4PHTA

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
485
structure length
438
Chain Sequence
RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEADKEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAGEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
total genus 127
structure length 438
sequence length 485
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4phtA01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4phtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phtA03
1G7RA 1VYTA 1SQ5A 4UQOA 2YOHA 3KKOA 5KU1A 2BJVA 2ANBA 3U6BA 1XMJA 2QTVB 3CRW1 3U4QB 3CW2A 4CEHB 2N42A 3NDBB 3HPQA 2FOLA 3GJ8A 3RNLA 3LNCA 3I8XA 4DRZA 4BEJA 3GLGE 3QXCA 3TK1A 1U0JA 3ZYCA 1P2TA 1UADA 2Q9BA 3A8TA 2BHRA 2DFKB 2R6FA 5B57C 2OCBA 1W2HA 4PR0A 1HURA 4RY2A 1GL9B 2P0EA 1P62B 3A58B 2B6HA 3W3AA 4G5OA 5EQTA 5J4VA 4B73A 5FBWB 4Q7LA 3HU2A 5F9HA 3LDAA 3R7WA 4P4TA 1G5TA 3I73A 4FXPA 1U8ZA 2WPDD 1JAIA 4URZR 5CITA 1R6BX 2ZRAA 1CXZA 2QMUA 3IBGA 1DEKA 1XTJA 4BZPA 1GKIA 1Y3AA 4RD1A 3KQNA 2YKGA 1HY3A 2BMJA 2CLDX 3ONWA 4PC3A 3SDZA 2WWHA 3FMFA 5CIWA 4LJ9A 1C1YA 2QAGB 2BWJA 2IUTA 3BE4A 3K1JA 3R8CA 3VR1A 1JEEA 1Z83A 4Q18A 4DB2A 4H9GA 2ZYWX 3SOPA 2DFNA 8OHMA 3AVQA 2O8EB 5JS7A 1RYHA 1GZSA 2GESA 4OK3A 5EE1A 3N5CA 1PV4A 1AK2A 3NC0C 2J59A 3NDPA 1IOZA 3S1AA 4IEIA 4NYMQ 1UKVY 4DT1A 4CIDA 1S3GA 3AVOA 1DBSA 1SHZA 1RYFA 3BJIC 3EG5A 3GD7A 3OE7A 4WXRA 4ZI2A 3I72A 5EE0A 3RC8A 3C8UA 4JT4A 2AWOA 3Q5EA 3U60B 4WOPA 3ZS9A 1E2DA 1SKYB 3CKLA 1WRBA 4V03A 4C30A 2FFAA 5SZKB 1RE0A 1TQ6A 3BH0A 3K9HA 2J7KA 1FQKA 5JFGA 4EKDA 2GAOA 4NYIR 4TLEA 4HUQA 2BIFA 1KO5A 3B8HA 3SYLA 2F7SA 4DJTA 1QBKC 3W6NA 3RRYA 1K6MA 1RKBA 2EW1A 2V7QA 4CT4B 1RJ9B 3B1ZA 1TF2A 2QI9C 3UMSA 3AUXA 2WAXA 3F3YA 4TL7A 2IBMA 1AKYA 2GZDA 3CNLA 3RABA 4A0FA 3JVVA 4IKEA 5DYIA 4ESHA 2VRWA 1IQPA 4S35A 3K0FB 4YDSA 1E9RA 1VPLA 2D3WA 1E79A 3Q8XB 3GJ3A 1XEWX 2GF0A 2KI5A 4CGZA 2C95A 1OFTA 1KO1A 1T5LA 1T0JB 1YR6A 2FSIA 1Z0JA 2J41A 4BFWA 4P0TA 1Q3HA 1N25A 4C0JA 3AVUA 1XRJA 3KXLA 2GXSA 1UBCA 2H5EA 1U0HC 4HAUA 3B9PA 4M53A 1TX4B 2QGNA 2ZRCA 4YMTA 2FJUA 2ZRPA 1N6PA 2GK6A 2F1IA 3CUEF 1JR3A 3KFVA 4Q4LA 1KI2A 4PQYA 4YONB 1SGWA 5FOWA 2XNSA 5C18A 4LHWA 4EAQA 1US8A 1W0KA 2OO7A 2GJ9A 4LJ6A 2V54A 4M1TA 2EFEB 4BASA 1JI0A 4RD4A 4DLZA 2J5XA 1ZD9A 4PO1A 2DFLA 3CPEA 3OIWA 4A9AA 4EPRA 1GNQA 4P4SB 1E0KA 4DUGA 3CRVA 2XZPA 4JVLA 1OKKA 1U90A 1KTVA 3F5FA 4WBSA 3B6EA 4BFSA 2EWVA 1YQTA 5FR1A 5C2JB 2EYUA 4QHYA 3BD9A 3PVSA 3LQQA 5FTNA 1KI9A 5LB2A 1BMFD 4ZKDA 3EIQA 1UDWA 3WNBA 3IPXA 5H70A 4MKHA 4F4JA 2AFHE 1E2MA 2TMKA 1GG2A 3OIVA 1N6OA 2WKRA 4DIEA 5AK0A 4ZDIA 2ZYUX 4U5XA 2AXPA 5KPJA 1P2SA 1A7JA 1UKYA 3LLUA 3QF4B 1VYVA 4EPXA 3LAWA 1QHSA 4US2R 2QGZA 1UBGA 3AVYA 5FUYA 1TQDA 4Q9HA 1NVUQ 3HJNA 2ZU0C 2ZR9A 4FD2A 3TLXA 3ZIAA 2Y8EA 1TUIA 4TTQA 2CE7A 1NN0A 3NIBA 1P72A 3PCRB 3ZQJA 1D5CA 1N6HA 1GOTA 1JECA 2IK8A 2ZAMA 4NCJA 2YWEA 3N2IA 3CB4A 4C2UA 5L3SA 2OZEA 1Z6AA 4IOKA 1KZGB 1YZTA 1NLZA 2RGBA 2WWFA 3LD9A 2GEDA 2VHUA 4TTPA 5FI0B 1ZIOA 4DXAA 1G291 2IA5A 2DFTA 2DHRA 4IOJA 2VA8A 1TAGA 1JQJC 4RCYA 5C4MA 2A9KA 1OIVA 2BMFA 4U7DA 3SE0A 1OSNA 2O8DB 4CEIA 1FP6A 1G17A 2YWFA 4DLTA 2ODEA 4CW7A 3ASZA 3HR8A 4XTRA 4LPKA 4Q47A 3OIYA 4G5RA 3FFAA 2RGGA 5FFMA 1O87A 3KB2A 1S2MA 4LHXA 1KDOA 3B1VA 1UEJA 2ZI9A 2JLYA 2JLVA 3QNUA 4DSTA 3GLGB 4DIDA 1JQLB 4M4SA 1GDDA 2W6JA 3DM9B 4P31A 5AJZA 5JJKA 2O8CB 2QP9X 4OI2A 5JJIA 2ZRHA 3ZVRA 3B82A 4QGFA 2C2HA 2QENA 3AVTA 1U9IA 4GMDA 3GJXC 2FNAA 3EPLA 2HXSA 3K0SA 1HE8B 1DAEA 3TBKA 1AGRA 3IGFA 1E2PA 4MDEA 3OE7D 3PUZA 4KV9A 2XOKA 1G64A 3O8CA 5K8LA 2P3SA 2C8VA 3P4YA 4XH9B 2JASA 2V55B 3KKPA 3DO6A 4Z54A 4XVRA 1LB1B 2FEOA 3FHTA 2PCJA 4ZCLA 1S8FA 2V4ZA 4IJMA 2RMKA 1PUIA 4DCNA 2XXAB 4Z8YA 4XTCS 3OFNA 1E2KA 3QY0A 4OJKA 5AUNB 4FW9A 2HYIC 2ZE6A 1R0XA 3BS4A 3RANA 2FA9A 1HE1C 3Q9LA 1A2KC 3AVPA 1P60A 3TAUA 1KO7A 2QBYA 4AKEA 4II7A 4V0ME 3KL4A 3PXGA 1E79D 4NZYA 2REBA 4HATA 1DPFA 2EU8A 3DPUA 5E7IA 1KGDA 1IN8A 2Z4SA 2BH1X 3VAAA 1SXJD 2WZQA 2ZEJA 3WMGA 3THWA 2IYTA 2XITA 2B21A 4JVMA 4X8OA 2OV2A 3FMOB 5JHGB 4OHVA 4OK6A 3QEJA 1SVKA 5KPDA 4BLOA 3ZJYA 1DAIA 2ORIA 2WSSA 1HT2E 3A1VA 4JL8A 5LD2B 3W9YA 1KK2A 5H8WA 4G01B 2H18A 1SVOA 4DLYA 4KITB 1JR3D 1R5NA 3I5XA 3SYNA 3P27A 2MSDB 2ZI4A 2CL7X 2PX0A 4PHFA 3WYGA 1RVDA 3DKVA 5DHFA 1BIFA 1HH4A 2ZXUA 5FL7A 3GMTA 1GITA 2QZ4A 2OFXA 1KSGA 4RFSA 3TQCA 3EWSA 4IDQA 3I62A 3OEHA 4NCIA 1RPZA 1OKKD 2XEXA 3THYA 4Q1EA 2HCJB 4AG5A 3P4XA 3AV0B 5ANRB 4C9BA 3DDCA 1R0WA 4LJYA 4AC9A 4F4IA 3LA6A 4TL8A 3EPHA 5CJPA 4LPSA 2QM7A 4MDFA 3MWLA 1L4UA 1Z3IX 2D27A 4LZZA 5ELXA 1UF9A 2ZRDA 3VNUA 3K0AA 2F55A 1MKYA 3QKUA 5D3QA 4M1OA 5CLLA 5AR1A 4GMXA 1NVWQ 3NHAA 3IO5A 1GSIA 1KY3A 1PLJA 4EUNA 4R2HA 4O3MA 3DMDA 1NKTA 4C3ZA 2W2TA 5J4HA 3B2EA 4OQLA 1OH6A 5FBRB 1G8FA 1OIXA 1B0UA 1W5TA 5DH9A 3ZIAD 4ZV4A 5CK4A 1YKSA 4A4DA 2ANCA 2Z4RA 4DLUA 3SBEA 4EJSC 4D26A 1WDTA 4C0SA 2NZJA 4BQSA 1T8UA 1NVXQ 2AL7A 4NH0A 1WA5A 2OCYC 1VIYA 2OCAA 2UZ3A 2BBSA 2CK3D 3I92A 1I2MA 2PEYA 1DVRA 2VYFA 4FMCB 2NMVA 3SZRA 2IEZA 5BXQC 5JSZB 2C5LA 4OHYA 2QMEA 3QVUA 1M7BA 2FX3A 3RWMB 2EFDB 1KSFX 2F43B 3C7KA 1OFHA 4J0QA 3BB1A 1ZNZA 4RD0A 3DOFA 3VQTA 4LC0A 3NTUA 5H68A 3GJ0A 1E9EA 4P3YA 2ZTSA 3H2YA 4HB2A 4KSCA 3WY9A 1TEVA 1T0HB 3W34A 3B9QA 5JWHA 1CF4A 5F3WB 1WQ1R 2J7PD 3IUYA 1MO6A 4RZUA 4O2RA 4ERNA 1XX6A 5SZJA 2RCNA 2JLZA 4NHOA 2VSFA 3FGNA 1KKLA 3CZQA 2EFCB 1ZCAA 4H1VA 5JBQA 3AKYA 2VP5A 4G5SA 4KHZA 1E32A 3PEYA 3B1WA 3QKSA 2YYZA 4M9SA 1F2TA 1TADA 5FOTA 1S0UA 1YE8A 3QXSA 2WWIA 1QHNA 1I2DA 2XOKD 2WMNB 1YU9A 2YWGA 4B6FA 1DELA 3KFXA 1TMKA 1Z29A 3RHFA 1E9AA 2BCGY 3M4YA 4OHZA 2MSEB 1IJFA 4B33A 5G41A 4QFMA 3X1WA 2DYKA 2ZVPX 3AEZA 3ZD6A 1W36C 1G5PA 4MGKR 1W0JD 3RS0A 1E1QA 1N6KA 3FDIA 2W6IA 4US1R 2IYXA 2NGRA 2HT6A 4HSEA 4CT5A 1VECA 4L9SA 3LW8A 5H1YA 3SS8A 2PL3A 2L0XA 5CYOA 3U6KA 1XPOA 1S9HA 2NPIA 1MO3A 4UNRA 1PUJA 2H17A 2ZS9A 4KFRA 4QGGA 3TE6A 1Z47A 4IVPA 3TW8B 3WYAA 1OXVA 2BBTA 2DBYA 2GAAA 3LLMA 2IS1A 4HI0E 2D4HA 4LI0A 2NOAA 3ASYA 4CVNA 2R6AA 1OT3A 5CDFE 4YQFA 1NIJA 1XB2A 3ICQB 2A2ZA 4EDHA 4QNMA 3BB4A 1YR9A 3EARA 5M04A 1H65A 1CTQA 5C46F 4MQBA 4QM7A 3MMPA 3LQRA 1JJ7A 2JGNA 2PLFA 5L3QA 1IJEA 2FF7A 1VG1A 4HAVA 5KDLA 3E2IA 2RGCA 5DE3A 3RRMA 2ZITA 2CJWB 3QPWA 2CLCX 3KXIA 4V0LA 1WBBA 4N0DA 3OEHD 4DVGA 2WV9A 4KBFA 4ON9A 4B44A 4RSGA 2RGNC 3QJYA 5EE9A 2WPDA 1SKYE 1I4DD 2Q6TA 4TQAA 1JR6A 3U3MA 2G83A 4JLOA 1DG3A 3SQWA 2WHXA 2VL7A 1UBFA 4GBMA 1KOFA 1D9XA 4LC1A 3PEVA 5FUWA 4RVCA 4AG6A 1L4YA 1CR1A 3GLHB 1RRCA 4IXNA 4EPTA 1AIPA 5K8TA 3P32A 3G82C 1Z6YA 3NKVA 2IS2A 2IF2A 2XZLA 1MABB 5E95A 5EZ6B 5JI3E 3LW7A 3PIRA 2VP4A 1YJ5A 1AN0A 4GI7A 3FE2A 4QHSA 5FUXA 4FCVA 3K0CC 3MCAA 2NO6A 1LS1A 2GJAA 3AF2A 2WSMA 3MD0A 2IUUA 4PO8A 1NNEA 1UPTA 4A2QA 5KNBA 4MGIR 1E0JA 4KI0A 2YWHA 1EFTA 2OAQ1 2A30A 2XAUA 5BYKA 3W8NA 4OBEA 3A36A 1JXOA 3AM1A 1ZYUA 4EFMA 3UXMA 3PQCA 3B60A 2WM9B 1QHXA 3BAFA 2GJSA 1JBKA 3AGQA 2F1JA 3PFIA 3SI7A 2HF8A 4BUJA 3TSOA 1J7KA 1XJ0A 4Z51A 4FI3C 4CDGA 2BM0A 4RKEA 5FPSA 1KI6A 4O2LA 2H57A 2VHJA 3REFA 4KCGA 2ZANA 1NG9A 2FFBA 5DI3A 1VKJA 3BWDD 4W5JA 2FSFA 5DHAA 2CHQA 3CNNA 4I81A 4C0KA 1E96A 2IF0A 2J0UA 2C9CA 2QP3A 3MLEA 1P7CA 2PH1A 3P1JA 4JBXA 2G6BA 4WZBE 5FI1B 4B43A 2P5TB 4LY6A 3ZVNA 3NC1C 3DMNA 3IIMA 1E0AA 4AKHA 1SVWA 4PZZA 4D4MA 1FQJA 4GP6A 1GILA 3L8ZA 2VH5R 2VHCA 3U5ZB 1BS1A 3T15A 1HEIA 4PZLA 1GFIA 2Q3FA 4A8JA 4KVGA 4B34A 3UK6A 2FG5A 3AP2A 5FTKA 4B2IA 4B75A 1Q1EA 2QPTA 1QDEA 2H1LA 4ZCMA 5HPYB 1VG0B 3GFPA 3GLIE 2Z6VA 1NN1A 1R8QA 2IC5A 3AUYA 4A1FA 1W7AA 4A0RA 2W58A 5EZ5A 1G16A 2GHIA 1YZUA 3CX8A 4JZKA 3VMFA 1F3OA 1XD2A 2OLKA 1NSFA 4BRWA 1X8JA 2QM8A 4IOMA 4K46A 4IVQA 3TGPA 2DPXA 2WJYA 2AWNA 2OESA 4OQNA 3WBJA 4G5QA 2RGAA 2QL6A 3D6TB 3FFBA 4Q1CA 3FKSD 4LYAA 1QG4A 2F1HA 4IFBA 5UKDA 3G0HA 4BFUA 4Q4JA 3TJZA 3A4MA 4NYJR 3K09A 4JLNA 4AK9A 4B71A 2ZJ2A 1BMFA 2WOJA 2BOVA 2IWRA 5JLJA 4D4JA 4GDFA 1QHHA 1VCNA 3AVVA 4KBGA 4I1OA 4R98A 3ZLJA 2FE4A 1GP2A 1MRNA 1G3IA 3U7FB 1FL9A 2QORA 4AKGA 3AP1A 3NWJA 1XMIA 2P65A 3D8BA 3QKRB 1ZBDA 521PA 4DBLC 3MFYA 3U7HB 1ZU5A 4TZ6A 1VHTA 1KI3A 2GRJA 2R44A 1LTQA 2GXUA 1EWQA 1NBME 4KYUA 3R7WB 2VF7A 2ATXA 1Q1QA 2ZR0A 3U4QA 4HLUC 4WW0A 4B3FX 1XEWY 1Z0DA 4CEHA 3T06B 5CB8A 2LWIA 3WNDA 1E2IA 3BOSA 1V5WA 1KI8A 1XCGB 3C5HA 1TF7A 2F6RA 1Z07A 2D2FA 1SKQA 1P9NA 4KSBA 3REGA 1G9XA 1UAAA 1MO5A 1VYUA 5FTLA 3TVDA 4A2WA 2JJ1A 2IS6A 3KQUA 3U44B 5L3RA 4Q66C 2WAYA 3ZZUA 4DWJA 1RC8A 3T5GA 2A78A 3CLVA 4KLNA 2C03A 4A8JC 1XNJA 3WBKA 3I8SA 2EQBA 2ORWA 2R2AA 2REXB 3W6PA 3W5IA 4C0BA 3EA0A 4D0LB 4JKYA 1T8TA 2HJGA 1QVRA 4XVQA 4ACBA 2RHMA 4PC6A 4C2TA 2AD1A 5FPYA 2A5FA 2ZE5A 3I4LA 3ZS8A 2C96A 2IYVA 1XEXB 2ORVA 2VO1A 3T61A 3TQFA 3X1ZA 2ZR7A 3NH6A 2HLDD 5FBQB 821PA 3PV0A 5IK2D 5JEDA 3K70D 3K9GA 4TQUS 4AYWA 4GRAA 1S4QA 2QU8A 4RKFA 3AVWA 3FB4A 2A5DA 4JJKA 5GADl 3EZ7A 4MKFA 2Q0HA 4NE2A 3DL0A 3G5UA 1GVNB 3Q5DA 1N3BA 5LBIA 5KDDA 2GDJA 1U99A 2NZ8A 4Q1BA 3K53A 3KB1A 3AKCA 2O8EA 4HAXA 2LKDA 3KKMA 4JYCA 4Y0AA 3RAPR 1N5JA 2IHBA 2OAP1 4PQRA 1T3SA 3JZAA 3Q85A 1NLYA 4RD2A 3CF6R 3FMIA 4M9ZA 4Q4HB 2UVQA 5TXGA 2PZEA 3RS7A 2W83A 2IYQA 4NYIQ 3VFDA 2HT1A 4IDNA 2KE5A 1R8SA 4NCHA 4Q9LA 5EXTA 1GKUB 4MYTA 4DLVA 2JLRA 4UXJA 5EP3A 1Q3TA 5F2EA 4F4CA 3AVXA 1ESNA 1SXJA 1N6LA 5JI2E 1XTKA 5EP4A 4LJ8A 2PT5A 4Q1AA 2OHFA 4AIIA 1IN7A 4LV5B 4D2IA 3EZ9A 3IHWA 4GOJA 1RJ9A 1N6NA 2ZIAA 1DAFA 1OHHD 4DLRA 2IYSA 2ZRJA 2GF9A 3A1WA 3TSZA 1W47A 1LS6A 4V02A 2QPOA 4UJ3A 2YOGA 3B13B 1RRGA 2CCGA 2GK7A 3K0FA 3SR0A 3LX5A 1KNQA 1G7TA 2RKOA 3KJIA 4QJ5A 2ZJYA 1SVIA 2VP6A 2GZAA 1H8HA 3BK7A 4JS0A 2PZFA 2UKDA 5HE9A 3CPHA 2D7CA 4MRSA 1Z0FA 4NKRA 4P32A 2AKAB 2ZS8A 3KJHA 1CLUA 3VR2A 4BLRA 2XZOA 1II8A 5DYGA 3FHCB 1NMZA 1T5IA 4Z1MA 4GOXA 2IYLD 4M2LA 1DAMA 3FPAA 5K8IA 3K9NA 5G3YA 4LRWA 4FWTA 5A5GA 4PANA 2YVUA 5LB4A 1G8PA 2WJGA 3GLFB 4EIWA 1J8YF 1UM8A 2GBLA 4O25A 3RVBA 4MRRA 4TMWA 2X2EA 3UMFA 3GCGA 5JEEA 3ECCA 2IEYA 3WRXC 1XEFA 1ZW6A 4BE7B 3IPYA 3V4FA 4M9XA 4P4SA 1AZSC 4IEEA 1HQCA 2AFIE 2OM2A 1RZ3A 3BH6A 4Q01A 3U2QA 3H0KA 4HZUB 3MG9A 5L8VA 4HB0A 3GLIB 1WB9A 1HTWA 2WWWA 3ZVMA 3NH9A 1TTTA 2RAPA 2REOA 4DKXA 1NIPA 1Z5ZA 4I1UA 1LW7A 1NVVR 1ZMXA 2QNRA 1X3SA 4M9QA 2O8FB 1HT1E 4HAZA 4DC9A 1KI7A 2WVJA 4JBWA 2CK3A 1R4AA 2DWPA 3P20A 4IFEA 4PAMA 1TU4A 2R6DA 3RS3A 1KSHA 3WMFA 1NSTA 3QF4A 2ZE8A 1FFHA 1L7VC 2JJ1D 1IN6A 1XMSA 1GIAA 1SXJC 2ZSEA 2JATA 4TMTA 5AWFC 1KO8A 2ZI5A 4BRUA 1OJLA 3IO3A 4FMDB 4OK5A 3D3QA 1CIPA 4C7OB 3QEOA 4ILEA 4B35A 2QG6A 1XF9A 2YOFA 2J7PA 2VHTA 1Z0KA 2CVFA 5EUQB 3LVQE 5EXPA 4WVFA 2MSCB 1BKDR 4LOAA 3W6OA 4IVRA 4RZ3A 2FEMA 3ZZTA 4D80A 3WYFA 2GXAA 1G7SA 2VSOA 2C9YA 3HYRA 2ZJ5A 5EE3A 1Y63A 4Q4AA 1YZQA 5AUOB 1VHLA 3I3SR 4LJ4A 5CYPA 4F92B 3GQBA 3DHWC 1AKEA 1ZU4A 4ZCIA 1P75A 1XD9A 4Q9JA 2C99A 4Q19A 1E9SA 3KXKA 1FX0A 1UKZA 1NI3A 3HR7A 5KYKA 1VMAA 2EFHB 3BGWA 1L2TA 3GLGA 1A2BA 2OBNA 4L16A 5EXSA 1XU4A 3PUVA 3BH7A 4NONA 1RRFA 1ZD8A 1PJRA 2GBLC 3L0SA 5BN4A 2XNDA 4GOKA 4CRWB 1ZM2A 4QJ4A 3C16C 4EJSB 1W0JA 2V8OA 2XTZA 3IILA 4YMVA 2ZRFA 3L0PA 4M1MA 4AI6A 3EA5A 1CKEA 1I4LD 4JLMA 3AF4A 3IKJA 3QPUA 2BC9A 4JLJA 1OH8A 4AKIA 4U00A 1CR0A 1KYIA 3EC1A 3PUYA 4LSGA 3TW4A 4TYNA 3OZXA 3WRYC 4ZIRB 1E6CA 3GLHE 3EZFA 4GSYA 3CBQA 1OIWA 3AF1A 3THXB 2FH5B 2C77A 1Z28A 2QE7A 4WZAE 1J90A 3U3OA 1F5NA 3UKDA 1Z63A 4TQ9A 2GCPA 4Q21A 3UATA 4BWYA 3BORA 4HZIA 4DSNA 1FTSA 1DO0A 2KJQA 2O5VA 2RGEA 4PPQA 2ZRGA 5EP1A 1P2VA 2ODNA 3NHBA 4D81A 1GAJA 3BBPA 1AQUA 1E2HA 1FOEB 1KNXA 3LV8A 1JB1A 2DB3A 1N2CE 4Q00A 2PMDA 4JKIA 1WXQA 5FOVA 3AB3A 2W00A 1NMYA 3AGPA 3GFOA 2FSGA 1CR2A 1TUEA 2OFWA 5KHOC 2X2FA 1QHYA 3EZ2A 4GFDA 4TZ0A 3IQXA 2QEQA 1YZLA 3M1IA 5GJCA 4URUR 2WWYA 1H8HD 3SJBA 4YMUA 3THYB 4XWOA 3KJEA 3LH5A 2ZETA 1IONA 4CYMA 1F2UB 2WWGA 1EX7A 2G1KA 4X8LA 3TR5A 1HV8A 1NN5A 1W48A 3QG1A 1X1RA 4Z1MD 4G5GA 1OFUX 1XTQA 1K8RA 1Z6XA 1U9IC 1EG7A 4MUAA 4KO8A 2YC4C 4PSVA 3CF0A 3K0AB 3QPVA 4A92A 2ZUBA 5A4JA 1LFDB 4A6XA 4DDTA 5FOUA 1MOZA 2B7CA 1W36B 5EE5B 4OHXA 5SZIA 4TSFD 4D6PA 1OXTA 4A0HA 1AS0A 2XB4A 3OESA 3LBHA 3BFVA 1S1CA 1KAGA 4HYYA 1Z06A 3H4MA 2X77A 4QHTA 2FZ4A 1ZIPA 2HEIA 2GCNA 2O0JA 4LCBA 3GJ7A 1OYYA 4JL5A 4IOLA 4PHTA 5C4GB 2WOOA 3T34A 5B2ZA 2K5UA 2QRZA 4QBIA 1OPXA 3VKWA 4C0AC 4ARZA 1FNMA 2WIBA 1HUQA 2HUPA 3WP1B 2WICA 4OI4A 4TYPA 4ZDKA 3QIAA 4I99A 3QXXA 4LJAA 1X86B 1XXHB 2OCPA 4UKDA 2PEZA 2N46A 5TARA 2XB2A 1H8EA 3KTAB 2BKUA 3ZH9B 2CMKA 2DWOA 4DEXA 3BERA 4HLCA 3X2SA 1Z22A 2OE2A 1AGPA 4I1VA 1A1VA 4LWZA 4M0LA 2JDIA 3GJ5A 3NXSA 1IY2A 4EFNA 2VIIA 1XPRA 2ERYA 4LYJA 3BB3A 4BEBA 4ESVA 3UMRA 4CZ2A 4Q03A 5KDOA 4QGAA 1EFRA 1G4AE 3Q3JB 4HB4A 1W1WA 4AURA 4BLQA 2IS4A 1D2EA 1FUKA 4MA4A 4TYQA 1HA3A 3LWNA 3PEUA 2GVDC 4F93B 1T4GA 3QQ5A 4KU4A 4JLKA 2D62A 2F43A 1ZD1A 5HKKA 2ONKA 4DCUA 3SHWA 3BIFA 2Q3MA 2B7BA 2BEKA 4JYBA 2Z0MA 3W90A 2QAJA 1GL6A 5J40A 4QGHA 3SN6A 4JVSB 5L3VA 1W46A 4G1UC 1G21E 3LX8A 2ZYTX 3QE0A 2B8WA 2MMGA 3RS2A 5EP2A 2XNDD 5DN6A 4DDUA 4GPTA 2VF8A 1Z6GA 4MITA 1YRAA 1O3YA 2JA1A 2QT0A 4TMKA 3MJRA 5IDVA 3DEFA 5G40A 3PJRA 121PA 3DOEA 2ZJOA 1FMJA 1NBMD 2AK2A 3HU1A 4FMCF 3R8FA 4GZLA 5CM8B 3LO5A 3FKSA 4KAXA 4WZ6A 2IYYA 2KWIA 2RB4A 4UNPA 1AS2A 4W5HA 1G3RA 3H86A 1DG1G 3B7GA 2E9SA 3ZDQA 2QUZA 3SC3A 3SEAA 1GL7A 1E2NA 3EASA 2I1VB 4E22A 1R0YA 1XCPA 2QE7D 3V00A 1E2GA 3QVVA 4W9MC 5TY0A 1Q20A 4TYWA 1GRQA 4IDHA 1T3LA 2V1UA 4PZYA 1ANKA 2ZRLA 2F3TA 5DIFA 1KMHB 1F60A 3KKQA 2G3YA 3CX7A 4EQ6B 4QBFA 2G1JA 1HYQA 4POAA 4A0GA 1UKEA 4K81B 4D4KA 2CL0X 3AQ4A 621PA 1E1RD 2KBEA 1W44A 4BLTA 3SJAA 1DAGA 1EGAA 1VCOA 2J87A 1TPZA 1GRRA 2J0QA 5GVSA 1GNPA 2KBFA 1N5LA 3QG5A 4RZ2A 1J99A 3C5CA 2VP9A 3CNOA 4AWXA 2NO1A 4QRHA 1XJCA 2W0SA 5FOXA 1Q57A 2BMDA 3BFKA 2XGJA 4Q5IA 5FPHA 2ZUDA 1ONBA 4JLDA 3ND8A 4PC2A 2GCOB 2WWXA 2PT7A 4UJ5A 2VEDA 4A36A 4FCWA 2OG2A 1QVAA 1W4AA 5FTJA 4YMWA 1G3MA 3IEUA 4DSOA 1E3MA 2IYUA 5KUTA 3ND9A 1KO4A 3LVRE 1KDTA 2WMOB 2O8BA 1OYWA 3R9WA 1K5GA 2JIZD 1KI1A 3AP3A 4M8NE 2WJVA 1P2UA 3RSOA 2GWHA 1CJVC 721PA 4AYTA 4L5BA 3QXJA 4UXHA 2QT1A 3M6AA 4UNNA 4CEJB 4BGDA 5D3MB 1G3UA 2FFHA 3HDTA 3LXRA 3NVAA 1NG1A 2D74A 4V0MA 3GLHA 5JCPA 2UZIR 2D28C 2HLDA 1G18A 5IK2A 2QSYA 3VU9B 4UNSA 1MABA 1U0LA 1NMXA 5E3HA 2RHDA 4JLVA 4NDZA 3KKNA 3EAQA 1YVDA 4PTLA 3DZDA 1H8ED 1P73A 1S96A 1BOFA 1E9CA 1X1SA 2GKSA 1ETUA 3B5JA 1T6NA 3IIJA 2Z5FA 2IXEA 3K8YA 2JDID 2NO7A 5CLQA 5K8UA 2C04A 1N0WA 3NEYA 2GJ8A 2MMCA 2PBRA 3ZZ0A 1G6HA 1ZUNB 1VG8A 2A5YB 2J0UB 4FINA 4EPWA 1CRPA 1EFRD 5EJEA 4Q7MB 2H92A 3NBZC 4TT3A 1Z2CA 4TMXA 3HYTA 5EUMA 2F3RA 2X8AA 3GLFE 2HV8A 2E87A 3RSLA 5HKKD 3BRWD 1XFAA 3B1YA 3O47A 1XWIA 4LBZA 3QSYA 1L8QA 2SHKA 2F1RA 3IDQA 2ZJBA 1FZQA 2GEUA 4QL3A 4A8JB 4DDWA 1WBDA 4DEYA 1M34E 5TB5A 3T12A 221PA 3L82B 3X1YA 3TUZC 5FPTA 1CULC 3CR7A 1OHHA 1C9KA 4MUBA 1OXXK 2ZJZA 3PENA 5GJWC 4XVUA 1U8AA 3CH4B 5TMPA 1PVOA 4MRPA 1R7RA 2Q21A 3J81k 2WBLC 3KX2A 5HE8A 3TR0A 4RZXA 5CK5A 4XIGS 5DN6D 4AYXA 1KIMA 4JIMA 4M1WA 5CJ2A 1G20E 1F6BA 1Q1BA 1QF9A 1NN3A 3CM0A 3KJGA 2CLSA 5SZHB 3NBYC 2X19A 1NY6A 4JBYA 3T1OA 1QRAA 4M21A 4HAWA 4BZXA 4MGZR 2NO9A 5EXXA 5HCNA 3RS4A 1CEEA 2CNWA 3D7MA 4Q02A 5DISB 1E69A 2ERXA 1EWRA 4Q7KA 4QNRA 1E0SA 1Z0IA 4PO9A 4FN5A 4B32A 2I3BA 4MRNA 2FSHA 3K70C 1QHHB 1EX6A 2ZU6A 1WF3A 3RRZA 3I61A 1S1MA 1LF5A 2QPAA 2LKCA 4MYHA 2FU5C 2JLUA 4WXPA 1P6XA 1GM5A 2OSBA 1LNZA 5F98A 2J3EA 4NYJQ 4HDQB 3U3RA 4QXAA 2I4IA 4A15A 4A2PA 4DLXA 5IRCD 3I1FA 1OH7A 1DAKA 4TLDA 2QSZA 3T1VA 2IW3A 5IF9A 2VQSA 3W3ZB 4PSAA 2VSXA 4D0NA 1TQ4A 1SHKA 2F9LA 4D4LA 4V0NA 1Z2AA 4XSGA 3BFXA 3ADDA 2ZRIA 1VIAA 2A5GA 3NBFA 4B6EA 4E03A 2WIAA 2P6UA 4IDOA 4Q7JB 1KJYA 2Q9CA 2JJ2D 4B2LA 1G6OA 1IN4A 1ZC3A 4AY2A 2ZM5A 3KQLA 1S9DA 3CWQA 2A5JA 4B3XA 1IXSB 1KK3A 5KSPA 2QTFA 4D25A 3QKRA 2W2XA 4L8GA 1Z6TA 1DADA 5GJBA 2IWHA 1KDPA 2J45A 3KUDA 5HTKA 1XZQA 2ZJ8A 1TNDA 2KSQA 4URWR 2BKEA 1GKYA 5DI9A 2Z43A 2XJ9A 3VX3A 2R9VA 1OXUA 5JJLA 2ZJAA 4B2PA 2YZ2A 3RRNA 3L0OA 4YLGA 3L2OB 5KTYA 4TMVA 4NTZA 4PPFA 1R0ZA 2ECKA 4DZZA 2IXGA 5FBVB 4JMPA 1ZM3A 4OI1A 5DNYB 2QN6A 4US0R 1ZVQA 4YXWA 3S1AB 4WIAA 1VCMA 1CP2A 3GFTA 1CJKC 2V9PA 421PA 4C0HA 4DT1B 3U44A 1LY1A 3T35A 5BN3A 4PC7A 5AJWA 4ZDWA 1G7CA 1IBRA 1U8YA 2GTPA 2O52A 2D2EA 2QAGA 3BC1A 4LV8B 4RCZA 5FL3A 1E9DA 1MR3F 3N70A 5CDFA 4TWZA 3K09C 2BBOA 2V1XA 4NYMR 4TLCA 3PUXA 2Q9AA 4LYHA 1KAOA 1T91A 4Q1DA 3X1DA 2NPFA 4HUQB 4G0NA 4NBSA 3NEJA 3T5DA 2H8KA 5CIQA 5JCZA 4E07A 2J0VA 1W4CA 2O0KA 2NTYC 2CHVA 1XEXA 4OQFA 3SHFA 3CRMA 1CS4C 5HZKA 1K5DA 4TT3D 2VLIA 3NG1A 2YC2C 5DLQC 3U3KA 4LV6A 1BH2A 2XX3A 3LY5A 1CRQA 3FVQA 4Y0VA 4TN1A 4BLPA 1X8KA 2GNOA 5J47A 4LYFA 4QBGB 4S2EA 3FYHA 4OL0A 3TIFA 2HJVA 3U7GA 4OQXA 1SXJB 3W8RA 3CONA 3DZ8A 3FKQA 4NL4H 2V6IA 2J1LA 2G77B 4KODA 4D0GA 5JRJA 2X1VA 3C41J 1QZXA 2IUSA 4GNKA 3SFZA 1G19A 4QOSA 2PJRA 4G3XA 4QM6A 2FPKA 1KJWA 3OEEA 2CCJA 4Q4HA 1FP7A 4I4LA 4JT2A 4F7WA 2ZI6A 1OW3B 4XD7A 3EC2A 1OH5A 4LHZA 1WP9A 4L9WA 4TLAA 1E2FA 4WA7A 2ZI3A 4IRUB 1QHIA 2OEPA 2DR3A 1US8B 2W2VA 2AXNA 2WKQA 3QBTA 3CRQA 4GZMA 2A3RA 4LBYA 3MJHA 1EFUA 2R6CA 4P33A 4BLSA 3TVTA 4ABYA 1XXHE 4PPNA 3A1SA 3CZPA 5AUQA 3SFVA 3RS5A 5FH9A 2CNWD 1D2NA 2BEJA 1II8B 1UEIA 2I1QA 3HPRA 3L0IB 3A37A 1NJGA 4IDPA 1D2MA 1M2OB 5E7JA 5CM9C 5CB6A 2VPPA 3A4LA 3HWSA 4QJ3A 1DO2A 3RYTC 1LV7A 2ZVQX 3L43A 1OFIA 4DHEA 1R2QA 2QAGC 2GEVA 1R5BA 1TQ2A 4W5WA 1P9RA 2FGKA 4RD3A 1JPJA 2FPMA 4TSFA 4DCVA 2JLWA 2OXCA 3GJ4A 4XWAA 2BJWA 1Q12A 1VG9B 2OLJA 3EW9A 5TV2A 4JL6A 2WTUA 1B23P 4MH0R 4EPVA 4DDVA 1Z0AA 1XBTA 3VR5A 1R10A 4ZO4A 1DOAA 5AJYA 5C1BA 3PG5A 4XSHA 4JLAA 6Q21A 4OI0A 1ZNXA 5IT5A 4JLBA 2AR7A 2YJTD 5JRZA 3F8TA 1YZGA 5L3SB 1W4BA 1YZKA 4OJQA 5J4LA 3GLFA 3QENA 4QC2A 3WXMA 1KMQA 1R5OA 3LRPA 3O8BA 2GJKA 2IXFA 4CF7A 4PHGA 1N5KA 5AJXA 3UWOA 4PSKA 1WCV1 5A0FA 1NVVQ 2QA5A 2BMEA 2AHOA 2IX3A 2QQ0A 2JJ8A 2PLRA 4KXFB 4O0MA 1G8HA 1Q1ZA 4URYR 3TAHA 1TF5A 4HZUA 2GA8A 1ZM7A 4CEIB 1CJMA 1NY5A 3GLIA 1OV4A 3CF2A 1Q21A 3TUIC 2R8RA 3MGCA 3FHOA 3LFUA 1G4UR 1J8MF 4R7ZA 3TRFA 2O8FA 1PZNA 2QY9A 1G5RA 1GUAA 4B48A 1VTKA 2YINC 3TMKA 1P5ZB 2OBLA 4YDHB 3SNHA 2EWWA 1DARA 1G41A 4AD8A 1UBEA 2EYQA 3GJ6A 1E9FA 2JLQA 2RH5A 1W5SA 4MKGA 2W0MA 4Q4AB 4PAOA 3TH5A 2YNMA 1XTIA 1M1YE 2NG1A 3SQXA 4YXWD 4B3BA 4LJ7A 2ZRMA 2ODWA 1OXSC 1E4VA 2OFOA 2O8DA 5BW8A 2C78A 4XJXA 4DB4A 4DCTA 2G0TA 1BO6A 1FX0B 4TTRA 1ZUIA 4F38A 3VR6A 3X1XA 5HR5A 4C7OA 4FIDA 4P4UA 1IN5A 1IXZA 1N0VC 2IYWA 2JEOA 2LCFA 4FWIB 4I1SA 4X8MA 2J0SA 5B30A 1XD8A 4OQMA 1VDZA 1E4YA 4JVNA 2ODBA 1JJVA 1M6NA 1W49A 1MV5A 3VNVA 2DY1A 4FMBB 1NF3A 2O8CA 1AQYA 3OHMA 4H1UA 2H16A 3UG7A 4K8OA 3CX6A 1IAQA 2ZAOA 3MUFA 3HU3A 5B58C 1NBMA 4YMSA 1N5IA 2OILA 4EPYA 3UWKA 3R9XA 1NJFA 4LX0A 2QBYB 3EIEA 2QROA 3QXHA 1N0UA 1CJUC 2NO0A 3SU8A 3VKHA 1XTRA 3NBXX 1ODFA 1II9A 4RD6A 3W5JA 3CH5A 3THWB 3QUSA 4FMDF 3EZ6A 2N1BA 3EPJA 2XXAA 4PPGA 2ZPTX 4LDJA 4BFZA 2RGXA 4EJSA 1EK0A 2V7QD 3Q7QA 2GILA 4OKSA 2P6NA 4A6PA 3GEEA 1YHNA 4BPBA 3OEED 1GTVA 4JLPA 3CR8A 4KJZA 2XSZA 4QKQA 4UXIA 3E1SA 5BQ5A 4TYYA 4F91B 4XD7D 2A7QA 4L4UA 2CCKA 1SVLA 3K0EA 1OB2A 3ZD7A 2G9NA 1IXRC 1IY1A 4ZIRA 1E1RA 3PITA 5HZHA 3ICEA 1RIFA 5E7MA 1KK0A 3THXA 3TNFA 4QBHA 4PFSA 5AJVB 4RFSB 2B92A 4C4PA 3VX4A 1M8PA 1OF1A 2BM1A 4LBWA 2R6GA 1ZINA 4N1AA 1G8YA 1YZNA 3IQWA 4LK2A 3WMEA 3A6PC 4GL2A 3AH8A 2CL6X 3N2EA 4RJLA 4HDCA 4Z8XA 1U81A 4HUTA 2NQ2C 4N0EA 1ZM9A 1KJZA 2C98A 1J2JA 2ZSAA 2GVZC 2QMHA 5IHPA 1DTSA 4BFTA 5FUVA 3D31A 1XZPA 4LBVA 1W0KD 1GRNA 2FGJA 3VKGA 1SULA 1ZAKA 2VTKA 1A4RA 1YR8A 2GXQA 2JIZA 3CWZA 3MWYW 2G88A 1I4TD 5TVKA 4DUGD 3MAAC 4B3CA 1KSJA 2FFQA 5JMTA 1NL3A 1KKMA 1CJTC 1NLFA 2AD5A 4BFVA 1F2UA 1NP6A 5FBLB 5DO9A 4DLSA 1AM4D 1MH1A 3QI2A 3FOZA 4DSUA 4KVAA 4MYCA 3CPJB 3T1TA 2JLSA 4KLZA 5FR2A 1T3HA 1SVMA 3VR4A 3HP1A 5FPKA 5KNDA 2VP0A 4ARZB 4QG7A 2ONJA 3U61B 2BVNA 3AKEA 1D8TA 3QBVA 2B8TA 3SJZA 4URXR 4M1KA 4MRVA 3VTKA 1G3QA 4BFYA 1E2LA 3I5YA 2CHGA 2VHQA 1GWNA 1ESMA 2BV3A 2PX3A 3KUCA 4HEJA 2FN4A 2IYZA 2AKYA 4R9UC 3WNCA 5JECA 4B47A 4ASUA 1P9WA 4ZI3A 3IBYA 3C4JA 3Q72A 1KI4A 2FPLA 3EIHA 3RWOA 4DLWA 4LHVA 1D9ZA 5LDDC 1X6VA 1RW4A 4Q48A 4HDOB 3QOFA 4ZKEA 3UIEA 1Q44A 4HAYA 3SYKA 4D82A 2OT3B 1OE0A 4PQFA 1NKSA 4LGMA 1PLKA 2ATVA 3OF5A 4MYUA 3WHLA 5BN5A 1DE0A 2AN9A 3OAAA 5TDHA 4X8HA 1ZRHA 3L8YA 2QRNA 1XXHA 1ZM4A 5JSZA 5KOYA 1YRBA 1JAHA 5KNCA 3ADBA 3KTAA 1G8GA 3QKSB 1F2TB 1ZJ6A 3VHLB 1A5TA 2CDNA 4RFVA 4V0KA 5B64A 3FTQA 2HCBA 5P21A 3R9IA 3MSXA 3TSWA 5KSOA 2D06A 4HLDA 3RDPA 5J4YA 4PC1A 1W4RA 2QMOA 5AUPB 5LD2C 4PXAA 4MKIA 2WJIA 4A82A 1OB5A 2FV8A 5KSYA 3UPUA 1E2JA 1C4OA 3ADCA 1EXMA 4KYIB 2W6JD 2RGNA 1II0A 2HDNB 1FNNA 2ZUCA 3GEIA 3MRSA 4W7SA 4TMZA 1FUUA 3H1TA 2HXYA 4E5UA 3QF7A 4NCKA 3FWYA 3VR3A 1W2GA 4MGYR 1XCMA 2J46A 3MWKA 1COWA 1YR7A 3ADKA 4XOIA 3RC3A 2WKPA 1KZ7B 2FZLA 4OYHA 1LVGA 2IL1A 4KFUA 2C9OA 4FCTA 1DS6A 2CXXA 2PZGA 2JLXA 1A82A 1QG2A 1E98A 4URVR 2NIPA 1QHGA 2AX4A 3K0CA 4C0LA 5BYJA 2JAQA 2P2LA 2PCLA 2XTNA 3CIOA 3OFND 1CR4A 4GT1A 1UDXA 1RRPA 1P4SA 1Z08A 2ZQ5A 2Q3HA 2D7DA 3PEWA 1TL7C 2OBMA 3KDSE 3CRRA 2AK3A 4NP6A 3SJCA 2OUKA 2QP4A 1FW6A 1P3JA 2XSZD 1M7HA 3E5HA 1RFLA 4ZDJA 1DAHA 5J5CA 1SVSA 4V0OA 3U7EB 5LPNA 5GJVC 1G1MA 1TU3A 4Q9IA 1KK1A 1ZCBA 5L3QB 2EVWX 4DCSA 2XTMA 2Z83A 2GZHA 2VP2A 3UANA 2VBCA 1SZPA 5JWRA 1BYUA 1IHUA 1KY2A 2J9RA 2YV5A 2JJ2A 1F48A 1X8LA 2E1RA 3AF3A 2DWQA 2QTHA 3ZQ6A 3LBIA 2R65A 4UNQA 1KDRA 1KHTA 2ZRNA 3ZGXA 2WSSD 3B1XA 1AS3A 3B78A 2V6JA 3A4NA 4B3DA 1KMHA 1WE2A 1JALA 4XWKA 2DCUA 4L15A 3RLFA 1N6IA 5JS8A 4Q1FA 3TUJC 1IM2A 1EFCA 1XTSA 3PUWA 4EQ6A 1E2EA 2CVHA 2ZI7A 2O8BB 5J4KA 2P67A 4U02A 2ASEA 1EESA 5FL7D 1JXMA 2ZSFA 2CJWA 4KFTA 1ZNWA 2H7VA 2ZSDA 4TL6A 3THOA 3DVLA 3IIKA 4BFXA 2ZREA 2F9MA 4NMMA 3DM5A 4IXMA 3F0TA 4JJZA 1J70A 2HF9A 3LXXA 4BZQA 1JEDA 1XDBA 3JZMA 4BECA 2GCOA 3O8RA 4R71A 1SXJE 5FOSA 2ZYVX 1E2QA 3K70B 4B74A 3GPLA 1XPUA 1OLOA 5F9FA 5FTMA 1W36D 4IHQA 4M1YA 1IY0A 1ZC4A 3K9LA 4TL9A 2CE2X 3V4RA 4JSTA 4JSYA 1ZNYA 3O8DA 2QQEA 1JR3E 2ZRBA 4HLQB 1ZP6A 5G53C 4WAUA 4M22A 4NPHA 4ASUD 1Q0UA 3R20A 2IHYA 3M0EA 2G0NA 2O0HA 5DGXA 2EFGA 4R2IA 4M1SA 3TKLA 2FDCA 1KI6B 3ETLA 2HYDA 2IYRA 2ZRKA 1UJ2A 2FMXA 3C15C 5D3MA 4CEJA 4PX9A 1S3SA 2P6RA 1N6RA 3E70C 4NCNA 2ZS7A 4IW3B 5DI3B 3A1UA 3DKPA 4ZPXA 4B3GA 4Q9KA 1Q22A 4KFSA 1Z8FA 2PMKA 1M74A 3T1QA 2CEAA 3VU9A 1XP8A 5JWOA 3OAAD 3I32A 3EWAA 1MRSA 1FPMA 2R62A 2FWRA 3ZVLA 3VHXA 5E4FA 1FTNA 3GP8A 3IEVA 3GEHA 1ELOA 1GNRA 1MT0A 3SBDA 2KB0A 5JZVA 2IT1A 2V3CC 1NRJB 3WHKA 5DSZA 3AF0A 1U98A 4C0QC 2WJHA 4N3NA 1WMSA 4E09A 5BWMA 1ZUHA 1AZTA 3UG6A 2JCSA 5G3ZA 4GP7A 4EFLA 5JHHB 1XJQA 4LUCA 1BYIA 1LF0A 3CO5A 4HLUA 1TEXA 2BDTA 1MO4A 4NU0A 1V43A 1AJEA 4PHHA 1E94E 3MWJA 4LHYA 3QKTA 1E99A 3EX7C 3OIUA 2ZE7A 3LBNA 3IHLA 1XD2B 4PAQA 1P61B 5KSZA 2GETA 1JPNA 1M7GA 3PR1A 4TLBA 1CU1A 1COWD 3FMPB 1D6JA 1PLLA 2BBWA 4OHWA 1CBUA 3KQHA 2OXRA 1U94A 1E9BA 1JNYA 1VCIA 3KQKA 3EPKA 3B85A 2PJZA 2ZSBA 3BXZA 4ITRC 5HCIA 1U2RA 3A1TA 4Q4JB 3AKDA 5KO2A 1FMLA 3WP0A 1EFHA 1UFQA 2YHSA 1AA9A 3V9PA 3EXAA 3P26A 4HB3A 1HQYE 3C14C 3JVUA 2WJJA 1T9HA 4LJ5A 4ACAA 4B76A 1E1QD 4YC7A 3KZ1E 5GVRA 3U3JA 2W6ID 1XMVA 2RGDA 3H84A 2P5SA 2CBZA 3Q7PA 2XJ4A 2BCJQ 2ZROA
chains in the Genus database with same CATH superfamily
2BJVA 3E7FA 1JEYB 2FWNA 2N42A 5LL6P 1L8LA 3HPQA 3GJ8A 5DZSA 3FYUC 1I3MA 1CZRA 2R6FA 2FSVA 1HURA 1WB4A 3B38A 3FZNA 5SICE 4FS3A 1E0DA 3ZNQA 5B7GA 1U8ZA 1IBSA 2YIVX 2X5XA 3O4JA 2H8GA 3FUVA 3KLNA 3OTOC 3S4YA 4BCDA 4GKKC 1VE5A 3PE3A 4RDXA 1KARA 3UJ9A 8OHMA 4GMHA 2WU0A 4PO3X 1GNTA 1DRJA 5F12A 1S3GA 1OZAA 2C2WA 2HMAA 5EJ7A 1WMAA 2CMHA 1J4AA 2J7KA 3CUEA 2PUWA 2BIFA 1K6MA 1L5ZA 2G09A 1MY8A 2A7XA 3AUXA 1TRKA 2GZDA 2RSLA 3HDGA 1HORA 4YJ2A 1XEWX 3HJUA 1T19A 1F5SA 5IP5A 2QTAA 5B4TA 3ZD8A 1T1RA 1XRJA 3FPVA 1MW9X 4HDKA 3FHLA 4M53A 1XJ5A 5JD6A 4WJZA 2OP1A 4HTFA 2EXAA 1N6PA 3KFVA 4RHUA 3QI7A 3P2IA 4W5RA 5EVIA 3L07A 4DLZA 2DFLA 1BFDA 4N0PA 3CRVA 4WMCA 3F5FA 2WHEA 4DR6B 1BWPA 3BD9A 1V11A 4B4VA 2Y1EA 3BZBA 3WNBA 1FUIA 4MHOA 2R6JA 1E2MA 4H1TA 4DIEA 3MAGA 2AXPA 2A9PA 4X65B 1GSXA 3AIOA 1M34A 4BL5A 3HJNA 2ZU0C 5D3OA 2WLSA 4BVFA 3S3TA 2E4AA 4NWIA 3CB4A 4LXGA 4J1SA 4V0SA 4BVAA 5TMBA 1PNRA 2VHUA 3ZIUA 2NCLA 1EWTA 4OJYA 4IOJA 2HPVA 5C4MA 2BMFA 4UEYA 3TLJA 4ER6A 1SY7A 3L4SO 1DKUA 1PEDA 3B1VA 4ZZ0A 1TA0A 5DBEX 1M6HA 3ROTA 1UMDB 2VV6A 1JQLB 4CF5A 3GWGA 3A9WA 1EJ6A 1I7LA 2J80A 4U5QA 3DLAA 2AA3A 4GMDA 5G4ZA 3RK4A 2Y4NA 1SVNA 1YRYE 4LQLA 2Y2JA 4A03A 2RMKA 1XJ6A 4Z8YA 5AKLA 3H3JA 3IAFA 3RVDA 2FA9A 1EHIA 4WRRA 4BRSA 1NQ5A 3I12A 1P60A 4YAWA 4N9QA 4KYTA 3JWGA 2JI6A 1WM1A 2UV8A 3O6VA 2K2QB 5F1GA 1I6MA 3AR2A 1VPEA 1QJCA 3UK0A 1ZXLA 2WIDA 4JQYA 4G01B 1P2BA 1R5NA 4PHFA 5KYWA 1HH4A 4ZK6A 1GITA 1OKKD 3IVRA 1JQEA 4MB2A 4HH0A 1KQPA 1QVWA 4Y98A 1FEZA 3IQFA 3CT6A 1MKMA 3OUUA 4OTZA 4LZJA 1NVWQ 4O3MA 4C3ZA 1R9GA 3CLRC 1W5TA 1O07A 3FD8A 2Z4RA 4EJSC 4BQSA 4L7QA 3NT4A 4ZQBA 3SYTA 3EVDA 4MI9A 5FI6A 1JSXA 4EI2A 2IEIA 4DCMA 1H4QA 2G5GX 2C1EA 2C4KA 4DV0B 1GPJA 3PA8A 3WJ7A 4BC7A 1ACFA 3QNWA 1DHRA 5H68A 1XA3A 3LZ6A 1Y1RA 1MO6A 4ERNA 4X7MA 3BFDA 4LYDA 4KENB 1KKLA 3DZHA 3BMCB 2UWXA 2P9GA 1QSGA 1ERMA 3NDRA 4EQIA 3ECSA 2BEWA 4O5OA 3DC2A 2WYWA 1YE8A 4BMDA 1I2DA 2BCGY 2MSEB 1TYEB 4DNQA 1IWPB 4MVXA 4MGKR 1W0JD 4K6GA 1CE8A 4DUPA 3D3JA 3MB5A 5BN1A 3O2QB 1ZJ5A 3TE6A 1KEPA 2X22A 2DBYA 1GUFA 3FFXA 4CR8A 2FN3A 2AEEA 4HEA6 1YHYA 5M7EA 1LSSA 2HRDA 4BBUA 5SV2A 2RK4A 5KDLA 4QOJA 3BA6A 5F51A 1MBLA 2RK6A 4HWRA 4ON9A 3JQBC 2C4VA 5AVUA 4JLOA 1DG3A 2IZ0A 4GBMA 1OU0A 1DP4A 1E5DA 3OFKA 3G82C 4R41A 2BISA 5E95A 5EZ6B 3MJDA 1O6FA 2PLWA 3V9AA 3OCCA 1C3EA 2I4LA 3SK0A 3CEHA 1PI3A 5CLJA 3ILVA 1T36B 4HYEA 3UXMA 1JFVA 2J8ZA 4OKPA 2GJSA 4JVOA 1X77A 2HF8A 4BUJA 3TSOA 4K6FA 1ZK2A 2BTOA 3EGIA 2C00A 1XOIA 4CDGA 3PTEA 3VOLA 1ISIA 2FEAA 1F8YA 3PXEA 2ZANA 3OZVA 1DAPA 4OMFG 1JKJA 3ZQ5A 2J32A 4QVGA 2OV6A 3FN4A 1UK8A 1XQWA 5LNK1 4E3JA 1RCUA 3AILA 4GP6A 2OCGA 1JA9A 4Q93A 3ZR4B 3L8ZA 5C5KA 3PLNA 3DZJA 3TMAA 4B34A 4D3ZA 1H3QA 3UV7A 5BP7A 2WAFA 3U3ZA 1EI9A 3V7FA 4ZCMA 1NN1A 3WL4A 3DEJA 3PP8A 1YZUA 1Z15A 1QCZA 1RKVA 2GM3A 2QM8A 3HLGA 2OA0A 5GWXA 1N1MA 2H2AA 4Q4JA 2LIPA 3E4PA 2C94A 3P19A 2BG1A 3PICA 3EODA 1C3LA 1GP2A 1Z4IA 3D8BA 1N75A 4TTAA 5A91A 3WLLA 2NACA 2OBBA 3OPYA 4RK0A 1O4VA 2VF7A 2ATXA 3WISA 1LRJA 3U4QA 1L3CA 4O2BB 1UFKA 3AEQB 4DFDA 3G2MA 5KKNB 1UAAA 3BYZA 3U44B 1QX4A 4TTSA 1UFRA 4BYMA 6NULA 2R2AA 5TQ2B 2FN9A 1ML4A 4EARA 5JPDA 1M9NA 4O02B 3MELA 1MU0A 1T25A 3G34A 4RHFA 3GVCA 3EEIA 4KPEC 2C3MA 2R4QA 3KKMA 4CU2A 2BELA 4P87A 1E1YA 2R00C 2Z8XA 2YWXA 4IQGA 5K3AA 1TKAA 4Q4HB 4FZ3A 2Y9PB 2PZEA 4XWTA 4DJDC 4BMOB 2EXXA 3NHSA 3E0QA 3L7BA 4KX3A 2G36A 4YUYA 2BASA 1IN7A 4QYTA 3IHWA 3HRKA 1DJLA 4HS9A 2QAIA 2JGFA 1H4VB 1SVIA 2VP6A 2FPUA 3SZUA 3HS3A 4R4JA 2E48A 5CEEA 2AKAB 2XKKA 3NYIA 1E4OA 3QX3A 4M9UA 3ZWBA 2JS7A 3T9AA 2R8PA 3K5IA 4MRRA 4ND6A 1KQNA 1XR3A 5HUQA 3NPDA 3LDUA 4HZUB 4C4RA 4GQIA 4MWEA 2J3TC 3AIIA 1Z5ZA 3GGJA 4LVNA 3UEOA 4F1KA 1G9TA 2ZAYA 1FFHA 2WY2D 5AWFC 4EQ1A 4GF5A 4ND8B 1WULS 1QZZA 1O97C 1SCQA 4IO0A 2VTBB 2XB8A 5F68A 3RFUA 4XUXA 1B1AA 3L49A 2A86A 1WDKA 2BT4A 3GXOA 4Q19A 4DR7B 3K0KA 1L2TA 3GLGA 4E04A 2PXHA 1RRFA 2C0QA 3GHHA 4CRWB 1W0JA 1A5AB 3ZG0A 1W34A 3IKJA 2DKFA 4UW9A 4FFLA 1HETA 3UK1A 4OBWA 2FH5B 3B8EA 2P9HA 3SSNA 4WZAE 3OECA 2XCRB 4NJMB 4Q21A 4HZIA 4YGXB 1V2GA 5LMNB 3VP0A 1P2VA 1TEZA 2H5JA 2WT9A 2HA2A 3ZNYA 3L7JA 4B4UA 4LRUA 4G65A 3ZFZA 3D7NA 1DINA 3AOGA 5BT9A 1F2UB 1NN5A 3B2QA 4LF7C 3JS5A 1X1RA 1VL2A 1U9IC 5A4JA 4H16A 2OCLA 5ALWA 5SZIA 5F7XA 4A0HA 3T0IA 5BV7A 1S8OA 4QUDA 3NU1A 5IUKC 4HYYA 3USES 1LLQA 5JG7A 1W88A 4MQEA 2D0PB 1TT5B 2B4QA 3HB1A 1RACA 1JPVA 1TRHA 3DYVA 2BKUA 3DXFA 3JVDA 4NC9A 1B43A 5DJTA 3KYCA 3SYMA 5K0CA 4IVIA 5C8ZA 4IGAA 3A6HA 4Y9UA 1H0KA 1DMSA 2VH1A 3VO8A 4MA4A 4Z9XA 3SKVA 3PEUA 2P1ZA 2XT0A 1JGTA 2OSVA 2HHHC 2C20A 3EIWA 3CVVA 3H17A 2Q4TA 3GX1A 2YXNA 2PYZA 1ONHA 2WILA 4G0WA 1XNRB 4DPKA 5JMPA 1V8DA 1Z6GA 3IEXA 3UWDA 4NG5A 4R8MA 3ZGLA 1KFKB 2P9JA 1O57A 4DUYC 2QD2A 3OOJA 1BAPA 2X0DA 5KZMB 3DMGA 4MQ4A 2VKSA 1DG1G 1CPYA 1CQWA 3SEAA 1RZUA 1E2NA 1EDOA 2GM9A 3VC1A 2Q45A 4PX3A 4K1XA 4LOIA 2GJ4A 3RUDA 3IH9A 2ZRLA 1A8QA 3U4LP 4L3VA 3GECA 4A0GA 4K81B 1EEHA 2B99A 4XQCA 2KBEA 1QE5A 2H54A 4K2HA 1RM3A 2ECOA 4F3RA 3PFHA 1VQ1A 3EISA 2XGJA 1GNLA 2ZUDA 2YMPA 1P91A 4JLDA 2Y0BA 2V5UA 3G1WA 3A3JA 4DSOA 5LQDA 1QONA 3LY9A 5HGJA 4O4LB 2O8BA 2CV0A 1ESZA 4EG7A 1UC9A 1I5QA 2DKNA 1GSOA 3PKZA 5J7EA 3BK1A 1G2PA 5DNWA 3OLWA 4G1BA 1K2VN 2ZB8A 4H0NA 4NLLA 4GE0A 1G18A 4W8OA 1EVIA 1I7NA 5HPIA 2H7YA 2Z5FA 2C04A 3ZZ0A 4EPWA 3O2SB 5IG2A 2Z1DA 2HRBA 4UMEA 4EB6B 5HIIA 4TZTA 1UXKA 1MENA 5KJEA 1L8QA 2K87A 1JT2A 3OTGA 1J8QA 2JJYA 2YBDA 3T12A 1DBIA 1CULC 2CLHB 3CR7A 3PENA 2H5IA 3VKUA 4FFPA 3TR0A 5C34B 1KIMA 1Q1BA 1F6BA 1QF9A 3DDOA 1I2ZA 3KJGA 5SZHB 1QRAA 2VSYA 1HVBA 3WWXA 3CF4G 3MTJA 4Y13A 1E1DA 5FPQA 1R50A 4QNRA 2P9YA 5AOBA 1M8FA 1TAHA 4YR9A 2R5NA 1MX3A 3D4OA 4LSZA 3MINA 3ABRB 2I4IA 3I5UA 5EGSA 3QK7A 5FQQA 1Z7BA 2IU0A 3UE6A 2F9LA 3E3LA 5ESXA 5THQA 4XJVA 4N9LA 4AY2A 5DF8A 4BU0A 4HGNA 1S9DA 1RD4A 4EUSA 3GA0A 5H16A 3NV9A 2HMTA 5GJBA 4BMNA 1XVIA 1TNDA 4K6CA 3FF4A 1XVLA 3JQCA 3NAMA 4DAEA 1GHTA 2VV8A 4UE6A 1IK4A 3L0OA 4BO8A 4I5DA 3LDGA 1QU2A 3I42A 3DYBA 2UUBB 2J4FA 1CP2A 4L73A 3V3TA 2PH7A 2YIMA 3F67A 1Z8DA 1YFJA 2O52A 2D5IA 2Y1OA 2R751 5ERGB 2QI9F 2V1XA 4NYMR 4E94A 2Q9NA 5D1NA 3VPBA 3TRHA 4RUKA 3TLAA 3TVYA 1JLMA 2E4XA 1H5QA 4ER5A 2F8SA 3C4QA 4BIIA 1ZQ9A 1X0OA 5DNDA 3NG1A 1X7YA 4KWEA 4YJ2B 1V3UA 2WU8A 3W8FA 3FTPA 1FQOA 5EOOA 3UJ7A 3TKYA 1MTZA 1QP0A 1HO3A 4I5FA 1H0RA 4HTFB 2CL5A 3V8VA 1F98A 3QXGA 1L3LA 1TZJA 3C3CA 2W2VA 5EVIB 1MG5A 2KDKA 3EVAA 4K2AA 4JI1B 5DXFA 1IZ8A 4A6DA 2PA0A 4FD8A 5CM9C 3HWSA 1O2DA 2ZVQX 4XPIA 5IPFA 3OTWA 2P2FA 2O54A 2ORYA 2BJWA 4L50A 1Q12A 3DWFA 4RTQA 4NG2A 3X3HA 3EFEA 2D1TA 3KKKA 3RBVA 5EKXA 2IOFK 1VIDA 2FSPA 2QL9A 3LRPA 2JHGA 3BSFA 4EHFA 4LOLA 2AI1A 2IX3A 2LW7A 3EOAI 3K9WA 2BSQA 3W3AD 1GA0A 1OV4A 4EB8A 4S2JA 5HZMA 1U6KA 2WV7A 4OB8A 2IYEA 2GUGA 5B1EA 4X3CA 1E77A 3P2JA 1UBEA 1Q2PA 1SIOA 3GJ6A 4UA7A 1VIVA 3AHJA 4LY9A 4DXBA 2C2KA 5CT5A 2WUDA 4HQ6A 4AY6A 3G49A 3A26A 3HABA 4IQ8A 3MJTA 1GLGA 5E1MA 4K8OA 5HK9A 3UPTA 3SH7A 1Z88A 8ATCA 2J09A 3EE6A 1G4HA 1XTRA 2C29D 4E2XA 4FP9A 3VDMA 1N2OA 2N1BA 3FCXA 5IVPA 2RGXA 1ADCA 2GILA 2AI2A 2OENG 2YS6A 3R0JA 4UXIA 1S67L 1NVMB 3UC5A 3G2PA 5KYWB 1IBMC 1M1XB 4BNGA 5DX1A 2B92A 2R6GA 3SS5A 1YZNA 5L53A 3AL3A 5EM0A 1WS6A 4YN3A 3PNVA 3ZHXA 4URFA 4D3FA 1KF0A 4EEPA 5CRIA 1GRNA 4KXYA 2YZMA 3NUGA 3PLAE 3C97A 1OTEA 2B4KA 4BFVA 4BCAA 1L7AA 5HRCA 3RODA 1T3HA 2QTNA 3QE4A 5I47A 1L5KA 1R00A 1O90A 2ZUTA 2I7XA 5JNSA 4ZI3A 4HAYA 1TTPB 4PYRA 5I7SA 3QP5A 3OF5A 3N2YA 4OHOA 3HQ4O 2AN3A 5INTA 1GCUA 3GAAA 3L4BA 1XKXA 3RJ5A 1ZS9A 3HVFA 1W0CA 4N5LA 5BQPA 2V7WA 5ERXA 4U0JA 4UTOA 1UXIA 4YMGA 2DZDA 1U3UA 1LTHR 4M88A 4E5UA 1XLTC 3QF7A 5JSUA 2JF0A 1COWA 1WCXA 2RD2A 2GTHA 1KYTA 3CLRD 1YFLA 3VPXA 2ZQZA 3VYWA 1LRKA 5A5FA 1BE6A 1DV2A 1L4NA 4NP6A 5KYTA 3KJZA 4EYKA 3QWAA 1NJ2A 1JR2A 4R05A 1X8LA 1ARZA 4R9VA 3ZGXA 4FEEA 2C5FA 3LYXA 3NBKA 2DCUA 3RLFA 4H31A 1O8BA 4IWXA 4BSZA 2EHDA 4M83A 1EE2A 2GN9A 4QECA 2B1GA 2BGMA 1NM5A 4OBBA 2YFKA 2W43A 3QA3E 1R6AA 3DM5A 1EVQA 2VCHA 4R4SA 3JZMA 4BECA 4R71A 3L40A 5AI5A 5IFLA 4X9XA 1PEYA 2WZCA 4TTJA 1KEUA 5CHYA 3PZBA 1QQ7A 3B6ZA 1H4TA 1NPDA 4WAUA 4PYKA 3M0EA 4R2IA 4I5GA 5D3MA 4PX9A 1NVAA 5HJEA 5AIBA 3C3BA 1JG3A 4CKBA 1JKJB 3PI6A 4F5YA 2GS9A 4ZVQA 4NENA 3OIFA 4BNYA 3IEVA 2X01A 4DYHA 4NEED 3UAGA 5DU2A 4JV5C 2JCSA 1ZUNA 4Q0IA 2QJOA 3PCXA 1MO4A 3TRDA 1CUHA 1E94E 4N48A 5HQTA 1FBTA 1IQRA 2HPZA 1D6JA 5LMUC 2EKDA 1U94A 4X55A 2CLOB 4Q4JB 3INNA 3FPWA 1S1YA 2AB0A 5MC7A 2FLWA 2WMYA 3EF1A 2JFXA 4LJ5A 4BDTA 4I8XA 1JMYA 5GVRA 2HZBA 1Y6JA 4G1VA 4FFVA 4RY0A 1V9ZA 5A71A 5AK3A 3S2FA 3OPYB 1JI3A 3VSAA 2ZIXA 3U6BA 3U4QB 3CRW1 2J3IA 2BUAA 2N3ZA 1PWDA 3ZN2A 1KS9A 1RXYA 1P2TA 1PL6A 4XOUA 2Q9BA 5BOHA 5KMWA 2BHRA 2MSNA 3DO5A 5HUHA 4RY2A 1P62B 1PGOA 3W3AA 3FYTA 3A0SA 1G5TA 1PW7A 3I73A 5AQ9A 4IUCS 3CNQS 5KSCA 3LR0A 5JZ9A 2P2MA 1CV2A 4X94A 2BZSA 3QWIA 3MIIA 5FX2A 1A9RA 4QTYA 4QULA 5C1DA 3PD0A 1YKGA 3AVQA 1C0PA 5KQPA 5C8XA 1ZHHB 4JF4A 2WKEA 3QEAZ 3RC8A 1BLHA 3PPYA 3T7AA 3WRXA 3HKBA 4WPGA 3H4TA 3P9YA 1KJ9A 1PNEA 4AECA 3GJZA 2YY6A 4ZV9A 3B2NA 3C2QA 2WAXA 1MG0A 3ULFA 1PJZA 1K6RA 1ADYA 4LTMA 4LV2A 4ENTA 3NATA 4MRMA 1RCFA 1ZGBA 2PHZA 4CGZA 2C95A 2CYCA 2QUAA 4QWOA 4BFWA 5DF9A 3PEEA 1AKWA 1N2HA 1HRKA 1E1KA 1BEEA 3R7SA 1E7WA 4XEUA 5FLXD 2ZRPA 1JR3A 4PQEA 1KI2A 4Z3KA 4ZLPA 8MHTA 1MC8A 3PXUA 5CGWA 3OIWA 1GNQA 3LIEA 2EJWA 1A9XA 1LLBA 4E5YA 3QX9A 3ZU4A 3P4UA 3MJQA 3OZAA 2ZYUX 1TJPB 2PX2A 2HV9A 2VPZA 3CUKA 1EFPA 4TTQA 1KQGA 2ZAMA 3KSUA 3O2JA 3UCXA 1XDUA 3BRCA 3E05A 3VJKA 2GEDA 4JHXA 1L5QA 3K8OE 4IIVA 4LZLA 5F73A 2O8DB 4IHAA 4CEIA 5EIHA 3VH4A 3RSGA 3UMYA 2IDZA 3GLGB 1TT7A 3DM9B 5AJZA 4EJFA 3AL2A 4Q4CA 3UK7A 4CM1A 1EDEA 5EEGA 2FNAA 3RKUA 1IHOA 1LRLA 2C8VA 4IQ0A 3KO6A 4OXQA 4K03A 3CG5A 3L9KA 4BP1A 5I8PA 4OJKA 3R3JA 2HYIC 1USIA 2J3TD 3AY6A 1HE1C 1ZICA 1QZ3A 2HZ5A 4J4BA 3BFGA 2ZSKA 3J80D 2XB6A 4O5AA 1EUCB 3LQ1A 2LNDA 4AY5A 3HNPA 1O97D 5KPDA 4ZYYA 1BDJA 2FWPA 2G0AA 2REQB 1RWOA 4KITB 4RVOA 4OIFA 1UIRA 3P0EA 4X1IA 2NSYA 1KSGA 3LM8A 4MROA 3TMYA 3IURA 1W88B 3EPHA 1Y3HA 4MQEB 3RU2A 4WLUA 2IY9A 3S8MA 4GMXA 2JGLA 3KUUA 3UO8B 1KE1A 4OQLA 4YGYA 1IVSA 1RPJA 1U5BA 3UNWA 2OZKA 1H2AS 4RS4A 3STTA 3KYCB 2ZL1A 4A4DA 5DGTA 5GONA 3AZPA 1T8UA 4ZCQA 2CK3D 1FYVA 1R6DA 3PYPA 4GLLA 2A88A 4Q3OA 2GMWA 5IXJA 3SW1A 3HDHA 2NADA 4MDHA 5JAQA 3ZC3A 5SZJA 2VV7A 2RCNA 3M5PA 5B7NA 3ZYZA 3CRZA 3PQ6A 2HDWA 2UYOA 4MRAA 3BBLA 3MVEA 2PAVP 4ICIA 1QHNA 1C7JA 1Z29A 3WGZA 3FNEA 1EUDA 4LYEA 4XGQA 4NMXB 1LX7A 3P9ZA 3PTLA 2D1RA 3EQ7A 2QF7A 4NAHA 1MO3A 2HA6A 4GD3Q 5B7PA 1DXYA 3QVKA 3HBLA 3KHTA 1EEXB 1A7KA 4J7XA 4YRFA 1J20A 1T8SA 1H65A 2G28A 2JGNA 3ZBTA 3CU5A 5ELLA 4TS9A 3N7TA 4DVGA 4QQRA 2NU7A 5EUCA 3U3MA 1QQTA 2G83A 4DC1A 1P7PA 2WHXA 2GWRA 4HGYA 5E9WA 5IC6A 1T9GR 4WTOA 1ADJA 3LW7A 3R0XA 2GZRA 3NOXA 4V1CA 2YJ6A 1Q84A 1Z4NA 3PWZA 3ZOZA 4QU9A 1O1YA 2XAUA 1VJ5A 3W8NA 4OBEA 3A36A 1O94A 2O1SA 3HSKA 1RQRA 3BFCA 2ON6A 4EFMA 4YCAA 2NU9A 4KRYA 4PYOA 4RKEA 2PKYX 3T12B 3EQVA 1Q1GA 4I1RA 4W5JA 3MBZA 2P3OA 3TXAA 1R6UA 2IF0A 2QP3A 3EZXA 4F45A 2PQ0A 4Q9DA 2WUGA 1E5VA 3RO7A 2VHCA 2EXBA 5CT4A 2QRUA 2GSWA 3B6JA 1YONA 2I6XA 1B93A 2VUIB 4EB3A 4LE2A 1X70A 1G16A 3MINB 1TYDE 2Z8YA 4EI7A 4IVQA 3A2MA 1XPJA 3WWYA 2HWYA 4FOOA 4MS4B 2O8NA 3N3AC 4NYJR 3PFBA 4OBXA 5THKA 4MTLA 1PQWA 4GDFA 2NU6A 1NZFA 3CMMA 1JKFA 4CTNA 1G3IA 3JRXA 2R00A 4DZTA 5EQFA 2PRKA 3DOHA 5A92A 1F8UA 4QVIA 3GRCA 4G0PA 1XEWY 1B00A 1PDWA 3C5HA 4ZVTA 2D2FA 4WX2B 3H11A 1Y1PA 2JJ1A 1FX1A 5BSEA 3BG5A 2C5WB 1XZHA 1FA9A 3DT6A 2FEPA 5K85A 5AVTA 2HJGA 2XTJA 4WOJA 4IO1A 1QOQB 4C2TA 3OPHA 1OVMA 4YRAA 2JFQA 3PV0A 1X7YB 3WKCA 1QO0D 4DMKA 3V5NA 5KDDA 1VHMA 3V1UA 3K53A 4MW2A 4JYCA 3CVUA 3RAPR 2IHBA 3A70A 4LF6C 3SSMA 4QVKA 4ZCTA 5I5EA 4A10A 1EQ2A 3VSLA 1CHDA 2DTDA 2LVBA 4GS5A 2DFDA 3UMBA 5KHLB 3BJNA 3F7TA 3BE8A 3OT1B 2W27A 3Q88A 2QY6A 1F20A 3G2HA 3LRXA 5IDQA 4AZTA 2YCBA 2B2NA 5DYTA 2I2BA 4Z1MA 4W5QA 4ZICA 3T5AA 1K55C 2X2EA 3UW3A 1P2GA 3IBSA 5DWVA 3IPYA 3T4OA 1AZSC 1I8TA 4R9SA 3ICCA 3O1LA 2M1CA 1T10A 1UDBA 4WZBA 3GY0A 1UFOA 3U31A 4BB0A 3D64A 4IVKA 2EJVA 4E88A 4S3MA 3CWCA 2CK3A 3BQ9A 3WGGA 4UUBA 3UA4A 1WG8A 1NSTA 4M4XA 3HN2A 1CY6A 1XJ2A 3G9UA 1SXJC 3RJTA 1LI9A 2NVUA 2QU7A 1SEPA 2MSCB 1PT7A 4LOAA 4M0EA 2FCRA 2Q3JA 2Y79A 5GV8A 4IIGA 1M76A 4WT7A 4ENUA 1ZU4A 3U3XA 3P98A 1UKZA 4NICA 2G2UA 4K3UA 3FETA 3KV1A 3HCYA 4NONA 1UJ4A 3MGBA 1FNBA 3GVHA 1UXGA 3IDFA 2OL4A 1IVNA 3NB0A 3LY7A 1JHUA 3WGMA 4HJ6A 1KBZA 2B0CA 4TYNA 4GE3A 4FCFA 2D1YA 3GR2A 2DR0A 3NDIA 4OPZA 1CLEA 1AXEA 4O4IA 1DHTA 2AEJA 3AI2A 4HH1A 2WP8J 1R1DA 1NMYA 3AGPA 4ZEWA 1CR2A 1XEAA 2VX8A 4YMUA 1PX2A 5DYYA 4CYMA 2G1KA 1HV8A 1W48A 4E11A 1M6VA 3A6JA 4JUDX 1K8RA 4B2YA 5LUAA 1LFDB 3GOQA 1RP5A 4QEZA 4JYAB 4OP8A 1PQ4A 1S1CA 3BGIA 2V6GA 3IAUA 4TXJA 4K0KB 2NTJA 1XA4A 1MB3A 3GN1A 3E23A 4ZVPA 3KALA 1T9KA 1VM1A 4CKWA 2XB2A 3LYLA 4H7KA 4Y7DA 2YFYA 2JDIA 5K01A 3ANYB 1YQUA 1HE5A 1NNSA 3H6GA 3UMRA 3GA5A 5TQ0A 4P2GA 1W85A 1FUKA 4RTNA 4F93B 4XQ0A 2F43A 1BLPA 3PT9A 1LBTA 1PHPA 3QUCA 4Q9AA 4Z4QA 2X15A 5CD9A 5ALOA 4PLWA 2EDAA 5IBQA 3BHMA 3ID6C 2EP7A 2HA5A 4W6QA 1M6XA 4RO0A 3TYXA 1NBMD 1CYDA 2RB4A 5EY5B 3H86A 3V4PB 3VP2A 1O03A 3IWIA 1W5AA 1M1YB 1XNHA 4W9MC 4AWAA 4L9FA 3UBTA 4PZYA 1ANKA 5CZXA 4JBHA 3KKQA 2G3YA 5DEOA 1E9VA 1KEZA 1XLVA 5T6BA 3DZIA 4O4HF 3TDEA 4JPMA 1GRRA 1YQWA 2M2IA 2WP0A 3K2QA 3U3DA 3NJAA 3UE3A 1I01A 2ODQA 2PT7A 3WA6A 1W4AA 3W2FA 2VN8A 1PW8A 1PJLA 3CUWA 1OGIA 3JZFA 4M8NE 2WJVA 4QPZA 1X39A 4TPSB 1MTOA 2QT1A 4WEKA 1UKBA 3C6XA 5D3MB 1T4CA 3BWMA 2ARKA 3PNQA 4CKBB 1D3AA 3FLBA 4NENB 4PTLA 1QO0A 1QV6A 4FDMA 1LPSA 3BGOS 2M98A 4EYSA 2MMCA 1JFFA 4OM7A 4K9OA 1ZUNB 3RVPA 3NBZC 1NW4A 3C45A 1E5QA 3EF3A 3Q3EA 2PHYA 3B1YA 1JILA 1NATA 3IDQA 2QZSA 1FZQA 1LBQA 3EDQA 3X1YA 3TUZC 1C9KA 1NQOA 1HSOA 5LN1A 2C07A 1P45A 2W6PA 4P0QB 3HDJA 2BY4A 2P77A 5CJ2A 4INAA 2F8TA 5F2KA 2GPYA 4HAWA 1GCIA 5EXXA 4HVLA 2FRDA 1P9OA 2I3BA 1EX6A 3KQPA 5DXJA 2CN1A 1OWPA 4MYHA 1VLQA 3MQ4A 5F98A 4L8LA 2UYYA 4DLXA 5JROA 1R4ZA 4TLDA 3PF8A 2EG9A 2JJ2D 3U5TA 2HK7A 2A5JA 3ET5A 4BP3A 2QTFA 4BOYA 4JI8B 2XXBA 1VE7A 3K9QO 4DV6B 1CHNA 3ZNTA 4URWR 3FW1A 2XJ9A 5JJLA 1KYWA 3NAGA 1IZYA 4PPFA 4WUTA 4DZZA 5C7LO 3HFJA 3PGA1 1LK0A 3DTVD 2J5KA 1Q77A 2D2EA 4N54A 1A8SA 1S8AA 4TLCA 4MJ3A 3FBWA 1T91A 3OPXA 1V8BA 3TLEA 3RUIA 3ONVA 4OQZA 4O2BF 1RCTE 5ICEA 2QRLA 1D6SA 1V6AA 3WLNA 1MIOA 3T1HC 5BW4A 1A2OA 4CMHA 4MHTA 3ZJ5A 1CY1A 1T24A 1VJDA 2QLLA 5BO5A 1FP7A 1SMKA 4QQKA 4YT8A 1E2FA 1Y9ZA 1QHIA 2WKQA 3QBTA 4C7BA 2XODA 4O1IA 1D09A 1YQXA 1BJRE 6PFKA 5K2MA 4MWOA 1WCWA 1S7GA 3A37A 2EKBA 5E7JA 1LV7A 2QR3A 3MLAA 4Q24A 3C6MA 4W5WA 5CA1A 2FGKA 4F5EA 4XWAA 1B23P 2O48X 1R10A 4EKGA 5C1BA 1VQQA 1J6UA 1QR6A 1VRWA 1U7UA 3D0KA 4OJQA 4CLCB 1G8AA 1LPPA 1ODTC 4X61A 4PSKA 1WCV1 4HQFA 2AHOA 4ZO9A 4CEIB 1ZH8A 3GU3A 2FEWB 2IEDA 4D8XA 2LBPA 3NHPA 3O8QA 3B6IA 2O8FA 4YROA 1GUAA 4JF6A 3VMMA 1HDIA 1DARA 4ISBA 2EEPA 1TVEA 3SQXA 2ODWA 1EUYA 2OFOA 3DL2A 3WWDA 1S89A 4ZVKA 5FO1A 1QXSA 3IYLW 1HDRA 5AHXA 4HEHA 4OQMA 1G55A 1JJVA 1C2YA 1NF3A 4OQIA 4X1LA 1Q0ZA 3ZGZA 1FSYA 4I9UA 1NBMA 3I6MA 3QYFA 2Q5EA 5KC8A 4PWYA 5D8DA 2YHBA 1IOUA 1MDBA 1EK0A 4ANFA 1VB3A 2V98A 2JGAA 4IDCA 3WKAA 4BPBA 1QU3A 3KZNA 2Q1UA 4XD7D 3GQZA 4EVSA 3SVLA 1IN1A 3T1SA 4CMJA 2G9NA 4ZIRA 2WNHA 5HZHA 4X1IB 1K68A 5AJVB 3JWJA 3STWA 1OI7A 2POQX 3WMEA 2QUIA 3JWEA 4LF4C 1DXQA 1QP4A 1U81A 2NQ2C 4N0EA 2PH5A 3G9ZA 5JZOA 3DE2X 1KDSA 2ES4A 1U5BB 4P4NA 1IB6A 4AAYA 4DSUA 5GONB 4MYCA 5FR2A 1O95C 3IWQA 1LT0A 2VDPB 3I5YA 3F5MA 5HD5A 3E8XA 3STHA 3OEYA 1P9WA 3NR2A 3H1FA 3FVWA 2FPLA 2ZBQA 1T9DA 4R8RA 2R6ZA 3AWDA 3IAM1 3AW8A 3G9TA 1DE0A 3F2IA 3H3XA 1DRVA 3HCEA 2C83A 3FKVA 4IH9A 4EV4A 2YASA 3FTQA 3R9IA 2V6BA 3KXPA 2AOTB 1EUDB 4FU0A 4J07A 2DPYA 4EO7A 3NWBA 3TIIA 1PJBA 3RYFB 4KYVA 1SCJA 2QX8A 3OO0A 1G38A 3O4FA 3SZOA 2H7XA 1OT9A 4URVR 3R40A 2VNIA 2PCLA 2Y0PA 1RSZA 1Z35A 1PNOA 1HMPA 2H11A 2RARA 3L92A 5EKUA 5J5CA 1C41A 5GJVC 4GU5A 1P0PA 3DVQX 4TV9A 4UEQA 3JZDA 5H9UA 1TK3A 2JJ2A 3PNYA 3KQWA 4YNRA 1B0ZA 1AS3A 4TX1A 3A4NA 4L5IA 5BVHB 1EFCA 4JB2A 5HIKA 5I7AA 1ZNWA 3OJCA 4NMMA 3DOIA 2FMKA 4IXMA 4V1CB 4JJZA 5ERYA 3TWOA 3IIEA 2W0NA 1BEZA 3Q9SA 1WNFA 1TEMA 5I4BA 4L7IA 1WWKA 5LQSA 4MYRA 5JS1A 1W93A 1GLVA 4M8LA 1CW2B 5I7UA 1BEUB 1AO3A 4NK5A 1S3SA 1UJBA 3IQHX 1B41A 1RI2A 1UBTS 4XE5A 3N8KA 4H0CA 3DFUA 4RKYA 4OX9C 3LP8A 4O4LF 2HIAA 3ASVA 3H5TA 2WB2A 4E09A 1QB7A 4QUJA 1ZUHA 3CO5A 2JK0A 4IZOA 3CVWA 2H1SA 1N3IA 3R4CA 1AUPA 4IHKA 1TOAA 3ILSA 2PJUA 4EHJA 2GBIA 2I2CA 2FWAA 2QW0X 4DABA 3ZDZB 3NKFA 2NU6B 1U7TA 4YC7A 3U3JA 3L4KA 2PBDP 1UPBA 2NVOA 1T1CA 2ALJA 2UYCA 3SOIA 2VS1A 4HDNA 2E4ZA 3AIKA 4MPJA 4OQHA 1XMJA 2VQEB 3N2NA 1T9CA 4MINA 2GZSA 5EJMA 3H11B 1PSWA 2FB9A 2OCBA 1ODIA 2PROA 3B6KA 1BVUA 1WCIA 1UXHA 2NUTA 3HU2A 2HY7A 2XUZA 3C6KA 1FF9A 4J0FA 5D3ZA 1B6TA 1JQ5A 5EOVA 5JUWA 2CXCA 5CYFA 4UBIA 4AT1A 1ZC2A 1BHSA 4JJ8A 2GVNA 1AHHA 2C4UA 2QTGA 2I80A 3MOGA 3CINA 3MQ0A 1TDJA 3NM4A 4IIHA 3SM9A 1XAJA 5HOEA 1AK2A 5DV9A 4AZ3A 3AR5A 4ZGGA 4DA9A 1MX5A 1DBSA 5GAJA 4LRYC 2YVKA 3S2ZA 3FZGA 5ALMA 3EGXC 2E5WA 3RRYA 3QW2A 1YHZA 3HEBA 3MQOA 3GP5A 2H0RA 3HMQA 3NM5A 1PV1A 2FSIA 1YOVB 4KUGA 2UXBB 1ORRA 4NEHB 4YYZA 3CUEF 2F1IA 1EK6A 3HSSA 3W79A 1VBNA 2XVXA 3EA4A 2CXSA 1OKKA 1X1AA 1U90A 4BFSA 4JXGA 4U7GA 4WZBB 1DCFA 1B2LA 2VTEA 4UQIS 4H2DA 5EHQA 2JVKA 4C76A 3NDGA 1GG2A 1USGA 2JD2A 3W6ZA 5KQRA 3H1GA 3OMXA 4WACA 4BNZA 1N8NA 1FCOA 3GPIA 3M6FA 4X64B 4F4HA 4G85A 2ET6A 3DEAA 5L3SA 1KZGB 4YRDA 1YS9A 3DSRA 1ZIOA 2HHAA 1JQJC 3L18A 3BSWA 1JBEA 1OSNA 1XP5A 1Y3DE 2AOUA 5EZQA 4KB5A 1PR9A 1C9DB 1I7DA 5FEGA 4HXYA 3KT8A 1K89A 4BD0A 3D1VA 3E03A 1E2PA 4KV9A 1A98A 3R6DA 3PAEA 2P6PA 5IC5A 4O4IB 3EQ6A 3G0GA 4GLBA 3BM5A 2QBYA 2FVXA 3ADPA 1B15A 3WMXA 3KL4A 3PXGA 1IN8A 3VAAA 1SXJD 1E6WA 1A5SB 4CLOB 1BWQA 4OHVA 5EMNA 1M6VB 5LD2B 1H8YA 4I3JA 2DFVA 2H2FA 4X3OA 4R8VA 4GOGA 1MT3A 2PRFA 1ZZGA 2I55A 3DAPA 3QKUA 2XTAA 5CLLA 1YZFA 1PLJA 1X1TA