3TR3A

Structure of a bola protein homologue from coxiella burnetii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
MVTTHDIKQWIETGLSESRVISAEGDGHHFEAVVLCPTFEGQTALTRHRLVYNALGSHMQSDIHALSLKTYTPDEYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords BolA
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 23
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 3tr3A00
2MM9A 4PUHA 2MCQA 5LCIA 3TR3A 4PUGA 1XS3A 2KZ0A 1NY8A 2NCLA 1V60A 4PUIA 2MMAB 3O2EA 2KDNA 2DHMA
chains in the Genus database with same CATH superfamily
1M6XC 2UUBC 4B3MC 2V7BA 2DYJA 1FJGC 1XNQC 5KYVA 4I9FA 2D1SA 2P2FA 3NI2A 5BSTA 4AQYC 5BUQA 4LFCC 5H9UA 2ZZNA 1UWDA 2YWBA 4JI6C 4DV4C 3G7SA 2UXBC 4BC9A 4FUQA 4BBYA 1V25A 1I94C 4LF4C 2D1RA 3UX2A 2KZFA 4YY3C 3GR0A 5AE1A 1O9TA 5BSVA 3CJEA 4R1LA 3S82A 1XMQC 3J81D 1XHJA 2P2QA 1K0RA 5KYTA 4X65C 1FUGA 2UU9C 4TPSB 3RG2A 2P2BA 5DV9A 2YX1A 1P4EA 1N34C 2KDNA 3EERA 1ZB9A 3GR1A 1JOSA 1ZB8A 2BJOA 5JRHA 1FLOA 4DUZC 2D27A 4YHHC 1LCIA 4I9GA 4JV5C 4LF5C 3UZ0A 5LCIA 2ZZMA 4KHPC 1NY8A 4DV1C 5T8SA 4KTTA 4RLFA 4PHTA 5GTDA 4BSZA 2UXCC 2YWCA 5A1GA 3JAMD 3IMLA 3FCCA 4D4IA 5IFIA 2D7VA 1XRBA 2XR1A 4LE5A 3LNVA 2QVXX 1GPMA 1M6XA 4JI3C 4XX2A 4JI2C 4L2ZA 2BH1X 2OPLA 3E7WA 3K6RA 1N36C 4B3TC 4GKKC 3LUSA 3E7XA 1QWIA 3TDEA 3ETCA 4NOZA 4ISBA 2M5HA 3LAXA 2E8CA 4JYAC 5FLXD 2MM9A 2Z51A 4JI4C 5T8TA 3AF6A 2OPLB 5E7QA 1TH5A 2QW0X 1MD9A 4DR3C 3DLPX 3GPCA 1P7LA 3OTOC 2OO4A 4G1IA 2WD9A 3A26A 4B3RC 5BR8C 3TUFA 4LF9C 3R9WA 3A25A 3ETOA 1V60A 2P2MA 3DHVA 1RY2A 1MDBA 4IZ6A 3N54B 4OXIA 4RM3A 2VSQA 5A1IA 1NYEA 3AF5A 1EGAA 3T1YC 4DR6C 4GKJC 1IBKC 2QVZX 3UX3A 4JI1C 4DCVA 1PG3A 1WH9A 3LNOA 4BC7A 1IBMC 3A4IA 4JI5C 5K85A 2NCLA 2QVYX 1ULTA 1HR0C 1KKGA 1WF3A 3I08A 5KEIA 2MMAB 2JMPA 5BSWA 4GXQA 1RG9A 2DPLA 4PUGA 2HHHC 4MH4A 5K8FA 4DV3C 3NPDA 2CXCA 1LQLA 4U5YD 1IBLC 3NYQA 1XMOC 4G36A 5AE2A 4LF6C 2WP0C 1WCJA 1BA3A 4WV3A 4D56A 2EGTA 4PUIA 4DR5C 3PROC 4GXRA 4G37A 2Y4OA 2QL8A 2KZ0A 3PESA 2HJGA 3TQIA 4FUTA 3CW9A 4DV6C 3R44A 4D4GA 1MXBA 2YCBA 1XRCA 4X62C 3UEBA 3B7WA 1XNRC 1AMUA 5IWAC 1UKKA 2D1QA 3I07A 4FTFA 3DAYA 2PROA 5BSUA 4X64C 4WS9A 2E5LC 4D57A 2Y4NA 2CY1A 4GS5A 2UUAC 3IEVA 4EATA 1V26A 5CZXA 4NXMC 1USPA 3PBKA 4X66C 1IB8A 3VNRA 1HNWC 3CW8X 4PROC 3J80D 5BSMA 2MCQA 2CU6A 4DR4C 2ATWA 4DV7C 5LMUC 5IT9D 4LF8C 3EQ6A 2AYAA 2P20A 3A9UA 4OYCA 2E0GA 4HPVA 2F4VC 2P2JA 3IEUA 2OBVA 3H2TA 5AE3A 3VNSA 1VEHA 5CZVA 1O92A 5LMNC 4JI8C 5BUSA 2D28C 2Y27A 4JM1A 4ODJA 3LGXA 4RLQA 4LF7C 4BCAA 4B3SC 3SO4A 4DCUA 2DHMA 4RM2A 2JNVA 1N33C 3RV2A 4OX9C 1N32C 5BURA 2PT7G 1O90A 4ZJZA 3IPLA 4KTVA 4NDNA 1ML8A 4MTNA 5ADZA 4IR7A 4DCSA 2P02A 3GKUA 4DV2C 1PU1A 2VQEC 4DCTA 4PUHA 2UXDC 4DV5C 2VZEA 4DR1C 3KXWA 4JI7C 4K0BA 2UUCC 2ZM6C 4LFAC 4PZPA 1PA4A 1VLAA 2E7GA 2ONFA 1T5DX 4JI0C 3TR3A 5BSRA 1HH2P 1L2FA 3CQ3A 3O2EA 4DG9A 3CQ1A 3C5EA 1XRAA 4K0KC 1HNZC 4LFBC 3A9VA 1O93A 4R0MA 3FCEA 4R1MA 3N2QA 4DG8A 3NYRA 1P4EC 3CQ2A 3VNQA 1J5EC 2D1TA 4DR7C 1MKYA 1MXAA 5A19A 2E8FA 1N2FA 2PN2A 4NXNC 1PG4A 1HNXC 3R9XA 4ZLPA 4DUYC 3AY0A 1MXCA 1MDFA 1QM4A 1XS3A 3T1HC 2ASBA 4DV0C 3L95X 5A2QD 1T5HX 4L4QA 4RMNA 4L7IA 4RVOA 2VQFC 2E8EA 4DR2C 1USPB 4RVNA 3L8CA 2M5OA 1YJ7A 3UOWA
chains in the Genus database with same CATH topology
2MM9A 4PUHA 2MCQA 5LCIA 3TR3A 4PUGA 1XS3A 2KZ0A 1NY8A 2NCLA 1V60A 4PUIA 2MMAB 3O2EA 2KDNA 2DHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM9 A;  4PUH A;  2MCQ A;  5LCI A;  3TR3 A;  4PUG A;  1XS3 A;  2KZ0 A;  1NY8 A;  2NCL A;  1V60 A;  4PUI A;  2MMA B;  3O2E A;  2KDN A;  2DHM A; 
#chains in the Genus database with same CATH topology
 1M6X C;  2UUB C;  4B3M C;  2V7B A;  2DYJ A;  1FJG C;  1XNQ C;  5KYV A;  4I9F A;  2D1S A;  2P2F A;  3NI2 A;  5BST A;  4AQY C;  5BUQ A;  4LFC C;  5H9U A;  2ZZN A;  1UWD A;  2YWB A;  4JI6 C;  4DV4 C;  3G7S A;  2UXB C;  4BC9 A;  4FUQ A;  4BBY A;  1V25 A;  1I94 C;  4LF4 C;  2D1R A;  3UX2 A;  2KZF A;  4YY3 C;  3GR0 A;  5AE1 A;  1O9T A;  5BSV A;  3CJE A;  4R1L A;  3S82 A;  1XMQ C;  3J81 D;  1XHJ A;  2P2Q A;  1K0R A;  5KYT A;  4X65 C;  1FUG A;  2UU9 C;  4TPS B;  3RG2 A;  2P2B A;  5DV9 A;  2YX1 A;  1P4E A;  1N34 C;  2KDN A;  3EER A;  1ZB9 A;  3GR1 A;  1JOS A;  1ZB8 A;  2BJO A;  5JRH A;  1FLO A;  4DUZ C;  2D27 A;  4YHH C;  1LCI A;  4I9G A;  4JV5 C;  4LF5 C;  3UZ0 A;  5LCI A;  2ZZM A;  4KHP C;  1NY8 A;  4DV1 C;  5T8S A;  4KTT A;  4RLF A;  4PHT A;  5GTD A;  4BSZ A;  2UXC C;  2YWC A;  5A1G A;  3JAM D;  3IML A;  3FCC A;  4D4I A;  5IFI A;  2D7V A;  1XRB A;  2XR1 A;  4LE5 A;  3LNV A;  2QVX X;  1GPM A;  1M6X A;  4JI3 C;  4XX2 A;  4JI2 C;  4L2Z A;  2BH1 X;  2OPL A;  3E7W A;  3K6R A;  1N36 C;  4B3T C;  4GKK C;  3LUS A;  3E7X A;  1QWI A;  3TDE A;  3ETC A;  4NOZ A;  4ISB A;  2M5H A;  3LAX A;  2E8C A;  4JYA C;  5FLX D;  2MM9 A;  2Z51 A;  4JI4 C;  5T8T A;  3AF6 A;  2OPL B;  5E7Q A;  1TH5 A;  2QW0 X;  1MD9 A;  4DR3 C;  3DLP X;  3GPC A;  1P7L A;  3OTO C;  2OO4 A;  4G1I A;  2WD9 A;  3A26 A;  4B3R C;  5BR8 C;  3TUF A;  4LF9 C;  3R9W A;  3A25 A;  3ETO A;  1V60 A;  2P2M A;  3DHV A;  1RY2 A;  1MDB A;  4IZ6 A;  3N54 B;  4OXI A;  4RM3 A;  2VSQ A;  5A1I A;  1NYE A;  3AF5 A;  1EGA A;  3T1Y C;  4DR6 C;  4GKJ C;  1IBK C;  2QVZ X;  3UX3 A;  4JI1 C;  4DCV A;  1PG3 A;  1WH9 A;  3LNO A;  4BC7 A;  1IBM C;  3A4I A;  4JI5 C;  5K85 A;  2NCL A;  2QVY X;  1ULT A;  1HR0 C;  1KKG A;  1WF3 A;  3I08 A;  5KEI A;  2MMA B;  2JMP A;  5BSW A;  4GXQ A;  1RG9 A;  2DPL A;  4PUG A;  2HHH C;  4MH4 A;  5K8F A;  4DV3 C;  3NPD A;  2CXC A;  1LQL A;  4U5Y D;  1IBL C;  3NYQ A;  1XMO C;  4G36 A;  5AE2 A;  4LF6 C;  2WP0 C;  1WCJ A;  1BA3 A;  4WV3 A;  4D56 A;  2EGT A;  4PUI A;  4DR5 C;  3PRO C;  4GXR A;  4G37 A;  2Y4O A;  2QL8 A;  2KZ0 A;  3PES A;  2HJG A;  3TQI A;  4FUT A;  3CW9 A;  4DV6 C;  3R44 A;  4D4G A;  1MXB A;  2YCB A;  1XRC A;  4X62 C;  3UEB A;  3B7W A;  1XNR C;  1AMU A;  5IWA C;  1UKK A;  2D1Q A;  3I07 A;  4FTF A;  3DAY A;  2PRO A;  5BSU A;  4X64 C;  4WS9 A;  2E5L C;  4D57 A;  2Y4N A;  2CY1 A;  4GS5 A;  2UUA C;  3IEV A;  4EAT A;  1V26 A;  5CZX A;  4NXM C;  1USP A;  3PBK A;  4X66 C;  1IB8 A;  3VNR A;  1HNW C;  3CW8 X;  4PRO C;  3J80 D;  5BSM A;  2MCQ A;  2CU6 A;  4DR4 C;  2ATW A;  4DV7 C;  5LMU C;  5IT9 D;  4LF8 C;  3EQ6 A;  2AYA A;  2P20 A;  3A9U A;  4OYC A;  2E0G A;  4HPV A;  2F4V C;  2P2J A;  3IEU A;  2OBV A;  3H2T A;  5AE3 A;  3VNS A;  1VEH A;  5CZV A;  1O92 A;  5LMN C;  4JI8 C;  5BUS A;  2D28 C;  2Y27 A;  4JM1 A;  4ODJ A;  3LGX A;  4RLQ A;  4LF7 C;  4BCA A;  4B3S C;  3SO4 A;  4DCU A;  2DHM A;  4RM2 A;  2JNV A;  1N33 C;  3RV2 A;  4OX9 C;  1N32 C;  5BUR A;  2PT7 G;  1O90 A;  4ZJZ A;  3IPL A;  4KTV A;  4NDN A;  1ML8 A;  4MTN A;  5ADZ A;  4IR7 A;  4DCS A;  2P02 A;  3GKU A;  4DV2 C;  1PU1 A;  2VQE C;  4DCT A;  4PUH A;  2UXD C;  4DV5 C;  2VZE A;  4DR1 C;  3KXW A;  4JI7 C;  4K0B A;  2UUC C;  2ZM6 C;  4LFA C;  4PZP A;  1PA4 A;  1VLA A;  2E7G A;  2ONF A;  1T5D X;  4JI0 C;  3TR3 A;  5BSR A;  1HH2 P;  1L2F A;  3CQ3 A;  3O2E A;  4DG9 A;  3CQ1 A;  3C5E A;  1XRA A;  4K0K C;  1HNZ C;  4LFB C;  3A9V A;  1O93 A;  4R0M A;  3FCE A;  4R1M A;  3N2Q A;  4DG8 A;  3NYR A;  1P4E C;  3CQ2 A;  3VNQ A;  1J5E C;  2D1T A;  4DR7 C;  1MKY A;  1MXA A;  5A19 A;  2E8F A;  1N2F A;  2PN2 A;  4NXN C;  1PG4 A;  1HNX C;  3R9X A;  4ZLP A;  4DUY C;  3AY0 A;  1MXC A;  1MDF A;  1QM4 A;  1XS3 A;  3T1H C;  2ASB A;  4DV0 C;  3L95 X;  5A2Q D;  1T5H X;  4L4Q A;  4RMN A;  4L7I A;  4RVO A;  2VQF C;  2E8E A;  4DR2 C;  1USP B;  4RVN A;  3L8C A;  2M5O A;  1YJ7 A;  3UOW A; 
#chains in the Genus database with same CATH homology
 2MM9 A;  4PUH A;  2MCQ A;  5LCI A;  3TR3 A;  4PUG A;  1XS3 A;  2KZ0 A;  1NY8 A;  2NCL A;  1V60 A;  4PUI A;  2MMA B;  3O2E A;  2KDN A;  2DHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...