XR1A 2CY1A 2E8CA 3GKUA 3B7WA 4L2ZA 3N2QA 2UUAC 4YHHC 5AE2A 2E8FA 4KHPC 2ZM6C 4JV5C 1XMQC 3T1HC 1RY2A 2VQFC 2UXDC 2WP0C 3A4IA 4LF7C 4GXRA 3R44A 1WF3A 4IR7A 4BCAA 2D7VA 1XRCA 4DR7C 2ASBA 1V25A 3RV2A 4D4IA 4OX9C 3T1YC 4LFAC 1MDFA 3CJEA 5CZXA 1N33C 1FUGA 1BA3A 1FJGC 3NPDA 4X62C 2YWBA 2OPLB 3H2TA 4NOZA 2DPLA 2EGTA 2P2FA 3VNRA 4JI2C 5BSVA 1PG3A 4FUTA 5IT9D 1USPB 5BR8C 3A9UA 4TPSB 1PA4A 1N36C 1LCIA 4PZPA 3E7XA 1AMUA 4BC9A 3VNSA 4DV1C 3J81D 5K85A 2P2QA 4D57A 2E7GA 3LNVA 1ZB8A 5E7QA 3ETOA 4R0MA 4JI7C 1KKGA 1MD9A 4OXIA 2BJOA 3LUSA 4X64C 4LF9C 2HHHC 5K8FA 4DR6C 4D56A 4JI3C 1K0RA 2AYAA 3FCEA 2D1SA 1ML8A 1HNZC 4B3MC 4DCTA 2QVYX 4U5YD 4DR3C 5BSTA 3GR1A 4DCVA 5GTDA 1XRBA 4LF8C 2ATWA 2D1QA 2PROA 3I08A 4R1LA 5A1GA 4HPVA 4DV2C 3NI2A 3RG2A 4KTVA 1O93A 2QVZX 3EERA 2DYJA 4DUZC 4D4GA 2QL8A 2P20A 2VZEA 4G37A 4JYAC 1YJ7A 4RLQA 3PROC 1QWIA 1J5EC 1MXCA 4NXNC 4BBYA 2OPLA 4RLFA 5KYTA 2UXCC 4OYCA 2P2MA 1O9TA 5KEIA 3IMLA 4B3TC 1USPA 4ZJZA 3E7WA 3AF5A 3A9VA 5A2QD 1XNRC 2OBVA 3DHVA 4JI8C 3J80D 1T5DX 1N34C 3LAXA 4RVNA 5BURA 4RM3A 4K0KC 3TDEA 3DAYA 3DLPX 2D28C 4NXMC 2E8EA 3L95X 4L4QA 5DV9A 3JAMD 4ISBA 4GXQA 4X65C 3UZ0A 5BSUA 2VQEC 2P2BA 3IPLA 4PHTA 3UOWA 3R9WA 3PESA 2P2JA 4XX2A 5H9UA 3L8CA 3N54B 3TUFA 4MH4A 4DR1C 3TQIA 5BUSA 1MXAA 1T5HX 4DR5C 3ETCA 3PBKA 3C5EA 3FCCA 2QVXX 3OTOC 4DCSA 3IEUA 4BSZA 2VSQA 3SO4A 2QW0X 4DV7C 5AE1A 2P02A 2F4VC 5BSWA 4DR2C 4DV0C 2YCBA 4FTFA 2YWCA 3LGXA 4BC7A 4I9GA 4ODJA 5ADZA 1O92A 4DV5C 4LFCC 2D1RA 4WS9A 1MXBA 1VLAA 4GKKC 4K0BA 4WV3A 4B3SC 4DG9A 4NDNA 1XMOC 1N32C 5BSMA 2KZFA 4JI6C 3G7SA 1IBLC 2OO4A 3EQ6A 3NYQA 3R9XA 1L2FA 4AQYC 4GKJC 4DR4C 4LF4C 3CW9A 5LMUC 1WH9A 4I9FA 3KXWA 3VNQA 2ONFA 4DUYC 1EGAA 2CXCA 1RG9A 2PN2A 4B3RC 3S82A 4RMNA 1HNWC 5FLXD 4DV3C 4JI0C 2UUCC 3I07A 2E5LC 4G1IA 1IBMC 1I94C 4FUQA 5CZVA 1O90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I08 A; 
#chains in the Genus database with same CATH topology
 2CU6 A;  2Y4O A;  1UKK A;  1LQL A;  5LMN C;  3A26 A;  4R1M A;  1MDB A;  4L7I A;  3GR0 A;  4IZ6 A;  1XRA A;  2WD9 A;  4RM2 A;  2KZ0 A;  4ZLP A;  4JI1 C;  5IWA C;  2V7B A;  1M6X A;  4PUI A;  4EAT A;  1MKY A;  4LF6 C;  3CW8 X;  2E0G A;  2MM9 A;  4DV6 C;  4LE5 A;  4G36 A;  5IFI A;  1NYE A;  4DG8 A;  5AE3 A;  2HJG A;  1NY8 A;  1HR0 C;  2UU9 C;  1HH2 P;  4JM1 A;  1IB8 A;  2UUB C;  1V26 A;  2PT7 G;  4GS5 A;  1HNX C;  2D1T A;  5JRH A;  1N2F A;  4JI4 C;  4RVO A;  4MTN A;  2BH1 X;  2D27 A;  4DV4 C;  1IBK C;  2Y27 A;  5A19 A;  5T8S A;  3UX2 A;  2Y4N A;  1QM4 A;  4LFB C;  1ZB9 A;  3IEV A;  4LF5 C;  2UXB C;  1JOS A;  4PRO C;  4X66 C;  4DCU A;  3LNO A;  4KTT A;  3GPC A;  4JI5 C;  1ULT A;  5T8T A;  4YY3 C;  1GPM A;  5BUQ A;  3NYR A;  1XNQ C;  3AF6 A;  2JMP A;  1PG4 A;  5KYV A;  5A1I A;  4PUH A;  1P7L A;  5BSR A;  2XR1 A;  2CY1 A;  2E8C A;  3GKU A;  3B7W A;  4L2Z A;  3N2Q A;  2UUA C;  1WCJ A;  4YHH C;  5AE2 A;  2E8F A;  4KHP C;  2ZM6 C;  4JV5 C;  1XMQ C;  3T1H C;  1RY2 A;  2DHM A;  2VQF C;  2UXD C;  2WP0 C;  3A4I A;  2M5O A;  4LF7 C;  4GXR A;  3R44 A;  1WF3 A;  4IR7 A;  4BCA A;  2D7V A;  1XRC A;  5LCI A;  4DR7 C;  2ASB A;  1V25 A;  3RV2 A;  4D4I A;  4OX9 C;  3T1Y C;  4LFA C;  1MDF A;  3CJE A;  4PUG A;  5CZX A;  1N33 C;  1FUG A;  1BA3 A;  1FJG C;  3NPD A;  4X62 C;  2YWB A;  2OPL B;  1V60 A;  3H2T A;  4NOZ A;  2DPL A;  2EGT A;  2P2F A;  3VNR A;  2M5H A;  4JI2 C;  5BSV A;  1PG3 A;  4FUT A;  5IT9 D;  1USP B;  5BR8 C;  3A9U A;  4TPS B;  1PA4 A;  1N36 C;  1LCI A;  4PZP A;  3UEB A;  3E7X A;  1AMU A;  4BC9 A;  3VNS A;  4DV1 C;  3UX3 A;  3J81 D;  5K85 A;  2P2Q A;  4D57 A;  2E7G A;  3LNV A;  1ZB8 A;  5E7Q A;  3ETO A;  3CQ2 A;  4R0M A;  2ZZM A;  4JI7 C;  1KKG A;  1MD9 A;  4OXI A;  2BJO A;  3LUS A;  4X64 C;  4LF9 C;  2HHH C;  5K8F A;  4DR6 C;  4D56 A;  4JI3 C;  3CQ1 A;  1K0R A;  2AYA A;  3FCE A;  2D1S A;  2NCL A;  1ML8 A;  1HNZ C;  4B3M C;  4DCT A;  2QVY X;  4U5Y D;  4DR3 C;  5BST A;  3GR1 A;  4DCV A;  5GTD A;  1XRB A;  4LF8 C;  2ATW A;  2D1Q A;  2PRO A;  1FLO A;  3I08 A;  4R1L A;  5A1G A;  4HPV A;  4DV2 C;  3NI2 A;  3RG2 A;  4KTV A;  1O93 A;  2QVZ X;  3EER A;  2DYJ A;  4DUZ C;  1PU1 A;  4D4G A;  2QL8 A;  2P20 A;  2VZE A;  4G37 A;  4JYA C;  1YJ7 A;  4RLQ A;  3PRO C;  1QWI A;  2KDN A;  1J5E C;  1MXC A;  4NXN C;  4BBY A;  2OPL A;  4RLF A;  5KYT A;  2UXC C;  4OYC A;  2P2M A;  1O9T A;  5KEI A;  3IML A;  2Z51 A;  3CQ3 A;  4B3T C;  1USP A;  4ZJZ A;  2YX1 A;  3E7W A;  3AF5 A;  1XS3 A;  3A9V A;  3AY0 A;  5A2Q D;  1XNR C;  2OBV A;  3DHV A;  4JI8 C;  1P4E C;  3J80 D;  1T5D X;  1N34 C;  3LAX A;  4RVN A;  5BUR A;  4RM3 A;  4K0K C;  3TDE A;  3DAY A;  3DLP X;  2D28 C;  4NXM C;  2E8E A;  3L95 X;  4L4Q A;  5DV9 A;  3JAM D;  4ISB A;  4GXQ A;  4X65 C;  3UZ0 A;  5BSU A;  2VQE C;  2P2B A;  3IPL A;  4PHT A;  3UOW A;  3R9W A;  3PES A;  2P2J A;  4XX2 A;  5H9U A;  3L8C A;  3N54 B;  3TUF A;  4MH4 A;  2MCQ A;  3K6R A;  4DR1 C;  3TQI A;  5BUS A;  1XHJ A;  1M6X C;  1MXA A;  1T5H X;  4DR5 C;  3ETC A;  3A25 A;  3PBK A;  3C5E A;  3FCC A;  2QVX X;  3OTO C;  4DCS A;  3IEU A;  2ZZN A;  1UWD A;  4BSZ A;  2VSQ A;  3SO4 A;  2QW0 X;  4DV7 C;  5AE1 A;  2P02 A;  2F4V C;  2MMA B;  5BSW A;  4DR2 C;  4DV0 C;  2YCB A;  4FTF A;  2YWC A;  3O2E A;  3LGX A;  4BC7 A;  4I9G A;  1VEH A;  4ODJ A;  5ADZ A;  1O92 A;  4DV5 C;  1TH5 A;  4LFC C;  2D1R A;  4WS9 A;  1MXB A;  1VLA A;  4GKK C;  4K0B A;  4WV3 A;  4B3S C;  4DG9 A;  2JNV A;  4NDN A;  1XMO C;  1N32 C;  5BSM A;  2KZF A;  4JI6 C;  3G7S A;  1IBL C;  2OO4 A;  3EQ6 A;  3NYQ A;  3R9X A;  1L2F A;  4AQY C;  4GKJ C;  4DR4 C;  4LF4 C;  3CW9 A;  5LMU C;  1WH9 A;  4I9F A;  3KXW A;  3VNQ A;  2ONF A;  4DUY C;  1EGA A;  2CXC A;  1RG9 A;  2PN2 A;  4B3R C;  3S82 A;  4RMN A;  1HNW C;  5FLX D;  4DV3 C;  4JI0 C;  2UUC C;  3TR3 A;  3I07 A;  2E5L C;  4G1I A;  1IBM C;  1P4E A;  1I94 C;  4FUQ A;  5CZV A;  1O90 A; 
#chains in the Genus database with same CATH homology
 2Y4O A;  1UKK A;  1LQL A;  5LMN C;  4R1M A;  1MDB A;  4L7I A;  3GR0 A;  4IZ6 A;  1XRA A;  2WD9 A;  4RM2 A;  4ZLP A;  4JI1 C;  5IWA C;  2V7B A;  4EAT A;  1MKY A;  4LF6 C;  3CW8 X;  2E0G A;  4DV6 C;  4LE5 A;  4G36 A;  5IFI A;  1NYE A;  4DG8 A;  5AE3 A;  2HJG A;  1HR0 C;  2UU9 C;  1HH2 P;  4JM1 A;  2UUB C;  1V26 A;  2PT7 G;  4GS5 A;  1HNX C;  2D1T A;  5JRH A;  1N2F A;  4JI4 C;  4RVO A;  4MTN A;  2BH1 X;  2D27 A;  4DV4 C;  1IBK C;  2Y27 A;  5A19 A;  5T8S A;  2Y4N A;  1QM4 A;  4LFB C;  1ZB9 A;  3IEV A;  4LF5 C;  2UXB C;  1JOS A;  4PRO C;  4X66 C;  4DCU A;  4KTT A;  3GPC A;  4JI5 C;  1ULT A;  5T8T A;  4YY3 C;  1GPM A;  5BUQ A;  3NYR A;  1XNQ C;  3AF6 A;  2JMP A;  1PG4 A;  5KYV A;  5A1I A;  1P7L A;  5BSR A;  2XR1 A;  2CY1 A;  2E8C A;  3GKU A;  3B7W A;  4L2Z A;  3N2Q A;  2UUA C;  4YHH C;  5AE2 A;  2E8F A;  4KHP C;  2ZM6 C;  4JV5 C;  1XMQ C;  3T1H C;  1RY2 A;  2VQF C;  2UXD C;  2WP0 C;  3A4I A;  4LF7 C;  4GXR A;  3R44 A;  1WF3 A;  4IR7 A;  4BCA A;  2D7V A;  1XRC A;  4DR7 C;  2ASB A;  1V25 A;  3RV2 A;  4D4I A;  4OX9 C;  3T1Y C;  4LFA C;  1MDF A;  3CJE A;  5CZX A;  1N33 C;  1FUG A;  1BA3 A;  1FJG C;  3NPD A;  4X62 C;  2YWB A;  2OPL B;  3H2T A;  4NOZ A;  2DPL A;  2EGT A;  2P2F A;  3VNR A;  4JI2 C;  5BSV A;  1PG3 A;  4FUT A;  5IT9 D;  1USP B;  5BR8 C;  3A9U A;  4TPS B;  1PA4 A;  1N36 C;  1LCI A;  4PZP A;  3E7X A;  1AMU A;  4BC9 A;  3VNS A;  4DV1 C;  3J81 D;  5K85 A;  2P2Q A;  4D57 A;  2E7G A;  3LNV A;  1ZB8 A;  5E7Q A;  3ETO A;  4R0M A;  4JI7 C;  1KKG A;  1MD9 A;  4OXI A;  2BJO A;  3LUS A;  4X64 C;  4LF9 C;  2HHH C;  5K8F A;  4DR6 C;  4D56 A;  4JI3 C;  1K0R A;  2AYA A;  3FCE A;  2D1S A;  1ML8 A;  1HNZ C;  4B3M C;  4DCT A;  2QVY X;  4U5Y D;  4DR3 C;  5BST A;  3GR1 A;  4DCV A;  5GTD A;  1XRB A;  4LF8 C;  2ATW A;  2D1Q A;  2PRO A;  3I08 A;  4R1L A;  5A1G A;  4HPV A;  4DV2 C;  3NI2 A;  3RG2 A;  4KTV A;  1O93 A;  2QVZ X;  3EER A;  2DYJ A;  4DUZ C;  4D4G A;  2QL8 A;  2P20 A;  2VZE A;  4G37 A;  4JYA C;  1YJ7 A;  4RLQ A;  3PRO C;  1QWI A;  1J5E C;  1MXC A;  4NXN C;  4BBY A;  2OPL A;  4RLF A;  5KYT A;  2UXC C;  4OYC A;  2P2M A;  1O9T A;  5KEI A;  3IML A;  4B3T C;  1USP A;  4ZJZ A;  3E7W A;  3AF5 A;  3A9V A;  5A2Q D;  1XNR C;  2OBV A;  3DHV A;  4JI8 C;  3J80 D;  1T5D X;  1N34 C;  3LAX A;  4RVN A;  5BUR A;  4RM3 A;  4K0K C;  3TDE A;  3DAY A;  3DLP X;  2D28 C;  4NXM C;  2E8E A;  3L95 X;  4L4Q A;  5DV9 A;  3JAM D;  4ISB A;  4GXQ A;  4X65 C;  3UZ0 A;  5BSU A;  2VQE C;  2P2B A;  3IPL A;  4PHT A;  3UOW A;  3R9W A;  3PES A;  2P2J A;  4XX2 A;  5H9U A;  3L8C A;  3N54 B;  3TUF A;  4MH4 A;  4DR1 C;  3TQI A;  5BUS A;  1MXA A;  1T5H X;  4DR5 C;  3ETC A;  3PBK A;  3C5E A;  3FCC A;  2QVX X;  3OTO C;  4DCS A;  3IEU A;  4BSZ A;  2VSQ A;  3SO4 A;  2QW0 X;  4DV7 C;  5AE1 A;  2P02 A;  2F4V C;  5BSW A;  4DR2 C;  4DV0 C;  2YCB A;  4FTF A;  2YWC A;  3LGX A;  4BC7 A;  4I9G A;  4ODJ A;  5ADZ A;  1O92 A;  4DV5 C;  4LFC C;  2D1R A;  4WS9 A;  1MXB A;  1VLA A;  4GKK C;  4K0B A;  4WV3 A;  4B3S C;  4DG9 A;  4NDN A;  1XMO C;  1N32 C;  5BSM A;  2KZF A;  4JI6 C;  3G7S A;  1IBL C;  2OO4 A;  3EQ6 A;  3NYQ A;  3R9X A;  1L2F A;  4AQY C;  4GKJ C;  4DR4 C;  4LF4 C;  3CW9 A;  5LMU C;  1WH9 A;  4I9F A;  3KXW A;  3VNQ A;  2ONF A;  4DUY C;  1EGA A;  2CXC A;  1RG9 A;  2PN2 A;  4B3R C;  3S82 A;  4RMN A;  1HNW C;  5FLX D;  4DV3 C;  4JI0 C;  2UUC C;  3I07 A;  2E5L C;  4G1I A;  1IBM C;  1I94 C;  4FUQ A;  5CZV A;  1O90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...