3TR3A

Structure of a bola protein homologue from coxiella burnetii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
MVTTHDIKQWIETGLSESRVISAEGDGHHFEAVVLCPTFEGQTALTRHRLVYNALGSHMQSDIHALSLKTYTPDEYER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Unknown function
molecule keywords BolA
total genus 23
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 3tr3A00
1V60A 3TR3A 2DHMA 2KZ0A 2KDNA 2NCLA 4PUHA 2MMAB 5LCIA 2MCQA 3O2EA 1NY8A 4PUIA 2MM9A 4PUGA 1XS3A
chains in the Genus database with same CATH superfamily
1MDBA 1FUGA 3A25A 4TPSB 1WF3A 2ZM6C 1MXBA 3N2QA 4PUHA 4G37A 4XX2A 1P4EA 2YX1A 3DHVA 2F4VC 2QL8A 3LAXA 3E7XA 4BC9A 4JI2C 2PROA 3UZ0A 4RM2A 3CQ3A 4YY3C 1XS3A 3PBKA 1AMUA 5BUQA 4R1MA 1UWDA 4D4GA 3CW8X 3R9WA 4BC7A 3IEVA 3IEUA 2ZZNA 4MH4A 3FCEA 4BBYA 2Z51A 4BSZA 4LFCC 2CY1A 2BJOA 4K0KC 4JI0C 2P02A 3T1YC 1EGAA 4ODJA 3SO4A 3K6RA 3J80D 1M6XC 5IT9D 3LUSA 5AE2A 1T5HX 3S82A 2YWCA 1ML8A 4I9GA 4OX9C 2D1TA 1T5DX 4JI1C 3LGXA 2Y27A 4NXNC 4NDNA 2UUAC 3EERA 4L4QA 2UXDC 4DR4C 3ETCA 4DV1C 3VNRA 4LF4C 2OPLB 1PA4A 4LF7C 4DUZC 1JOSA 2P20A 4DR3C 5LMUC 2JMPA 2P2QA 4I9FA 1IBKC 4JI8C 1V60A 3AF6A 1N32C 5BSTA 1NYEA 4GXQA 4X64C 3LNVA 2ATWA 1O93A 3N54B 2P2MA 4G36A 1P7LA 3EQ6A 4JI6C 5A1GA 2WP0C 4DR5C 2UU9C 2E8EA 5K85A 4PROC 4R1LA 2YWBA 4DCTA 2CXCA 3TQIA 4B3TC 4RVNA 3A9UA 1RY2A 1PU1A 4YHHC 2MCQA 3TR3A 3CW9A 4DUYC 4JI4C 3PESA 3AF5A 4DG9A 3A26A 5KYVA 4JI5C 2CU6A 5BURA 5GTDA 4WV3A 2D1SA 5BSRA 1J5EC 3GR1A 2JNVA 4L2ZA 2NCLA 3R44A 2VQEC 4D57A 4D4IA 1MDFA 5IFIA 3R9XA 2QVXX 2QW0X 1YJ7A 5CZXA 4G1IA 3IMLA 1FLOA 5AE3A 1LCIA 3UX3A 4GXRA 2VZEA 2D27A 4X62C 4LF5C 3L95X 4DV2C 3NI2A 4KTTA 3I07A 4EATA 1FJGC 2UUCC 1BA3A 4LF8C 5LMNC 5ADZA 2ASBA 3RG2A 4RLFA 2OBVA 4RVOA 3VNQA 4JM1A 1IBMC 4LF6C 4NOZA 4PUGA 1RG9A 4K0BA 5H9UA 3IPLA 2ZZMA 2ONFA 2DHMA 4OXIA 3UX2A 2Y4NA 3O2EA 1I94C 3PROC 1O9TA 2MM9A 3CQ1A 3G7SA 4DV6C 5LCIA 4LFBC 5K8FA 1UKKA 2VSQA 4MTNA 5FLXD 4DR1C 1N34C 2HHHC 1XMOC 1MXCA 3J81D 1XNRC 2P2JA 2E8FA 5JRHA 3L8CA 3A9VA 1PG3A 4DV5C 4B3RC 4ISBA 2MMAB 1HH2P 5T8TA 3AY0A 1WCJA 5BSWA 3GKUA 3CQ2A 2HJGA 4LE5A 2YCBA 3TDEA 4WS9A 3OTOC 1HNWC 4GKJC 1K0RA 2BH1X 5IWAC 2EGTA 3ETOA 5DV9A 2P2FA 2XR1A 3LNOA 4FTFA 2PN2A 4KTVA 4L7IA 3JAMD 3VNSA 2V7BA 5AE1A 1MKYA 4DG8A 1KKGA 1N36C 4GS5A 4DV7C 1HNZC 4FUQA 1MD9A 3I08A 1ULTA 4PHTA 2UUBC 4JV5C 1XMQC 1USPB 1IB8A 1VLAA 5BUSA 1QM4A 5A2QD 4IR7A 4OYCA 2VQFC 2KZ0A 3RV2A 3E7WA 5CZVA 5BR8C 4JI7C 1O90A 1N2FA 2DPLA 3B7WA 4B3MC 4DCUA 3KXWA 3NYQA 3T1HC 3UEBA 2E7GA 2DYJA 5BSMA 3UOWA 5A19A 4B3SC 4D56A 2D28C 4ZJZA 4U5YD 1XHJA 4AQYC 4DV0C 2D1RA 3FCCA 4DCVA 5BSUA 4ZLPA 1V26A 4HPVA 2QVYX 4DR7C 2M5HA 1WH9A 1ZB9A 1O92A 4IZ6A 1NY8A 4RMNA 2D7VA 2AYAA 2UXBC 5BSVA 1QWIA 4R0MA 3NPDA 4BCAA 4RLQA 1M6XA 1PG4A 2P2BA 4PZPA 2OO4A 4X65C 2WD9A 5KEIA 4LFAC 1L2FA 3C5EA 4GKKC 4NXMC 4DV3C 2KZFA 3A4IA 5A1IA 4DR2C 4X66C 1MXAA 5KYTA 2E5LC 1P4EC 4JYAC 5E7QA 4FUTA 1XRBA 2E0GA 1LQLA 1USPA 2QVZX 1ZB8A 1XRCA 2OPLA 1XNQC 4RM3A 1V25A 2M5OA 4KHPC 1IBLC 1VEHA 4LF9C 4PUIA 2D1QA 3NYRA 3H2TA 3TUFA 3CJEA 4JI3C 3GR0A 2Y4OA 1HR0C 3DAYA 5T8SA 1XRAA 1TH5A 4DCSA 1HNXC 1N33C 2UXCC 2KDNA 4DR6C 3GPCA 2PT7G 1GPMA 2E8CA 3DLPX 4DV4C
chains in the Genus database with same CATH topology
1V60A 3TR3A 2DHMA 2KZ0A 2KDNA 2NCLA 4PUHA 2MMAB 5LCIA 2MCQA 3O2EA 1NY8A 4PUIA 2MM9A 4PUGA 1XS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V60 A;  3TR3 A;  2DHM A;  2KZ0 A;  2KDN A;  2NCL A;  4PUH A;  2MMA B;  5LCI A;  2MCQ A;  3O2E A;  1NY8 A;  4PUI A;  2MM9 A;  4PUG A;  1XS3 A; 
#chains in the Genus database with same CATH topology
 1MDB A;  1FUG A;  3A25 A;  4TPS B;  1WF3 A;  2ZM6 C;  1MXB A;  3N2Q A;  4PUH A;  4G37 A;  4XX2 A;  1P4E A;  2YX1 A;  3DHV A;  2F4V C;  2QL8 A;  3LAX A;  3E7X A;  4BC9 A;  4JI2 C;  2PRO A;  3UZ0 A;  4RM2 A;  3CQ3 A;  4YY3 C;  1XS3 A;  3PBK A;  1AMU A;  5BUQ A;  4R1M A;  1UWD A;  4D4G A;  3CW8 X;  3R9W A;  4BC7 A;  3IEV A;  3IEU A;  2ZZN A;  4MH4 A;  3FCE A;  4BBY A;  2Z51 A;  4BSZ A;  4LFC C;  2CY1 A;  2BJO A;  4K0K C;  4JI0 C;  2P02 A;  3T1Y C;  1EGA A;  4ODJ A;  3SO4 A;  3K6R A;  3J80 D;  1M6X C;  5IT9 D;  3LUS A;  5AE2 A;  1T5H X;  3S82 A;  2YWC A;  1ML8 A;  4I9G A;  4OX9 C;  2D1T A;  1T5D X;  4JI1 C;  3LGX A;  2Y27 A;  4NXN C;  4NDN A;  2UUA C;  3EER A;  4L4Q A;  2UXD C;  4DR4 C;  3ETC A;  4DV1 C;  3VNR A;  4LF4 C;  2OPL B;  1PA4 A;  4LF7 C;  4DUZ C;  1JOS A;  2P20 A;  4DR3 C;  5LMU C;  2JMP A;  2P2Q A;  4I9F A;  1IBK C;  4JI8 C;  1V60 A;  3AF6 A;  1N32 C;  5BST A;  1NYE A;  4GXQ A;  4X64 C;  3LNV A;  2ATW A;  1O93 A;  3N54 B;  2P2M A;  4G36 A;  1P7L A;  3EQ6 A;  4JI6 C;  5A1G A;  2WP0 C;  4DR5 C;  2UU9 C;  2E8E A;  5K85 A;  4PRO C;  4R1L A;  2YWB A;  4DCT A;  2CXC A;  3TQI A;  4B3T C;  4RVN A;  3A9U A;  1RY2 A;  1PU1 A;  4YHH C;  2MCQ A;  3TR3 A;  3CW9 A;  4DUY C;  4JI4 C;  3PES A;  3AF5 A;  4DG9 A;  3A26 A;  5KYV A;  4JI5 C;  2CU6 A;  5BUR A;  5GTD A;  4WV3 A;  2D1S A;  5BSR A;  1J5E C;  3GR1 A;  2JNV A;  4L2Z A;  2NCL A;  3R44 A;  2VQE C;  4D57 A;  4D4I A;  1MDF A;  5IFI A;  3R9X A;  2QVX X;  2QW0 X;  1YJ7 A;  5CZX A;  4G1I A;  3IML A;  1FLO A;  5AE3 A;  1LCI A;  3UX3 A;  4GXR A;  2VZE A;  2D27 A;  4X62 C;  4LF5 C;  3L95 X;  4DV2 C;  3NI2 A;  4KTT A;  3I07 A;  4EAT A;  1FJG C;  2UUC C;  1BA3 A;  4LF8 C;  5LMN C;  5ADZ A;  2ASB A;  3RG2 A;  4RLF A;  2OBV A;  4RVO A;  3VNQ A;  4JM1 A;  1IBM C;  4LF6 C;  4NOZ A;  4PUG A;  1RG9 A;  4K0B A;  5H9U A;  3IPL A;  2ZZM A;  2ONF A;  2DHM A;  4OXI A;  3UX2 A;  2Y4N A;  3O2E A;  1I94 C;  3PRO C;  1O9T A;  2MM9 A;  3CQ1 A;  3G7S A;  4DV6 C;  5LCI A;  4LFB C;  5K8F A;  1UKK A;  2VSQ A;  4MTN A;  5FLX D;  4DR1 C;  1N34 C;  2HHH C;  1XMO C;  1MXC A;  3J81 D;  1XNR C;  2P2J A;  2E8F A;  5JRH A;  3L8C A;  3A9V A;  1PG3 A;  4DV5 C;  4B3R C;  4ISB A;  2MMA B;  1HH2 P;  5T8T A;  3AY0 A;  1WCJ A;  5BSW A;  3GKU A;  3CQ2 A;  2HJG A;  4LE5 A;  2YCB A;  3TDE A;  4WS9 A;  3OTO C;  1HNW C;  4GKJ C;  1K0R A;  2BH1 X;  5IWA C;  2EGT A;  3ETO A;  5DV9 A;  2P2F A;  2XR1 A;  3LNO A;  4FTF A;  2PN2 A;  4KTV A;  4L7I A;  3JAM D;  3VNS A;  2V7B A;  5AE1 A;  1MKY A;  4DG8 A;  1KKG A;  1N36 C;  4GS5 A;  4DV7 C;  1HNZ C;  4FUQ A;  1MD9 A;  3I08 A;  1ULT A;  4PHT A;  2UUB C;  4JV5 C;  1XMQ C;  1USP B;  1IB8 A;  1VLA A;  5BUS A;  1QM4 A;  5A2Q D;  4IR7 A;  4OYC A;  2VQF C;  2KZ0 A;  3RV2 A;  3E7W A;  5CZV A;  5BR8 C;  4JI7 C;  1O90 A;  1N2F A;  2DPL A;  3B7W A;  4B3M C;  4DCU A;  3KXW A;  3NYQ A;  3T1H C;  3UEB A;  2E7G A;  2DYJ A;  5BSM A;  3UOW A;  5A19 A;  4B3S C;  4D56 A;  2D28 C;  4ZJZ A;  4U5Y D;  1XHJ A;  4AQY C;  4DV0 C;  2D1R A;  3FCC A;  4DCV A;  5BSU A;  4ZLP A;  1V26 A;  4HPV A;  2QVY X;  4DR7 C;  2M5H A;  1WH9 A;  1ZB9 A;  1O92 A;  4IZ6 A;  1NY8 A;  4RMN A;  2D7V A;  2AYA A;  2UXB C;  5BSV A;  1QWI A;  4R0M A;  3NPD A;  4BCA A;  4RLQ A;  1M6X A;  1PG4 A;  2P2B A;  4PZP A;  2OO4 A;  4X65 C;  2WD9 A;  5KEI A;  4LFA C;  1L2F A;  3C5E A;  4GKK C;  4NXM C;  4DV3 C;  2KZF A;  3A4I A;  5A1I A;  4DR2 C;  4X66 C;  1MXA A;  5KYT A;  2E5L C;  1P4E C;  4JYA C;  5E7Q A;  4FUT A;  1XRB A;  2E0G A;  1LQL A;  1USP A;  2QVZ X;  1ZB8 A;  1XRC A;  2OPL A;  1XNQ C;  4RM3 A;  1V25 A;  2M5O A;  4KHP C;  1IBL C;  1VEH A;  4LF9 C;  4PUI A;  2D1Q A;  3NYR A;  3H2T A;  3TUF A;  3CJE A;  4JI3 C;  3GR0 A;  2Y4O A;  1HR0 C;  3DAY A;  5T8S A;  1XRA A;  1TH5 A;  4DCS A;  1HNX C;  1N33 C;  2UXC C;  2KDN A;  4DR6 C;  3GPC A;  2PT7 G;  1GPM A;  2E8C A;  3DLP X;  4DV4 C; 
#chains in the Genus database with same CATH homology
 1V60 A;  3TR3 A;  2DHM A;  2KZ0 A;  2KDN A;  2NCL A;  4PUH A;  2MMA B;  5LCI A;  2MCQ A;  3O2E A;  1NY8 A;  4PUI A;  2MM9 A;  4PUG A;  1XS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...