3I08A

Crystal structure of the s1-cleaved notch1 negative regulatory region (nrr)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
174
structure length
174
Chain Sequence
ACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neurogenic locus notch homolog protein 1
publication title Effects of S1 cleavage on the structure, surface export, and signaling activity of human Notch1 and Notch2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 42
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00066 Notch LNR domain
A PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A01
3.30.300.240 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3i08A02
3I08A
chains in the Genus database with same CATH superfamily
3TQIA 1LCIA 2P2MA 3EERA 4NXMC 3L95X 4DCSA 3FCCA 4JM1A 1J5EC 2XR1A 4JV5C 4XX2A 5BSMA 2P2BA 3B7WA 1EGAA 4NDNA 2P2FA 4DV7C 1WCJA 3CW8X 2P20A 1K0RA 4BSZA 5BSUA 2WP0C 4KTVA 4LF9C 4R0MA 5CZXA 4PUHA 3I07A 1IBKC 3TR3A 1N34C 4JI7C 4IZ6A 3EQ6A 4DUZC 4G37A 3DLPX 2VSQA 3GR0A 4WS9A 2E7GA 3S82A 2P2JA 1M6XA 2KDNA 4DV2C 2Y4OA 3IEUA 2CU6A 5H9UA 3CW9A 4JI1C 2F4VC 4RLQA 4DR1C 2M5OA 4B3MC 1XMOC 4NOZA 2QVXX 1N36C 4K0KC 3IPLA 1O93A 1M6XC 1N33C 2CXCA 4RVNA 1HNWC 4FTFA 1XRAA 4X64C 5BUQA 4L2ZA 1N32C 5BR8C 1ZB8A 4D57A 3L8CA 4JI0C 3A9UA 3CJEA 5BSRA 4GKJC 1XS3A 2QVYX 4BC7A 2P2QA 5IT9D 3NYRA 3C5EA 4PZPA 5BSWA 4KTTA 5KYTA 4X66C 3R44A 2MMAB 1USPA 1VEHA 4FUTA 1L2FA 4LF4C 2NCLA 2QW0X 1XMQC 2UXDC 3PROC 5T8TA 5K85A 1P4EA 2V7BA 5CZVA 3GPCA 3LUSA 5DV9A 1XNRC 4G36A 5AE2A 2D28C 4DR3C 3LNOA 1QWIA 5IWAC 5A19A 4PUGA 4X62C 4DG9A 4DV5C 4JI4C 5BURA 4PHTA 1ZB9A 5A1IA 1MD9A 4KHPC 1RY2A 4GKKC 1LQLA 3J80D 3N54B 4YY3C 2BH1X 5FLXD 1NYEA 4K0BA 5A1GA 4DR2C 4MH4A 3RV2A 3E7WA 3DAYA 4DV6C 2UUCC 5BSVA 4LF8C 2Y4NA 2HJGA 1JOSA 3CQ3A 5AE3A 5AE1A 4AQYC 3KXWA 4NXNC 1V26A 2BJOA 3A26A 1MXCA 2PROA 2MCQA 4DUYC 3K6RA 1XNQC 3NI2A 4RVOA 2P02A 1I94C 1XRBA 4D4GA 4LFAC 3JAMD 1N2FA 3UOWA 4GS5A 4JI3C 4PUIA 3T1YC 4R1MA 3LGXA 2WD9A 1MDFA 5T8SA 3NPDA 2UU9C 3O2EA 2UXBC 3PESA 3LNVA 4I9GA 4DR6C 4D56A 2DPLA 2OPLB 4BBYA 4ODJA 1IB8A 4B3SC 1HH2P 4DV4C 4LFCC 2ZZMA 3H2TA 1PG4A 3AF5A 2UUAC 4JI5C 2YWBA 2UUBC 4MTNA 4L4QA 1FUGA 1RG9A 2YCBA 4ZJZA 3PBKA 4DV0C 3VNSA 4U5YD 4LFBC 2D1QA 4IR7A 5IFIA 5E7QA 3AF6A 3IMLA 3SO4A 2KZFA 4TPSB 3A4IA 5BSTA 1O9TA 4L7IA 2AYAA 3AY0A 3ETCA 4GXRA 4LF5C 4YHHC 2M5HA 2HHHC 1AMUA 3GR1A 1P4EC 4PROC 1O92A 3TDEA 4RMNA 5BUSA 4D4IA 3UX2A 4JI8C 5ADZA 2JNVA 1BA3A 1UWDA 1GPMA 5A2QD 1MXAA 4LF7C 1T5HX 4DCTA 1HNXC 1FJGC 4JI6C 1P7LA 3GKUA 4G1IA 4WV3A 4OX9C 3T1HC 5LCIA 1YJ7A 3LAXA 4RLFA 2ONFA 2ZM6C 4DR4C 4B3RC 2Y27A 3TUFA 2E8FA 2VZEA 2Z51A 3UX3A 1PU1A 4DV3C 1TH5A 2D27A 3NYQA 5K8FA 1WH9A 3CQ2A 1ULTA 1NY8A 3RG2A 2VQFC 1KKGA 1WF3A 1MXBA 2CY1A 5KYVA 1IBLC 4RM3A 4OYCA 1FLOA 5KEIA 2D1RA 4DG8A 5GTDA 4DCVA 2EGTA 2OBVA 2KZ0A 1PG3A 2PT7G 4EATA 2OO4A 4DV1C 2UXCC 2YWCA 1MDBA 2DYJA 1XHJA 1V60A 1VLAA 1MKYA 3A25A 3VNRA 2D1TA 3A9VA 2D1SA 4GXQA 2ZZNA 2OPLA 2VQEC 3OTOC 3I08A 4FUQA 1XRCA 3UEBA 3FCEA 2JMPA 2QL8A 2E5LC 1T5DX 2PN2A 1O90A 2DHMA 3VNQA 4OXIA 5LMNC 3E7XA 2D7VA 4DR5C 4DR7C 3J81D 3N2QA 4LF6C 4DCUA 2E0GA 4BC9A 1UKKA 1USPB 1QM4A 3R9WA 4X65C 2QVZX 3CQ1A 2E8EA 3DHVA 2ASBA 3G7SA 2YX1A 1HNZC 4RM2A 2ATWA 4ZLPA 4I9FA 1HR0C 2MM9A 1V25A 4BCAA 5JRHA 3R9XA 4B3TC 5LMUC 4ISBA 2E8CA 4LE5A 3IEVA 1PA4A 3UZ0A 1IBMC 4R1LA 4JYAC 4JI2C 1ML8A 3ETOA 4HPVA
chains in the Genus database with same CATH topology
3TQIA 1LCIA 2P2MA 3EERA 4NXMC 3L95X 4DCSA 3FCCA 4JM1A 1J5EC 2XR1A 4JV5C 4XX2A 5BSMA 2P2BA 3B7WA 1EGAA 4NDNA 2P2FA 4DV7C 3CW8X 2P20A 1K0RA 4BSZA 5BSUA 2WP0C 4KTVA 4LF9C 4R0MA 5CZXA 3I07A 1IBKC 1N34C 4JI7C 4IZ6A 3EQ6A 4DUZC 4G37A 3DLPX 2VSQA 3GR0A 4WS9A 2E7GA 3S82A 2P2JA 4DV2C 2Y4OA 3IEUA 5H9UA 3CW9A 4JI1C 2F4VC 4RLQA 4DR1C 4B3MC 1XMOC 4NOZA 2QVXX 1N36C 4K0KC 3IPLA 1O93A 1N33C 2CXCA 4RVNA 1HNWC 4FTFA 1XRAA 4X64C 5BUQA 4L2ZA 1N32C 5BR8C 1ZB8A 4D57A 3L8CA 4JI0C 3A9UA 3CJEA 5BSRA 4GKJC 2QVYX 4BC7A 5IT9D 2P2QA 3NYRA 3C5EA 4PZPA 5BSWA 4KTTA 5KYTA 4X66C 3R44A 1USPA 4FUTA 1L2FA 4LF4C 2QW0X 1XMQC 2UXDC 3PROC 5T8TA 5K85A 2V7BA 5CZVA 3GPCA 3LUSA 5DV9A 1XNRC 4G36A 5AE2A 2D28C 4DR3C 1QWIA 5IWAC 5A19A 4X62C 4DG9A 4DV5C 4JI4C 5BURA 4PHTA 1ZB9A 5A1IA 1MD9A 4KHPC 1RY2A 4GKKC 1LQLA 3J80D 3N54B 4YY3C 2BH1X 5FLXD 1NYEA 4K0BA 5A1GA 4DR2C 4MH4A 3RV2A 3E7WA 3DAYA 4DV6C 2UUCC 5BSVA 4LF8C 2Y4NA 2HJGA 1JOSA 5AE3A 5AE1A 4AQYC 3KXWA 4NXNC 1V26A 2BJOA 1MXCA 2PROA 4DUYC 1XNQC 3NI2A 4RVOA 2P02A 1I94C 1XRBA 4D4GA 4LFAC 3JAMD 1N2FA 3UOWA 4GS5A 4JI3C 3T1YC 4R1MA 3LGXA 2WD9A 1MDFA 5T8SA 3NPDA 2UU9C 2UXBC 3PESA 3LNVA 4I9GA 4DR6C 4D56A 2DPLA 2OPLB 4BBYA 4ODJA 4B3SC 1HH2P 4DV4C 4LFCC 3H2TA 1PG4A 3AF5A 2UUAC 4JI5C 2YWBA 2UUBC 4MTNA 4L4QA 1FUGA 1RG9A 2YCBA 4ZJZA 3PBKA 4DV0C 3VNSA 4U5YD 4LFBC 2D1QA 4IR7A 5IFIA 5E7QA 3AF6A 3IMLA 3SO4A 2KZFA 4TPSB 3A4IA 5BSTA 1O9TA 4L7IA 2AYAA 3ETCA 4GXRA 4LF5C 4YHHC 2HHHC 1AMUA 3GR1A 4PROC 1O92A 3TDEA 4RMNA 5BUSA 4D4IA 4JI8C 5ADZA 1BA3A 1GPMA 5A2QD 1MXAA 4LF7C 1T5HX 4DCTA 1HNXC 1FJGC 4JI6C 1P7LA 3GKUA 4G1IA 4WV3A 4OX9C 3T1HC 1YJ7A 3LAXA 4RLFA 2ONFA 2ZM6C 4DR4C 4B3RC 2Y27A 3TUFA 2E8FA 2VZEA 4DV3C 2D27A 3NYQA 5K8FA 1WH9A 1ULTA 3RG2A 2VQFC 1KKGA 1WF3A 1MXBA 2CY1A 5KYVA 1IBLC 4RM3A 4OYCA 5KEIA 2D1RA 4DG8A 5GTDA 4DCVA 2EGTA 2OBVA 2PT7G 1PG3A 4EATA 2OO4A 4DV1C 2UXCC 2YWCA 1MDBA 2DYJA 1VLAA 1MKYA 3VNRA 2D1TA 3A9VA 2D1SA 4GXQA 2OPLA 2VQEC 3OTOC 3I08A 4FUQA 1XRCA 3FCEA 2JMPA 2QL8A 2E5LC 1T5DX 2PN2A 1O90A 3VNQA 4OXIA 5LMNC 3E7XA 2D7VA 4DR5C 4DR7C 3J81D 3N2QA 4LF6C 4DCUA 2E0GA 4BC9A 1UKKA 1USPB 1QM4A 3R9WA 4X65C 2QVZX 2E8EA 3DHVA 2ASBA 3G7SA 1HNZC 4RM2A 2ATWA 4ZLPA 4I9FA 1HR0C 1V25A 4BCAA 5JRHA 3R9XA 4B3TC 5LMUC 4ISBA 2E8CA 4LE5A 3IEVA 1PA4A 3UZ0A 1IBMC 4R1LA 4JYAC 4JI2C 1ML8A 3ETOA 4HPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I08 A; 
#chains in the Genus database with same CATH topology
 3TQI A;  1LCI A;  2P2M A;  3EER A;  4NXM C;  3L95 X;  4DCS A;  3FCC A;  4JM1 A;  1J5E C;  2XR1 A;  4JV5 C;  4XX2 A;  5BSM A;  2P2B A;  3B7W A;  1EGA A;  4NDN A;  2P2F A;  4DV7 C;  1WCJ A;  3CW8 X;  2P20 A;  1K0R A;  4BSZ A;  5BSU A;  2WP0 C;  4KTV A;  4LF9 C;  4R0M A;  5CZX A;  4PUH A;  3I07 A;  1IBK C;  3TR3 A;  1N34 C;  4JI7 C;  4IZ6 A;  3EQ6 A;  4DUZ C;  4G37 A;  3DLP X;  2VSQ A;  3GR0 A;  4WS9 A;  2E7G A;  3S82 A;  2P2J A;  1M6X A;  2KDN A;  4DV2 C;  2Y4O A;  3IEU A;  2CU6 A;  5H9U A;  3CW9 A;  4JI1 C;  2F4V C;  4RLQ A;  4DR1 C;  2M5O A;  4B3M C;  1XMO C;  4NOZ A;  2QVX X;  1N36 C;  4K0K C;  3IPL A;  1O93 A;  1M6X C;  1N33 C;  2CXC A;  4RVN A;  1HNW C;  4FTF A;  1XRA A;  4X64 C;  5BUQ A;  4L2Z A;  1N32 C;  5BR8 C;  1ZB8 A;  4D57 A;  3L8C A;  4JI0 C;  3A9U A;  3CJE A;  5BSR A;  4GKJ C;  1XS3 A;  2QVY X;  4BC7 A;  2P2Q A;  5IT9 D;  3NYR A;  3C5E A;  4PZP A;  5BSW A;  4KTT A;  5KYT A;  4X66 C;  3R44 A;  2MMA B;  1USP A;  1VEH A;  4FUT A;  1L2F A;  4LF4 C;  2NCL A;  2QW0 X;  1XMQ C;  2UXD C;  3PRO C;  5T8T A;  5K85 A;  1P4E A;  2V7B A;  5CZV A;  3GPC A;  3LUS A;  5DV9 A;  1XNR C;  4G36 A;  5AE2 A;  2D28 C;  4DR3 C;  3LNO A;  1QWI A;  5IWA C;  5A19 A;  4PUG A;  4X62 C;  4DG9 A;  4DV5 C;  4JI4 C;  5BUR A;  4PHT A;  1ZB9 A;  5A1I A;  1MD9 A;  4KHP C;  1RY2 A;  4GKK C;  1LQL A;  3J80 D;  3N54 B;  4YY3 C;  2BH1 X;  5FLX D;  1NYE A;  4K0B A;  5A1G A;  4DR2 C;  4MH4 A;  3RV2 A;  3E7W A;  3DAY A;  4DV6 C;  2UUC C;  5BSV A;  4LF8 C;  2Y4N A;  2HJG A;  1JOS A;  3CQ3 A;  5AE3 A;  5AE1 A;  4AQY C;  3KXW A;  4NXN C;  1V26 A;  2BJO A;  3A26 A;  1MXC A;  2PRO A;  2MCQ A;  4DUY C;  3K6R A;  1XNQ C;  3NI2 A;  4RVO A;  2P02 A;  1I94 C;  1XRB A;  4D4G A;  4LFA C;  3JAM D;  1N2F A;  3UOW A;  4GS5 A;  4JI3 C;  4PUI A;  3T1Y C;  4R1M A;  3LGX A;  2WD9 A;  1MDF A;  5T8S A;  3NPD A;  2UU9 C;  3O2E A;  2UXB C;  3PES A;  3LNV A;  4I9G A;  4DR6 C;  4D56 A;  2DPL A;  2OPL B;  4BBY A;  4ODJ A;  1IB8 A;  4B3S C;  1HH2 P;  4DV4 C;  4LFC C;  2ZZM A;  3H2T A;  1PG4 A;  3AF5 A;  2UUA C;  4JI5 C;  2YWB A;  2UUB C;  4MTN A;  4L4Q A;  1FUG A;  1RG9 A;  2YCB A;  4ZJZ A;  3PBK A;  4DV0 C;  3VNS A;  4U5Y D;  4LFB C;  2D1Q A;  4IR7 A;  5IFI A;  5E7Q A;  3AF6 A;  3IML A;  3SO4 A;  2KZF A;  4TPS B;  3A4I A;  5BST A;  1O9T A;  4L7I A;  2AYA A;  3AY0 A;  3ETC A;  4GXR A;  4LF5 C;  4YHH C;  2M5H A;  2HHH C;  1AMU A;  3GR1 A;  1P4E C;  4PRO C;  1O92 A;  3TDE A;  4RMN A;  5BUS A;  4D4I A;  3UX2 A;  4JI8 C;  5ADZ A;  2JNV A;  1BA3 A;  1UWD A;  1GPM A;  5A2Q D;  1MXA A;  4LF7 C;  1T5H X;  4DCT A;  1HNX C;  1FJG C;  4JI6 C;  1P7L A;  3GKU A;  4G1I A;  4WV3 A;  4OX9 C;  3T1H C;  5LCI A;  1YJ7 A;  3LAX A;  4RLF A;  2ONF A;  2ZM6 C;  4DR4 C;  4B3R C;  2Y27 A;  3TUF A;  2E8F A;  2VZE A;  2Z51 A;  3UX3 A;  1PU1 A;  4DV3 C;  1TH5 A;  2D27 A;  3NYQ A;  5K8F A;  1WH9 A;  3CQ2 A;  1ULT A;  1NY8 A;  3RG2 A;  2VQF C;  1KKG A;  1WF3 A;  1MXB A;  2CY1 A;  5KYV A;  1IBL C;  4RM3 A;  4OYC A;  1FLO A;  5KEI A;  2D1R A;  4DG8 A;  5GTD A;  4DCV A;  2EGT A;  2OBV A;  2KZ0 A;  1PG3 A;  2PT7 G;  4EAT A;  2OO4 A;  4DV1 C;  2UXC C;  2YWC A;  1MDB A;  2DYJ A;  1XHJ A;  1V60 A;  1VLA A;  1MKY A;  3A25 A;  3VNR A;  2D1T A;  3A9V A;  2D1S A;  4GXQ A;  2ZZN A;  2OPL A;  2VQE C;  3OTO C;  3I08 A;  4FUQ A;  1XRC A;  3UEB A;  3FCE A;  2JMP A;  2QL8 A;  2E5L C;  1T5D X;  2PN2 A;  1O90 A;  2DHM A;  3VNQ A;  4OXI A;  5LMN C;  3E7X A;  2D7V A;  4DR5 C;  4DR7 C;  3J81 D;  3N2Q A;  4LF6 C;  4DCU A;  2E0G A;  4BC9 A;  1UKK A;  1USP B;  1QM4 A;  3R9W A;  4X65 C;  2QVZ X;  3CQ1 A;  2E8E A;  3DHV A;  2ASB A;  3G7S A;  2YX1 A;  1HNZ C;  4RM2 A;  2ATW A;  4ZLP A;  4I9F A;  1HR0 C;  2MM9 A;  1V25 A;  4BCA A;  5JRH A;  3R9X A;  4B3T C;  5LMU C;  4ISB A;  2E8C A;  4LE5 A;  3IEV A;  1PA4 A;  3UZ0 A;  1IBM C;  4R1L A;  4JYA C;  4JI2 C;  1ML8 A;  3ETO A;  4HPV A; 
#chains in the Genus database with same CATH homology
 3TQI A;  1LCI A;  2P2M A;  3EER A;  4NXM C;  3L95 X;  4DCS A;  3FCC A;  4JM1 A;  1J5E C;  2XR1 A;  4JV5 C;  4XX2 A;  5BSM A;  2P2B A;  3B7W A;  1EGA A;  4NDN A;  2P2F A;  4DV7 C;  3CW8 X;  2P20 A;  1K0R A;  4BSZ A;  5BSU A;  2WP0 C;  4KTV A;  4LF9 C;  4R0M A;  5CZX A;  3I07 A;  1IBK C;  1N34 C;  4JI7 C;  4IZ6 A;  3EQ6 A;  4DUZ C;  4G37 A;  3DLP X;  2VSQ A;  3GR0 A;  4WS9 A;  2E7G A;  3S82 A;  2P2J A;  4DV2 C;  2Y4O A;  3IEU A;  5H9U A;  3CW9 A;  4JI1 C;  2F4V C;  4RLQ A;  4DR1 C;  4B3M C;  1XMO C;  4NOZ A;  2QVX X;  1N36 C;  4K0K C;  3IPL A;  1O93 A;  1N33 C;  2CXC A;  4RVN A;  1HNW C;  4FTF A;  1XRA A;  4X64 C;  5BUQ A;  4L2Z A;  1N32 C;  5BR8 C;  1ZB8 A;  4D57 A;  3L8C A;  4JI0 C;  3A9U A;  3CJE A;  5BSR A;  4GKJ C;  2QVY X;  4BC7 A;  5IT9 D;  2P2Q A;  3NYR A;  3C5E A;  4PZP A;  5BSW A;  4KTT A;  5KYT A;  4X66 C;  3R44 A;  1USP A;  4FUT A;  1L2F A;  4LF4 C;  2QW0 X;  1XMQ C;  2UXD C;  3PRO C;  5T8T A;  5K85 A;  2V7B A;  5CZV A;  3GPC A;  3LUS A;  5DV9 A;  1XNR C;  4G36 A;  5AE2 A;  2D28 C;  4DR3 C;  1QWI A;  5IWA C;  5A19 A;  4X62 C;  4DG9 A;  4DV5 C;  4JI4 C;  5BUR A;  4PHT A;  1ZB9 A;  5A1I A;  1MD9 A;  4KHP C;  1RY2 A;  4GKK C;  1LQL A;  3J80 D;  3N54 B;  4YY3 C;  2BH1 X;  5FLX D;  1NYE A;  4K0B A;  5A1G A;  4DR2 C;  4MH4 A;  3RV2 A;  3E7W A;  3DAY A;  4DV6 C;  2UUC C;  5BSV A;  4LF8 C;  2Y4N A;  2HJG A;  1JOS A;  5AE3 A;  5AE1 A;  4AQY C;  3KXW A;  4NXN C;  1V26 A;  2BJO A;  1MXC A;  2PRO A;  4DUY C;  1XNQ C;  3NI2 A;  4RVO A;  2P02 A;  1I94 C;  1XRB A;  4D4G A;  4LFA C;  3JAM D;  1N2F A;  3UOW A;  4GS5 A;  4JI3 C;  3T1Y C;  4R1M A;  3LGX A;  2WD9 A;  1MDF A;  5T8S A;  3NPD A;  2UU9 C;  2UXB C;  3PES A;  3LNV A;  4I9G A;  4DR6 C;  4D56 A;  2DPL A;  2OPL B;  4BBY A;  4ODJ A;  4B3S C;  1HH2 P;  4DV4 C;  4LFC C;  3H2T A;  1PG4 A;  3AF5 A;  2UUA C;  4JI5 C;  2YWB A;  2UUB C;  4MTN A;  4L4Q A;  1FUG A;  1RG9 A;  2YCB A;  4ZJZ A;  3PBK A;  4DV0 C;  3VNS A;  4U5Y D;  4LFB C;  2D1Q A;  4IR7 A;  5IFI A;  5E7Q A;  3AF6 A;  3IML A;  3SO4 A;  2KZF A;  4TPS B;  3A4I A;  5BST A;  1O9T A;  4L7I A;  2AYA A;  3ETC A;  4GXR A;  4LF5 C;  4YHH C;  2HHH C;  1AMU A;  3GR1 A;  4PRO C;  1O92 A;  3TDE A;  4RMN A;  5BUS A;  4D4I A;  4JI8 C;  5ADZ A;  1BA3 A;  1GPM A;  5A2Q D;  1MXA A;  4LF7 C;  1T5H X;  4DCT A;  1HNX C;  1FJG C;  4JI6 C;  1P7L A;  3GKU A;  4G1I A;  4WV3 A;  4OX9 C;  3T1H C;  1YJ7 A;  3LAX A;  4RLF A;  2ONF A;  2ZM6 C;  4DR4 C;  4B3R C;  2Y27 A;  3TUF A;  2E8F A;  2VZE A;  4DV3 C;  2D27 A;  3NYQ A;  5K8F A;  1WH9 A;  1ULT A;  3RG2 A;  2VQF C;  1KKG A;  1WF3 A;  1MXB A;  2CY1 A;  5KYV A;  1IBL C;  4RM3 A;  4OYC A;  5KEI A;  2D1R A;  4DG8 A;  5GTD A;  4DCV A;  2EGT A;  2OBV A;  2PT7 G;  1PG3 A;  4EAT A;  2OO4 A;  4DV1 C;  2UXC C;  2YWC A;  1MDB A;  2DYJ A;  1VLA A;  1MKY A;  3VNR A;  2D1T A;  3A9V A;  2D1S A;  4GXQ A;  2OPL A;  2VQE C;  3OTO C;  3I08 A;  4FUQ A;  1XRC A;  3FCE A;  2JMP A;  2QL8 A;  2E5L C;  1T5D X;  2PN2 A;  1O90 A;  3VNQ A;  4OXI A;  5LMN C;  3E7X A;  2D7V A;  4DR5 C;  4DR7 C;  3J81 D;  3N2Q A;  4LF6 C;  4DCU A;  2E0G A;  4BC9 A;  1UKK A;  1USP B;  1QM4 A;  3R9W A;  4X65 C;  2QVZ X;  2E8E A;  3DHV A;  2ASB A;  3G7S A;  1HNZ C;  4RM2 A;  2ATW A;  4ZLP A;  4I9F A;  1HR0 C;  1V25 A;  4BCA A;  5JRH A;  3R9X A;  4B3T C;  5LMU C;  4ISB A;  2E8C A;  4LE5 A;  3IEV A;  1PA4 A;  3UZ0 A;  1IBM C;  4R1L A;  4JYA C;  4JI2 C;  1ML8 A;  3ETO A;  4HPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...