3I08A

Crystal structure of the s1-cleaved notch1 negative regulatory region (nrr)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
ACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Effects of S1 cleavage on the structure, surface export, and signaling activity of human Notch1 and Notch2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neurogenic locus notch homolog protein 1
total genus 42
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A01
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A02
3I08A
chains in the Genus database with same CATH superfamily
4HPVA 3S82A 1RY2A 4B3SC 1MDFA 4DR1C 4G36A 1FUGA 1HNWC 2OPLB 5IT9D 2QL8A 2D1TA 1FJGC 2KDNA 4RM2A 4GKKC 5A1GA 3DAYA 4JI1C 4FUQA 5A2QD 3J80D 1PG4A 1HH2P 2QVXX 1IBKC 3LUSA 4FTFA 4DG8A 3I07A 2XR1A 4YHHC 4I9GA 5LMNC 4ODJA 2CXCA 3ETOA 1PA4A 2PROA 5E7QA 4D4GA 4NXNC 5GTDA 5KEIA 1GPMA 1UKKA 4EATA 4DV7C 4DR3C 3R9WA 3R44A 1P4EA 4YY3C 2BH1X 5BSVA 4DR6C 3UX2A 1XMOC 2E0GA 3PBKA 2MM9A 5BUSA 4DV6C 2YCBA 3CQ2A 4GXQA 2E8FA 2E8EA 4BC7A 2MCQA 1EGAA 2ONFA 3DLPX 3K6RA 4RM3A 4RVNA 2DPLA 4K0KC 4PUHA 3C5EA 3IPLA 1XNRC 4OYCA 1XHJA 5IWAC 5DV9A 1IBLC 4JI7C 2PT7G 3CQ3A 3RV2A 5BSTA 4DUZC 1LQLA 2YWBA 5BSUA 4DCUA 2AYAA 5A1IA 3IEVA 5LMUC 1ZB9A 2DYJA 2OPLA 4B3RC 2KZFA 5FLXD 4OXIA 1T5HX 5AE3A 1L2FA 4RMNA 3A9VA 3TUFA 4LE5A 1NYEA 2P2BA 5BSMA 4DV2C 1M6XC 4TPSB 3GR0A 1PU1A 2Y4NA 2M5HA 1N36C 3VNRA 4DR4C 3VNQA 3GR1A 4MH4A 4DV4C 2KZ0A 2UXCC 4DCVA 1VEHA 1KKGA 2PN2A 2ASBA 4X65C 4PUIA 4B3TC 1P7LA 4WS9A 1XMQC 1WCJA 1V60A 4JI3C 2OBVA 4LFAC 2UUAC 4JYAC 2WP0C 4NXMC 4X66C 4JI6C 1P4EC 4MTNA 4NOZA 1JOSA 3UZ0A 3AY0A 4PUGA 1USPA 1ZB8A 1BA3A 2JMPA 1M6XA 2UUCC 3J81D 2QW0X 4R1MA 1NY8A 4LF6C 4ISBA 2ZZMA 1XNQC 3TDEA 3LNVA 3AF5A 3ETCA 4DCTA 1MD9A 2P2FA 3T1YC 1XS3A 1VLAA 3NYRA 2M5OA 4JI4C 3CJEA 1XRBA 4XX2A 1QWIA 4WV3A 4JV5C 4U5YD 2D1SA 4DG9A 2CY1A 2CU6A 4D57A 3PROC 5JRHA 2BJOA 4L2ZA 2HHHC 2D1RA 2HJGA 1HR0C 4DV5C 4RLFA 1QM4A 4NDNA 2UXDC 3NYQA 4LF9C 1WH9A 4R1LA 2MMAB 4ZLPA 4X64C 5K85A 2F4VC 3IEUA 3UOWA 4ZJZA 1O92A 4DCSA 3AF6A 1T5DX 2P2QA 4LFBC 3UX3A 4BCAA 2WD9A 3NI2A 1O90A 2ATWA 3O2EA 2Y27A 4JI0C 1O93A 4BSZA 1MXAA 3E7WA 3TR3A 2NCLA 1ULTA 4LF7C 3A26A 1WF3A 3CW8X 3T1HC 5CZVA 3LNOA 1FLOA 2EGTA 4DR7C 5AE2A 2QVZX 2Y4OA 4FUTA 5A19A 2VQEC 1HNZC 2VQFC 3L8CA 3TQIA 4RLQA 2P2JA 4D4IA 4B3MC 4JI8C 4BC9A 1MXCA 3EQ6A 3UEBA 2P02A 5KYVA 1YJ7A 2D1QA 4DV3C 3LGXA 3KXWA 1O9TA 1IB8A 2YX1A 2Z51A 5BSWA 4DV1C 4I9FA 3E7XA 3R9XA 4GXRA 3B7WA 4BBYA 4K0BA 4LF5C 3VNSA 4RVOA 3DHVA 3I08A 3N2QA 4LF4C 3A9UA 5K8FA 5CZXA 3IMLA 2D27A 4D56A 4GS5A 4KTTA 4LFCC 3JAMD 3GPCA 1MDBA 4R0MA 2P20A 3GKUA 5IFIA 3SO4A 1J5EC 1ML8A 3A4IA 2ZZNA 2QVYX 4PZPA 1MKYA 4L4QA 4JI5C 1K0RA 2D28C 1V26A 5T8SA 2UU9C 2VZEA 3FCEA 4IR7A 1UWDA 3EERA 4PROC 1RG9A 4JI2C 3H2TA 1N32C 1I94C 1IBMC 2UXBC 2E7GA 5BURA 4DR2C 4DUYC 2JNVA 1USPB 1LCIA 5BUQA 3CQ1A 2D7VA 4X62C 2E8CA 1N2FA 3A25A 3LAXA 1N33C 5LCIA 1AMUA 2YWCA 4G1IA 5ADZA 1MXBA 5AE1A 5H9UA 1XRCA 4LF8C 3CW9A 4KTVA 2UUBC 1TH5A 2P2MA 2V7BA 4PHTA 1V25A 1XRAA 3G7SA 2VSQA 1HNXC 3RG2A 4IZ6A 4OX9C 5BR8C 5T8TA 2E5LC 4DV0C 3OTOC 3L95X 2ZM6C 1N34C 2DHMA 3NPDA 3FCCA 3PESA 4L7IA 4JM1A 4KHPC 5BSRA 5KYTA 4GKJC 4DR5C 4G37A 4AQYC 2OO4A 1PG3A 3N54B
chains in the Genus database with same CATH topology
4HPVA 3S82A 1RY2A 4B3SC 1MDFA 4DR1C 4G36A 1FUGA 1HNWC 2OPLB 5IT9D 2QL8A 2D1TA 1FJGC 4RM2A 4GKKC 5A1GA 3DAYA 4JI1C 4FUQA 5A2QD 3J80D 1PG4A 1HH2P 2QVXX 1IBKC 3LUSA 4FTFA 4DG8A 3I07A 2XR1A 4YHHC 4I9GA 5LMNC 4ODJA 2CXCA 3ETOA 1PA4A 2PROA 5E7QA 4D4GA 4NXNC 5GTDA 5KEIA 1GPMA 1UKKA 4EATA 4DV7C 4DR3C 3R9WA 3R44A 4YY3C 2BH1X 5BSVA 4DR6C 1XMOC 2E0GA 3PBKA 5BUSA 4DV6C 2YCBA 4GXQA 2E8FA 2E8EA 4BC7A 1EGAA 2ONFA 3DLPX 4RM3A 4RVNA 2DPLA 4K0KC 3C5EA 3IPLA 1XNRC 4OYCA 5IWAC 5DV9A 1IBLC 4JI7C 2PT7G 3RV2A 5BSTA 4DUZC 1LQLA 2YWBA 5BSUA 4DCUA 2AYAA 5A1IA 3IEVA 5LMUC 1ZB9A 2DYJA 2OPLA 4B3RC 2KZFA 5FLXD 4OXIA 1T5HX 5AE3A 1L2FA 4RMNA 3A9VA 3TUFA 4LE5A 1NYEA 2P2BA 5BSMA 4DV2C 4TPSB 3GR0A 2Y4NA 1N36C 3VNRA 4DR4C 3VNQA 3GR1A 4MH4A 4DV4C 2UXCC 4DCVA 1KKGA 2PN2A 2ASBA 4X65C 4B3TC 1P7LA 4WS9A 1XMQC 4JI3C 2OBVA 4LFAC 2UUAC 4JYAC 2WP0C 4NXMC 4X66C 4JI6C 4MTNA 4NOZA 1JOSA 3UZ0A 1USPA 1ZB8A 1BA3A 2JMPA 2UUCC 3J81D 2QW0X 4R1MA 4LF6C 4ISBA 1XNQC 3TDEA 3LNVA 3AF5A 3ETCA 4DCTA 1MD9A 2P2FA 3T1YC 1VLAA 3NYRA 4JI4C 3CJEA 1XRBA 4XX2A 1QWIA 4WV3A 4JV5C 4U5YD 2D1SA 4DG9A 2CY1A 4D57A 3PROC 5JRHA 2BJOA 4L2ZA 2HHHC 2D1RA 2HJGA 1HR0C 4DV5C 4RLFA 1QM4A 4NDNA 2UXDC 3NYQA 4LF9C 1WH9A 4R1LA 4ZLPA 4X64C 5K85A 2F4VC 3IEUA 3UOWA 4ZJZA 1O92A 4DCSA 3AF6A 1T5DX 2P2QA 4LFBC 4BCAA 2WD9A 3NI2A 1O90A 2ATWA 2Y27A 4JI0C 1O93A 4BSZA 1MXAA 3E7WA 4LF7C 1ULTA 1WF3A 3CW8X 3T1HC 5CZVA 2EGTA 4DR7C 5AE2A 2QVZX 2Y4OA 4FUTA 5A19A 2VQEC 1HNZC 2VQFC 3L8CA 3TQIA 4RLQA 2P2JA 4D4IA 4B3MC 4JI8C 4BC9A 1MXCA 3EQ6A 2P02A 5KYVA 1YJ7A 2D1QA 4DV3C 3LGXA 3KXWA 1O9TA 5BSWA 4DV1C 4I9FA 3E7XA 3R9XA 4GXRA 3B7WA 4BBYA 4K0BA 4LF5C 3VNSA 4RVOA 3DHVA 3I08A 3N2QA 4LF4C 3A9UA 5K8FA 5CZXA 3IMLA 2D27A 4D56A 4GS5A 4KTTA 4LFCC 3JAMD 3GPCA 1MDBA 4R0MA 2P20A 3GKUA 5IFIA 3SO4A 1J5EC 1ML8A 3A4IA 2QVYX 4PZPA 1MKYA 4L4QA 4JI5C 1K0RA 2D28C 1V26A 5T8SA 2UU9C 2VZEA 3FCEA 4IR7A 3EERA 4PROC 1RG9A 4JI2C 3H2TA 1N32C 1I94C 1IBMC 2UXBC 2E7GA 5BURA 4DR2C 4DUYC 1USPB 1LCIA 5BUQA 2D7VA 4X62C 2E8CA 1N2FA 3LAXA 1N33C 1AMUA 2YWCA 4G1IA 5ADZA 1MXBA 5AE1A 5H9UA 1XRCA 4LF8C 3CW9A 4KTVA 2UUBC 2P2MA 2V7BA 4PHTA 1V25A 1XRAA 3G7SA 2VSQA 1HNXC 3RG2A 4IZ6A 4OX9C 5BR8C 5T8TA 2E5LC 4DV0C 3OTOC 3L95X 2ZM6C 1N34C 3NPDA 3FCCA 3PESA 4L7IA 4JM1A 4KHPC 5BSRA 5KYTA 4GKJC 4DR5C 4G37A 4AQYC 2OO4A 1PG3A 3N54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I08 A; 
#chains in the Genus database with same CATH topology
 4HPV A;  3S82 A;  1RY2 A;  4B3S C;  1MDF A;  4DR1 C;  4G36 A;  1FUG A;  1HNW C;  2OPL B;  5IT9 D;  2QL8 A;  2D1T A;  1FJG C;  2KDN A;  4RM2 A;  4GKK C;  5A1G A;  3DAY A;  4JI1 C;  4FUQ A;  5A2Q D;  3J80 D;  1PG4 A;  1HH2 P;  2QVX X;  1IBK C;  3LUS A;  4FTF A;  4DG8 A;  3I07 A;  2XR1 A;  4YHH C;  4I9G A;  5LMN C;  4ODJ A;  2CXC A;  3ETO A;  1PA4 A;  2PRO A;  5E7Q A;  4D4G A;  4NXN C;  5GTD A;  5KEI A;  1GPM A;  1UKK A;  4EAT A;  4DV7 C;  4DR3 C;  3R9W A;  3R44 A;  1P4E A;  4YY3 C;  2BH1 X;  5BSV A;  4DR6 C;  3UX2 A;  1XMO C;  2E0G A;  3PBK A;  2MM9 A;  5BUS A;  4DV6 C;  2YCB A;  3CQ2 A;  4GXQ A;  2E8F A;  2E8E A;  4BC7 A;  2MCQ A;  1EGA A;  2ONF A;  3DLP X;  3K6R A;  4RM3 A;  4RVN A;  2DPL A;  4K0K C;  4PUH A;  3C5E A;  3IPL A;  1XNR C;  4OYC A;  1XHJ A;  5IWA C;  5DV9 A;  1IBL C;  4JI7 C;  2PT7 G;  3CQ3 A;  3RV2 A;  5BST A;  4DUZ C;  1LQL A;  2YWB A;  5BSU A;  4DCU A;  2AYA A;  5A1I A;  3IEV A;  5LMU C;  1ZB9 A;  2DYJ A;  2OPL A;  4B3R C;  2KZF A;  5FLX D;  4OXI A;  1T5H X;  5AE3 A;  1L2F A;  4RMN A;  3A9V A;  3TUF A;  4LE5 A;  1NYE A;  2P2B A;  5BSM A;  4DV2 C;  1M6X C;  4TPS B;  3GR0 A;  1PU1 A;  2Y4N A;  2M5H A;  1N36 C;  3VNR A;  4DR4 C;  3VNQ A;  3GR1 A;  4MH4 A;  4DV4 C;  2KZ0 A;  2UXC C;  4DCV A;  1VEH A;  1KKG A;  2PN2 A;  2ASB A;  4X65 C;  4PUI A;  4B3T C;  1P7L A;  4WS9 A;  1XMQ C;  1WCJ A;  1V60 A;  4JI3 C;  2OBV A;  4LFA C;  2UUA C;  4JYA C;  2WP0 C;  4NXM C;  4X66 C;  4JI6 C;  1P4E C;  4MTN A;  4NOZ A;  1JOS A;  3UZ0 A;  3AY0 A;  4PUG A;  1USP A;  1ZB8 A;  1BA3 A;  2JMP A;  1M6X A;  2UUC C;  3J81 D;  2QW0 X;  4R1M A;  1NY8 A;  4LF6 C;  4ISB A;  2ZZM A;  1XNQ C;  3TDE A;  3LNV A;  3AF5 A;  3ETC A;  4DCT A;  1MD9 A;  2P2F A;  3T1Y C;  1XS3 A;  1VLA A;  3NYR A;  2M5O A;  4JI4 C;  3CJE A;  1XRB A;  4XX2 A;  1QWI A;  4WV3 A;  4JV5 C;  4U5Y D;  2D1S A;  4DG9 A;  2CY1 A;  2CU6 A;  4D57 A;  3PRO C;  5JRH A;  2BJO A;  4L2Z A;  2HHH C;  2D1R A;  2HJG A;  1HR0 C;  4DV5 C;  4RLF A;  1QM4 A;  4NDN A;  2UXD C;  3NYQ A;  4LF9 C;  1WH9 A;  4R1L A;  2MMA B;  4ZLP A;  4X64 C;  5K85 A;  2F4V C;  3IEU A;  3UOW A;  4ZJZ A;  1O92 A;  4DCS A;  3AF6 A;  1T5D X;  2P2Q A;  4LFB C;  3UX3 A;  4BCA A;  2WD9 A;  3NI2 A;  1O90 A;  2ATW A;  3O2E A;  2Y27 A;  4JI0 C;  1O93 A;  4BSZ A;  1MXA A;  3E7W A;  3TR3 A;  2NCL A;  1ULT A;  4LF7 C;  3A26 A;  1WF3 A;  3CW8 X;  3T1H C;  5CZV A;  3LNO A;  1FLO A;  2EGT A;  4DR7 C;  5AE2 A;  2QVZ X;  2Y4O A;  4FUT A;  5A19 A;  2VQE C;  1HNZ C;  2VQF C;  3L8C A;  3TQI A;  4RLQ A;  2P2J A;  4D4I A;  4B3M C;  4JI8 C;  4BC9 A;  1MXC A;  3EQ6 A;  3UEB A;  2P02 A;  5KYV A;  1YJ7 A;  2D1Q A;  4DV3 C;  3LGX A;  3KXW A;  1O9T A;  1IB8 A;  2YX1 A;  2Z51 A;  5BSW A;  4DV1 C;  4I9F A;  3E7X A;  3R9X A;  4GXR A;  3B7W A;  4BBY A;  4K0B A;  4LF5 C;  3VNS A;  4RVO A;  3DHV A;  3I08 A;  3N2Q A;  4LF4 C;  3A9U A;  5K8F A;  5CZX A;  3IML A;  2D27 A;  4D56 A;  4GS5 A;  4KTT A;  4LFC C;  3JAM D;  3GPC A;  1MDB A;  4R0M A;  2P20 A;  3GKU A;  5IFI A;  3SO4 A;  1J5E C;  1ML8 A;  3A4I A;  2ZZN A;  2QVY X;  4PZP A;  1MKY A;  4L4Q A;  4JI5 C;  1K0R A;  2D28 C;  1V26 A;  5T8S A;  2UU9 C;  2VZE A;  3FCE A;  4IR7 A;  1UWD A;  3EER A;  4PRO C;  1RG9 A;  4JI2 C;  3H2T A;  1N32 C;  1I94 C;  1IBM C;  2UXB C;  2E7G A;  5BUR A;  4DR2 C;  4DUY C;  2JNV A;  1USP B;  1LCI A;  5BUQ A;  3CQ1 A;  2D7V A;  4X62 C;  2E8C A;  1N2F A;  3A25 A;  3LAX A;  1N33 C;  5LCI A;  1AMU A;  2YWC A;  4G1I A;  5ADZ A;  1MXB A;  5AE1 A;  5H9U A;  1XRC A;  4LF8 C;  3CW9 A;  4KTV A;  2UUB C;  1TH5 A;  2P2M A;  2V7B A;  4PHT A;  1V25 A;  1XRA A;  3G7S A;  2VSQ A;  1HNX C;  3RG2 A;  4IZ6 A;  4OX9 C;  5BR8 C;  5T8T A;  2E5L C;  4DV0 C;  3OTO C;  3L95 X;  2ZM6 C;  1N34 C;  2DHM A;  3NPD A;  3FCC A;  3PES A;  4L7I A;  4JM1 A;  4KHP C;  5BSR A;  5KYT A;  4GKJ C;  4DR5 C;  4G37 A;  4AQY C;  2OO4 A;  1PG3 A;  3N54 B; 
#chains in the Genus database with same CATH homology
 4HPV A;  3S82 A;  1RY2 A;  4B3S C;  1MDF A;  4DR1 C;  4G36 A;  1FUG A;  1HNW C;  2OPL B;  5IT9 D;  2QL8 A;  2D1T A;  1FJG C;  4RM2 A;  4GKK C;  5A1G A;  3DAY A;  4JI1 C;  4FUQ A;  5A2Q D;  3J80 D;  1PG4 A;  1HH2 P;  2QVX X;  1IBK C;  3LUS A;  4FTF A;  4DG8 A;  3I07 A;  2XR1 A;  4YHH C;  4I9G A;  5LMN C;  4ODJ A;  2CXC A;  3ETO A;  1PA4 A;  2PRO A;  5E7Q A;  4D4G A;  4NXN C;  5GTD A;  5KEI A;  1GPM A;  1UKK A;  4EAT A;  4DV7 C;  4DR3 C;  3R9W A;  3R44 A;  4YY3 C;  2BH1 X;  5BSV A;  4DR6 C;  1XMO C;  2E0G A;  3PBK A;  5BUS A;  4DV6 C;  2YCB A;  4GXQ A;  2E8F A;  2E8E A;  4BC7 A;  1EGA A;  2ONF A;  3DLP X;  4RM3 A;  4RVN A;  2DPL A;  4K0K C;  3C5E A;  3IPL A;  1XNR C;  4OYC A;  5IWA C;  5DV9 A;  1IBL C;  4JI7 C;  2PT7 G;  3RV2 A;  5BST A;  4DUZ C;  1LQL A;  2YWB A;  5BSU A;  4DCU A;  2AYA A;  5A1I A;  3IEV A;  5LMU C;  1ZB9 A;  2DYJ A;  2OPL A;  4B3R C;  2KZF A;  5FLX D;  4OXI A;  1T5H X;  5AE3 A;  1L2F A;  4RMN A;  3A9V A;  3TUF A;  4LE5 A;  1NYE A;  2P2B A;  5BSM A;  4DV2 C;  4TPS B;  3GR0 A;  2Y4N A;  1N36 C;  3VNR A;  4DR4 C;  3VNQ A;  3GR1 A;  4MH4 A;  4DV4 C;  2UXC C;  4DCV A;  1KKG A;  2PN2 A;  2ASB A;  4X65 C;  4B3T C;  1P7L A;  4WS9 A;  1XMQ C;  4JI3 C;  2OBV A;  4LFA C;  2UUA C;  4JYA C;  2WP0 C;  4NXM C;  4X66 C;  4JI6 C;  4MTN A;  4NOZ A;  1JOS A;  3UZ0 A;  1USP A;  1ZB8 A;  1BA3 A;  2JMP A;  2UUC C;  3J81 D;  2QW0 X;  4R1M A;  4LF6 C;  4ISB A;  1XNQ C;  3TDE A;  3LNV A;  3AF5 A;  3ETC A;  4DCT A;  1MD9 A;  2P2F A;  3T1Y C;  1VLA A;  3NYR A;  4JI4 C;  3CJE A;  1XRB A;  4XX2 A;  1QWI A;  4WV3 A;  4JV5 C;  4U5Y D;  2D1S A;  4DG9 A;  2CY1 A;  4D57 A;  3PRO C;  5JRH A;  2BJO A;  4L2Z A;  2HHH C;  2D1R A;  2HJG A;  1HR0 C;  4DV5 C;  4RLF A;  1QM4 A;  4NDN A;  2UXD C;  3NYQ A;  4LF9 C;  1WH9 A;  4R1L A;  4ZLP A;  4X64 C;  5K85 A;  2F4V C;  3IEU A;  3UOW A;  4ZJZ A;  1O92 A;  4DCS A;  3AF6 A;  1T5D X;  2P2Q A;  4LFB C;  4BCA A;  2WD9 A;  3NI2 A;  1O90 A;  2ATW A;  2Y27 A;  4JI0 C;  1O93 A;  4BSZ A;  1MXA A;  3E7W A;  4LF7 C;  1ULT A;  1WF3 A;  3CW8 X;  3T1H C;  5CZV A;  2EGT A;  4DR7 C;  5AE2 A;  2QVZ X;  2Y4O A;  4FUT A;  5A19 A;  2VQE C;  1HNZ C;  2VQF C;  3L8C A;  3TQI A;  4RLQ A;  2P2J A;  4D4I A;  4B3M C;  4JI8 C;  4BC9 A;  1MXC A;  3EQ6 A;  2P02 A;  5KYV A;  1YJ7 A;  2D1Q A;  4DV3 C;  3LGX A;  3KXW A;  1O9T A;  5BSW A;  4DV1 C;  4I9F A;  3E7X A;  3R9X A;  4GXR A;  3B7W A;  4BBY A;  4K0B A;  4LF5 C;  3VNS A;  4RVO A;  3DHV A;  3I08 A;  3N2Q A;  4LF4 C;  3A9U A;  5K8F A;  5CZX A;  3IML A;  2D27 A;  4D56 A;  4GS5 A;  4KTT A;  4LFC C;  3JAM D;  3GPC A;  1MDB A;  4R0M A;  2P20 A;  3GKU A;  5IFI A;  3SO4 A;  1J5E C;  1ML8 A;  3A4I A;  2QVY X;  4PZP A;  1MKY A;  4L4Q A;  4JI5 C;  1K0R A;  2D28 C;  1V26 A;  5T8S A;  2UU9 C;  2VZE A;  3FCE A;  4IR7 A;  3EER A;  4PRO C;  1RG9 A;  4JI2 C;  3H2T A;  1N32 C;  1I94 C;  1IBM C;  2UXB C;  2E7G A;  5BUR A;  4DR2 C;  4DUY C;  1USP B;  1LCI A;  5BUQ A;  2D7V A;  4X62 C;  2E8C A;  1N2F A;  3LAX A;  1N33 C;  1AMU A;  2YWC A;  4G1I A;  5ADZ A;  1MXB A;  5AE1 A;  5H9U A;  1XRC A;  4LF8 C;  3CW9 A;  4KTV A;  2UUB C;  2P2M A;  2V7B A;  4PHT A;  1V25 A;  1XRA A;  3G7S A;  2VSQ A;  1HNX C;  3RG2 A;  4IZ6 A;  4OX9 C;  5BR8 C;  5T8T A;  2E5L C;  4DV0 C;  3OTO C;  3L95 X;  2ZM6 C;  1N34 C;  3NPD A;  3FCC A;  3PES A;  4L7I A;  4JM1 A;  4KHP C;  5BSR A;  5KYT A;  4GKJ C;  4DR5 C;  4G37 A;  4AQY C;  2OO4 A;  1PG3 A;  3N54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...