The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
127
|
sequence length |
485
|
structure length |
438
|
Chain Sequence |
RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEADKEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAGEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Type II secretion system protein L
|
publication title |
Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb |
source organism |
Vibrio vulnificus
|
molecule tags |
Protein transport
|
total genus |
127
|
structure length |
438
|
sequence length |
485
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2014-05-06 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | GMP Synthetase; Chain A, domain 3 | GMP Synthetase; Chain A, domain 3 | ||
Alpha Beta | 2-Layer Sandwich | Beta-Lactamase | Beta-Lactamase | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |