3TR3A

Structure of a bola protein homologue from coxiella burnetii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
MVTTHDIKQWIETGLSESRVISAEGDGHHFEAVVLCPTFEGQTALTRHRLVYNALGSHMQSDIHALSLKTYTPDEYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Unknown function
molecule keywords BolA
total genus 23
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 3tr3A00
4PUIA 3TR3A 2KDNA 1XS3A 2KZ0A 2MMAB 5LCIA 3O2EA 4PUHA 1NY8A 4PUGA 2MCQA 2DHMA 2NCLA 2MM9A 1V60A
chains in the Genus database with same CATH superfamily
4GXRA 3K6RA 1USPA 5AE3A 4G36A 5ADZA 4GKKC 2YWBA 4OYCA 1EGAA 4PHTA 5K85A 1T5HX 3VNRA 2UXDC 4IR7A 3TR3A 4B3SC 1ZB8A 2CY1A 5CZXA 2UXBC 1HR0C 1TH5A 3CQ1A 4JI7C 2Y4NA 2YCBA 4IZ6A 5BSTA 1V60A 5DV9A 1N2FA 3DAYA 4KTVA 3EERA 3S82A 4PZPA 4YHHC 2CXCA 5BSMA 4L2ZA 5BSWA 4JI8C 4FUQA 4DR5C 1PG3A 3UEBA 1RG9A 4LFAC 4DV1C 5LMUC 1PU1A 3A4IA 3E7XA 4JI2C 4LF9C 4PROC 1MXCA 3ETCA 1PA4A 2DHMA 3LGXA 4X65C 4LF6C 4ZLPA 2CU6A 4RVNA 2D1RA 3A26A 4BBYA 3ETOA 2D1SA 3IMLA 3UOWA 2D27A 2UU9C 1IB8A 3FCCA 5T8SA 3R44A 1MXBA 4DR6C 4B3MC 5BUSA 3B7WA 3TUFA 3PROC 3CQ2A 3CW9A 3N2QA 4ZJZA 4RM2A 4JI5C 2OO4A 4PUHA 1P4EC 1T5DX 3R9WA 2PN2A 1XNQC 4MTNA 1IBKC 2UXCC 4BC7A 2P20A 4KHPC 5LMNC 4K0KC 4NXNC 1ZB9A 5CZVA 4B3TC 2WD9A 3R9XA 1MDBA 1XRCA 2BH1X 2P02A 3IPLA 4DCUA 3JAMD 1UWDA 4D4IA 4DR2C 1VLAA 4DR1C 3E7WA 1LQLA 2ONFA 1MXAA 4RM3A 5BSUA 3I08A 1HNZC 1JOSA 5GTDA 1MKYA 3J81D 4BC9A 1N33C 3SO4A 4HPVA 3AY0A 3LNVA 4DCVA 3T1HC 2Y27A 1ML8A 4LF5C 4XX2A 1O90A 5LCIA 4BCAA 2KDNA 2VSQA 3CQ3A 2QVXX 1RY2A 4R1MA 1BA3A 5KYVA 3C5EA 2ZZNA 2P2JA 2M5OA 4ODJA 2MCQA 3A9VA 3N54B 4U5YD 4LF7C 1XS3A 3NPDA 1P7LA 1FLOA 4PUIA 2MM9A 1ULTA 1WCJA 4JYAC 3FCEA 3A9UA 4DV6C 3NYQA 4L4QA 2QW0X 3VNQA 3GR0A 1UKKA 2VZEA 3VNSA 3A25A 1AMUA 1M6XC 3TDEA 2P2FA 2M5HA 1P4EA 4DR4C 2YWCA 4G1IA 4DV4C 2Y4OA 4DG9A 3L95X 4DUZC 2ATWA 2P2BA 3T1YC 3LUSA 5A1GA 2D1QA 4DG8A 2ZM6C 3CJEA 2E8FA 4LE5A 4DCTA 4DV3C 3GKUA 4GS5A 1V26A 2DPLA 4DUYC 3NYRA 5BURA 4RMNA 4DV7C 4WV3A 1WF3A 1XMOC 4D4GA 2YX1A 3IEUA 5AE2A 4WS9A 4GXQA 2XR1A 5A2QD 2ZZMA 4R1LA 1XMQC 3J80D 3UX3A 2F4VC 1O93A 2PROA 4L7IA 4FTFA 1LCIA 4JI3C 1I94C 4I9GA 2E5LC 4NXMC 1N36C 2QL8A 1N34C 2E8CA 5T8TA 5BUQA 4R0MA 3LAXA 1J5EC 4AQYC 5E7QA 2VQFC 4JV5C 3L8CA 3UX2A 3H2TA 3GPCA 2WP0C 5BR8C 4RLQA 2NCLA 4OX9C 4FUTA 4LFBC 4DV0C 1MD9A 3IEVA 3GR1A 3OTOC 1PG4A 4NOZA 5IT9D 1QM4A 4DCSA 2PT7G 1NY8A 1O9TA 5IWAC 2KZFA 1QWIA 1M6XA 4OXIA 4D57A 1HNWC 4D56A 3DHVA 4X66C 5IFIA 5BSVA 2BJOA 3UZ0A 5A19A 5KYTA 4DV2C 1V25A 4KTTA 4TPSB 4MH4A 1O92A 2JMPA 1XRBA 2KZ0A 4JI4C 2UUCC 2E8EA 4RLFA 3KXWA 4K0BA 5AE1A 5K8FA 4I9FA 4BSZA 2P2MA 5A1IA 2ASBA 1IBMC 2E7GA 1GPMA 1K0RA 4RVOA 5FLXD 3NI2A 1XNRC 2E0GA 4JI0C 5KEIA 2UUAC 2UUBC 2Z51A 3I07A 2HHHC 1MDFA 2MMAB 2JNVA 2D28C 1FJGC 2QVZX 1KKGA 1YJ7A 2D1TA 2P2QA 4X64C 3PESA 1HH2P 1NYEA 3RG2A 1XRAA 3O2EA 4JI1C 4LFCC 2OPLB 4B3RC 2VQEC 2EGTA 1L2FA 4LF8C 1VEHA 2OBVA 2V7BA 4DR3C 1WH9A 3TQIA 3LNOA 4YY3C 3AF6A 1IBLC 4ISBA 4DR7C 5BSRA 1N32C 3EQ6A 2OPLA 5H9UA 1USPB 2HJGA 3RV2A 3CW8X 4GKJC 3DLPX 2QVYX 4LF4C 1HNXC 1FUGA 4NDNA 4JM1A 3PBKA 2DYJA 4JI6C 4G37A 2D7VA 4X62C 3G7SA 3AF5A 2AYAA 4PUGA 5JRHA 4EATA 1XHJA 4DV5C
chains in the Genus database with same CATH topology
4PUIA 3TR3A 2KDNA 1XS3A 2KZ0A 2MMAB 5LCIA 3O2EA 4PUHA 1NY8A 4PUGA 2MCQA 2DHMA 2NCLA 2MM9A 1V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUI A;  3TR3 A;  2KDN A;  1XS3 A;  2KZ0 A;  2MMA B;  5LCI A;  3O2E A;  4PUH A;  1NY8 A;  4PUG A;  2MCQ A;  2DHM A;  2NCL A;  2MM9 A;  1V60 A; 
#chains in the Genus database with same CATH topology
 4GXR A;  3K6R A;  1USP A;  5AE3 A;  4G36 A;  5ADZ A;  4GKK C;  2YWB A;  4OYC A;  1EGA A;  4PHT A;  5K85 A;  1T5H X;  3VNR A;  2UXD C;  4IR7 A;  3TR3 A;  4B3S C;  1ZB8 A;  2CY1 A;  5CZX A;  2UXB C;  1HR0 C;  1TH5 A;  3CQ1 A;  4JI7 C;  2Y4N A;  2YCB A;  4IZ6 A;  5BST A;  1V60 A;  5DV9 A;  1N2F A;  3DAY A;  4KTV A;  3EER A;  3S82 A;  4PZP A;  4YHH C;  2CXC A;  5BSM A;  4L2Z A;  5BSW A;  4JI8 C;  4FUQ A;  4DR5 C;  1PG3 A;  3UEB A;  1RG9 A;  4LFA C;  4DV1 C;  5LMU C;  1PU1 A;  3A4I A;  3E7X A;  4JI2 C;  4LF9 C;  4PRO C;  1MXC A;  3ETC A;  1PA4 A;  2DHM A;  3LGX A;  4X65 C;  4LF6 C;  4ZLP A;  2CU6 A;  4RVN A;  2D1R A;  3A26 A;  4BBY A;  3ETO A;  2D1S A;  3IML A;  3UOW A;  2D27 A;  2UU9 C;  1IB8 A;  3FCC A;  5T8S A;  3R44 A;  1MXB A;  4DR6 C;  4B3M C;  5BUS A;  3B7W A;  3TUF A;  3PRO C;  3CQ2 A;  3CW9 A;  3N2Q A;  4ZJZ A;  4RM2 A;  4JI5 C;  2OO4 A;  4PUH A;  1P4E C;  1T5D X;  3R9W A;  2PN2 A;  1XNQ C;  4MTN A;  1IBK C;  2UXC C;  4BC7 A;  2P20 A;  4KHP C;  5LMN C;  4K0K C;  4NXN C;  1ZB9 A;  5CZV A;  4B3T C;  2WD9 A;  3R9X A;  1MDB A;  1XRC A;  2BH1 X;  2P02 A;  3IPL A;  4DCU A;  3JAM D;  1UWD A;  4D4I A;  4DR2 C;  1VLA A;  4DR1 C;  3E7W A;  1LQL A;  2ONF A;  1MXA A;  4RM3 A;  5BSU A;  3I08 A;  1HNZ C;  1JOS A;  5GTD A;  1MKY A;  3J81 D;  4BC9 A;  1N33 C;  3SO4 A;  4HPV A;  3AY0 A;  3LNV A;  4DCV A;  3T1H C;  2Y27 A;  1ML8 A;  4LF5 C;  4XX2 A;  1O90 A;  5LCI A;  4BCA A;  2KDN A;  2VSQ A;  3CQ3 A;  2QVX X;  1RY2 A;  4R1M A;  1BA3 A;  5KYV A;  3C5E A;  2ZZN A;  2P2J A;  2M5O A;  4ODJ A;  2MCQ A;  3A9V A;  3N54 B;  4U5Y D;  4LF7 C;  1XS3 A;  3NPD A;  1P7L A;  1FLO A;  4PUI A;  2MM9 A;  1ULT A;  1WCJ A;  4JYA C;  3FCE A;  3A9U A;  4DV6 C;  3NYQ A;  4L4Q A;  2QW0 X;  3VNQ A;  3GR0 A;  1UKK A;  2VZE A;  3VNS A;  3A25 A;  1AMU A;  1M6X C;  3TDE A;  2P2F A;  2M5H A;  1P4E A;  4DR4 C;  2YWC A;  4G1I A;  4DV4 C;  2Y4O A;  4DG9 A;  3L95 X;  4DUZ C;  2ATW A;  2P2B A;  3T1Y C;  3LUS A;  5A1G A;  2D1Q A;  4DG8 A;  2ZM6 C;  3CJE A;  2E8F A;  4LE5 A;  4DCT A;  4DV3 C;  3GKU A;  4GS5 A;  1V26 A;  2DPL A;  4DUY C;  3NYR A;  5BUR A;  4RMN A;  4DV7 C;  4WV3 A;  1WF3 A;  1XMO C;  4D4G A;  2YX1 A;  3IEU A;  5AE2 A;  4WS9 A;  4GXQ A;  2XR1 A;  5A2Q D;  2ZZM A;  4R1L A;  1XMQ C;  3J80 D;  3UX3 A;  2F4V C;  1O93 A;  2PRO A;  4L7I A;  4FTF A;  1LCI A;  4JI3 C;  1I94 C;  4I9G A;  2E5L C;  4NXM C;  1N36 C;  2QL8 A;  1N34 C;  2E8C A;  5T8T A;  5BUQ A;  4R0M A;  3LAX A;  1J5E C;  4AQY C;  5E7Q A;  2VQF C;  4JV5 C;  3L8C A;  3UX2 A;  3H2T A;  3GPC A;  2WP0 C;  5BR8 C;  4RLQ A;  2NCL A;  4OX9 C;  4FUT A;  4LFB C;  4DV0 C;  1MD9 A;  3IEV A;  3GR1 A;  3OTO C;  1PG4 A;  4NOZ A;  5IT9 D;  1QM4 A;  4DCS A;  2PT7 G;  1NY8 A;  1O9T A;  5IWA C;  2KZF A;  1QWI A;  1M6X A;  4OXI A;  4D57 A;  1HNW C;  4D56 A;  3DHV A;  4X66 C;  5IFI A;  5BSV A;  2BJO A;  3UZ0 A;  5A19 A;  5KYT A;  4DV2 C;  1V25 A;  4KTT A;  4TPS B;  4MH4 A;  1O92 A;  2JMP A;  1XRB A;  2KZ0 A;  4JI4 C;  2UUC C;  2E8E A;  4RLF A;  3KXW A;  4K0B A;  5AE1 A;  5K8F A;  4I9F A;  4BSZ A;  2P2M A;  5A1I A;  2ASB A;  1IBM C;  2E7G A;  1GPM A;  1K0R A;  4RVO A;  5FLX D;  3NI2 A;  1XNR C;  2E0G A;  4JI0 C;  5KEI A;  2UUA C;  2UUB C;  2Z51 A;  3I07 A;  2HHH C;  1MDF A;  2MMA B;  2JNV A;  2D28 C;  1FJG C;  2QVZ X;  1KKG A;  1YJ7 A;  2D1T A;  2P2Q A;  4X64 C;  3PES A;  1HH2 P;  1NYE A;  3RG2 A;  1XRA A;  3O2E A;  4JI1 C;  4LFC C;  2OPL B;  4B3R C;  2VQE C;  2EGT A;  1L2F A;  4LF8 C;  1VEH A;  2OBV A;  2V7B A;  4DR3 C;  1WH9 A;  3TQI A;  3LNO A;  4YY3 C;  3AF6 A;  1IBL C;  4ISB A;  4DR7 C;  5BSR A;  1N32 C;  3EQ6 A;  2OPL A;  5H9U A;  1USP B;  2HJG A;  3RV2 A;  3CW8 X;  4GKJ C;  3DLP X;  2QVY X;  4LF4 C;  1HNX C;  1FUG A;  4NDN A;  4JM1 A;  3PBK A;  2DYJ A;  4JI6 C;  4G37 A;  2D7V A;  4X62 C;  3G7S A;  3AF5 A;  2AYA A;  4PUG A;  5JRH A;  4EAT A;  1XHJ A;  4DV5 C; 
#chains in the Genus database with same CATH homology
 4PUI A;  3TR3 A;  2KDN A;  1XS3 A;  2KZ0 A;  2MMA B;  5LCI A;  3O2E A;  4PUH A;  1NY8 A;  4PUG A;  2MCQ A;  2DHM A;  2NCL A;  2MM9 A;  1V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...