4PHTA

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
485
structure length
438
Chain Sequence
RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEADKEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAGEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
molecule keywords Type II secretion system protein L
total genus 127
structure length 438
sequence length 485
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4phtA01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4phtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phtA03
2W00A 3ZVLA 2A2ZA 4LJ8A 4ITRC 5KO2A 5BN5A 2GEVA 1LV7A 2GETA 2OEPA 4JSYA 1NL3A 1K5GA 3P27A 4MKFA 1XFAA 1GTVA 2R6CA 3BK7A 2FE4A 2ZSAA 3EZ9A 2WSSD 4WOPA 5GVRA 1D6JA 2YKGA 1E96A 1II8B 4Z1MA 1GP2A 1S9DA 2NTYC 3WBKA 1TEVA 3RAPR 2O5VA 4M1TA 3W6PA 4EQ6B 1KI7A 2X19A 5KSYA 2F43A 1MO4A 1NMZA 1ZJ6A 3GFOA 2W0SA 1GUAA 5H1YA 1YRAA 2OO7A 5LDDC 1MKYA 4PXAA 5JZVA 1TTTA 4O3MA 1W5SA 3R7WB 2VP2A 3EZ2A 2ZETA 4IOLA 1G7TA 4A9AA 1U8ZA 1ZP6A 1IXZA 3P26A 2OAP1 4DCTA 1JR3E 1PUIA 4DDUA 2WSMA 5CB8A 2C03A 1XEWX 5G40A 3AVWA 3BB3A 4RZ3A 1IY0A 3TK1A 1T0HB 2ZIAA 4JLBA 3GEEA 4OQXA 3U6BA 1LTQA 2Z4SA 3MJRA 4OK5A 2WICA 2WVJA 1HH4A 3I32A 1JR3D 2XAUA 2V9PA 2G9NA 3RHFA 1OF1A 2GCPA 4WZBE 4HB0A 3AEZA 2Q3HA 2C04A 2BH1X 5EJEA 2FNAA 3MD0A 4PAOA 1GITA 3WMEA 2PMKA 1UAAA 4FCWA 1XEXA 3KFXA 1KZGB 3PCRB 3THWB 3WRXC 4B2LA 1NVXQ 2O8DA 1VKJA 2F7SA 4OQMA 3TQFA 2P6NA 1OLOA 4F91B 4WXRA 8OHMA 4DB4A 2O8EA 5DSZA 4NBSA 1P73A 5LPNA 1XD2B 4PQRA 1YU9A 2F6RA 4HZUA 1YQTA 2Q0HA 1NIPA 5HE8A 1VMAA 3KUDA 4XTRA 3AKYA 3GCGA 2Z0MA 1RVDA 3PEWA 2VP5A 4LPKA 1PLKA 2ZJAA 2RKOA 3A1SA 4GZLA 1DAEA 2BVNA 4ZCIA 1NRJB 3Q7PA 4Q7JB 3E5HA 3BWDD 1J70A 3ZQ6A 3I8XA 2LKDA 1FP6A 3NKVA 4EDHA 3UATA 2IEZA 3B6EA 2F9MA 4YONB 1SXJB 3C41J 3TRFA 1KI1A 4C0AC 1RE0A 5J4KA 4MGKR 4EFNA 3OIVA 3PV0A 4JMPA 3K70D 3QXHA 4A0FA 5JEEA 2BEKA 2VSFA 2ZRJA 4H1VA 4L16A 3OIWA 1H8HA 1W4CA 3X1ZA 1L2TA 4KBGA 1UKYA 3T12A 1Z0FA 1Q1EA 2AL7A 4C0KA 3KTAA 3CF6R 3THXB 3NDBB 1WXQA 3UANA 2QGZA 3I73A 4PHGA 1IM2A 4BZPA 2GJ9A 3A1TA 3R8FA 2VF8A 3IQXA 2QAGC 1NF3A 1UKEA 3EZ6A 1GAJA 1WDTA 4QM6A 2WWWA 4IXMA 3ZVMA 4MRRA 3PJRA 4Q21A 5UKDA 2GZAA 2IXFA 2VO1A 3KKPA 4IW3B 5AUNB 2JA1A 4UXHA 3HPRA 2CMKA 3U7EB 2BOVA 1S4QA 1EFTA 4XVRA 5FTMA 4EPWA 4RJLA 4AKIA 2N46A 1E9CA 2JLWA 3KKMA 5EE0A 2FMXA 4RCYA 4URWR 4R2HA 4QBHA 1WP9A 3CR7A 1JB1A 4D0NA 1LNZA 1NI3A 2QPTA 4JLVA 1XX6A 4EPVA 1VDZA 2YOFA 4A4DA 1OYYA 1EG7A 1E9DA 1U9IC 2WMNB 5EE3A 1X6VA 3NTUA 4LJ9A 5B2ZA 3TGPA 1BKDR 1B23P 5C4GB 4B34A 4C3ZA 2IC5A 1RRCA 2Q9CA 4I1VA 3EIHA 4NDZA 3RRYA 2C95A 2QORA 2VTKA 4B33A 1T9HA 3ADKA 1T5LA 2XSZD 2BKUA 5JMTA 2JCSA 4KLZA 1XEFA 3F0TA 2PX0A 3VU9B 4BFSA 4EJSA 1G4AE 4TMTA 1P72A 1CJVC 4X8HA 2CNWD 1FOEB 4YLGA 4GI7A 3KX2A 2CHVA 5KSOA 1CJMA 5EXXA 4PAQA 2KB0A 5EXSA 2W0MA 5C1BA 1OFHA 4CF7A 5L3SB 3TBKA 2C9OA 4JLJA 1JXOA 3AQ4A 4NONA 1X86B 3WP0A 2R44A 1HE8B 3B1YA 2QAJA 3SHFA 1VECA 3PENA 2GXSA 5AR1A 2GKSA 3GJ3A 3MWYW 3QKSB 1S3GA 1OXUA 2FJUA 2E1RA 2PH1A 3LLUA 3MSXA 2V54A 3ZIAA 3AVVA 3HWSA 5CLQA 2C99A 3W6NA 2ATXA 1Z22A 4ZI2A 2FG5A 2R6AA 3X1WA 4R98A 1G3QA 3U4QB 1DG3A 3FKSD 3C14C 3FGNA 2EFDB 5JS8A 4WW0A 5DO9A 3VX4A 5AUOB 2JLQA 4C4PA 4JLOA 5FTLA 3EPHA 2ZRCA 3DOFA 4JLMA 2L0XA 5BN3A 1ZUIA 3EA5A 1COWD 2D2EA 4YDHB 5FBWB 4C2TA 1TUEA 1E2HA 2F55A 2ZJYA 3NWJA 1XJ0A 1S1CA 1CEEA 1GDDA 2CL7X 3RANA 1E9EA 4AWXA 3THOA 1W0KA 4XWAA 2BBTA 4HLUC 2HYIC 4UQOA 3ZD6A 1P2UA 3FVQA 1J90A 1Z08A 2QT0A 3CH5A 4B71A 1KO5A 4AC9A 2O8BA 1EGAA 1ZM7A 2HJGA 3CF0A 1AS3A 4P4TA 4BLPA 2ZRFA 1HV8A 3EZ7A 4L5BA 4LJ4A 2J7PA 5G3ZA 2BHRA 5JI2E 2ZITA 2BMDA 2QPOA 4UNQA 4TLAA 4BEJA 2C9CA 2CXXA 3LDAA 5EUQB 3WYGA 2HCBA 2W83A 2J59A 4CT4B 1MABA 1E2DA 1P4SA 2D4HA 2ZREA 3K0FA 5BWMA 1G3IA 5EQTA 1AKYA 3OAAD 3TW8B 3A4MA 3EC1A 3U2QA 3W5IA 1ANKA 4E09A 3KKQA 4LX0A 4QC2A 5IF9A 5JEDA 1AIPA 3FHCB 3TR0A 4LK2A 5GJVC 4IRUB 3FKQA 4G0NA 3AP2A 4H9GA 2WJVA 4BECA 1KO4A 3LLMA 5FL3A 3A1WA 3AF2A 1M1YE 1D9ZA 3K8YA 4N3NA 2QNRA 1G19A 1QVAA 4FW9A 1OIVA 2CNWA 5H70A 3UMRA 3GP8A 2C78A 1CKEA 2SHKA 3WXMA 4ZDIA 3T1VA 1GRQA 2G88A 1E32A 1G291 2IYUA 2FPMA 2KBFA 3QG1A 1P9RA 4ACAA 5TARA 3LH5A 2FZ4A 2OV2A 1N6KA 2ZU6A 3EX7C 1DG1G 2CLCX 4Z1MD 3DMDA 4JL6A 4Q66C 4DEYA 1VG9B 4M21A 3K0CC 1ZINA 1KI2A 3I61A 1VHLA 1W2GA 5HCNA 4CYMA 1JECA 1F2TB 4EPYA 3GJ7A 3GLHE 4C7OA 4YMTA 2HLDD 1Z0DA 1NVVR 5E95A 3GJ4A 2FV8A 3L0OA 4XSHA 5J4HA 2IYLD 3IIJA 1WBDA 3JVVA 3SQWA 1E2MA 2H92A 4JZKA 4B75A 4Z54A 2O52A 4D4MA 1XCPA 4X8MA 2EQBA 2QTFA 3PVSA 3FE2A 5JLJA 1M34E 1CBUA 4EJSC 1ZU4A 5CYPA 1KOFA 5J5CA 1Z63A 3K0CA 4WBSA 3TNFA 5KPDA 3S1AB 1QDEA 1O87A 2RH5A 1CP2A 2YWEA 2ONKA 1M74A 1TU3A 2AR7A 2YYZA 4HEJA 3NHAA 1F48A 3REGA 1XPRA 3IDQA 3AVUA 1FQKA 3TUZC 1WQ1R 1MV5A 121PA 2IX3A 1F6BA 1JQJC 2VSXA 1W46A 1XD2A 1KI8A 2OILA 1FUKA 4UJ5A 1KHTA 3NG1A 1AZTA 4FIDA 3TSOA 4FWIB 4QNMA 1NSFA 4FMBB 4MUBA 2BJVA 2VP6A 3B1ZA 3D31A 2EYQA 3DVLA 2BJWA 2R6GA 1EFRA 1KI3A 4PZLA 2F3RA 2REOA 1J7KA 3CBQA 1PLLA 1AS2A 1R4AA 3ZZUA 3AGPA 2HF8A 3VR6A 4NCHA 2V7QD 4HLQB 1SXJD 1FX0B 821PA 4LI0A 2DFTA 2CDNA 1IN7A 1X8LA 4B48A 2ZXUA 1E4YA 4O2LA 2DWOA 3R9IA 1LS6A 1ZM2A 3N5CA 1U0JA 3I1FA 2YV5A 3K0EA 2IEYA 4QXAA 2XOKA 4ZO4A 3IKJA 1Z8FA 1XZPA 2OCBA 1E79A 2CVFA 2QA5A 3EXAA 3I62A 2NO7A 1Z2AA 4US1R 5EXTA 4RZXA 5JECA 1KI4A 1NJGA 3ZDQA 4RCZA 4H1UA 1E1QD 3TUIC 3WHKA 1R0YA 3EIQA 5CITA 3ZS9A 1E1QA 1HT1E 4OBEA 2C98A 2HT1A 4M9SA 4QBFA 1XCMA 2DR3A 4ESHA 3WNCA 3NIBA 4TSFD 4HB2A 2FSHA 3IILA 2ZRLA 4I1UA 2Z6VA 4GP6A 3SFVA 3KFVA 3SZRA 4CDGA 3T1OA 4B2PA 4Q9JA 1W1WA 1G20E 1W5TA 2ZI5A 1AN0A 4BQSA 2OFWA 1VIAA 4NYJR 1KNXA 1UBGA 4PC3A 1A1VA 3DMNA 2BEJA 3QKRA 1JNYA 2WSSA 1W0KD 1J2JA 2ZPTX 4LJ6A 1WCV1 1XMIA 2RHDA 4Q5IA 1CRPA 1EFRD 1G5TA 2QY9A 2FPLA 1F5NA 1NY6A 1CULC 3RWOA 4QKQA 4CW7A 2ZU0C 5B57C 2FDCA 3ASZA 4AI6A 4OQNA 2ZI7A 2B6HA 2YHSA 3KQHA 2ZVQX 2OBMA 2F3TA 3AVQA 1OKKA 4LC0A 2BBWA 2OESA 1KO1A 1NIJA 1US8A 4CVNA 3D3QA 1RJ9B 2AFHE 4NYIR 2ZAOA 1XMSA 1II9A 4WIAA 3RS4A 3HYRA 1FTSA 3B82A 1U98A 5FPHA 3ZYCA 3GLGB 4KYUA 3BD9A 1TL7C 1NBMA 1DEKA 1DPFA 1KMQA 2ERYA 4A8JC 3THYA 4E5UA 4CEJB 1MABB 3HJNA 2V55B 3F3YA 3GJXC 2VP0A 4HAZA 4TQAA 3TAUA 1TU4A 1M7BA 2F1IA 2NZ8A 2RB4A 3BB1A 4LHXA 4F93B 4AKGA 1IAQA 1NBMD 1KDPA 2JEOA 3LY5A 5GJCA 4QJ3A 2ZRDA 3KQNA 3A4NA 4E22A 1OXVA 1QBKC 2G3YA 4MITA 3ZQJA 3W9YA 1U99A 2OAQ1 2NG1A 1ZYUA 3WP1B 2VHJA 1W47A 3EA0A 2QQEA 2GZHA 4HAYA 4C9BA 4F92B 1G7CA 5FUVA 2YOHA 2OUKA 1YKSA 2D27A 1I4TD 2CVHA 4JSTA 1ZNXA 2OXCA 4HLCA 4DRZA 3T34A 2K5UA 2YWHA 2V8OA 2QL6A 4DIDA 2IK8A 2Z83A 4HUTA 1XTIA 3B8HA 1G8PA 4MKHA 1DADA 2GF9A 1QRAA 4FMDF 5E7IA 4XVUA 3B60A 1S1MA 4DIEA 2XNDD 1KDRA 3QQ5A 2XB4A 1GKUB 1N5JA 2O8FB 2OM2A 4QGHA 2J0QA 2Q9AA 3UWKA 2ZE6A 2IW3A 5DYIA 3QIAA 4OHWA 3QXSA 1W48A 2GEUA 2GILA 2ODNA 3CRVA 5JWOA 3U4QA 3QVUA 3QNUA 4D4LA 2O8BB 3CPJB 4PSVA 5H68A 4WAUA 3HDTA 3KB1A 2QMOA 4FMCB 4ERNA 1NMYA 4XOIA 3SJBA 1U9IA 1SVWA 4DCNA 3P32A 5DI9A 1ZIPA 2WAYA 1Z0KA 3QSYA 5HCIA 1YR6A 4IFEA 5EP3A 4D81A 1R0WA 1DARA 4JL5A 3ADDA 4XD7A 4ASUA 2A5FA 4ABYA 1MRNA 3B9PA 3JVUA 4Q01A 1KI6B 4KXFB 4TWZA 1TQ6A 1U0LA 3X2SA 1G5PA 3PUWA 4BFZA 2KWIA 1Z47A 5HPYB 1SKYB 3BB4A 2QM7A 4RD6A 5FR2A 1A2KC 4TYPA 2BM0A 2J7KA 2VPPA 1E0JA 1R5OA 2CE2X 4Q03A 2A5GA 3MWKA 4DLYA 5IRCD 4HI0E 1HT2E 3VR4A 2DYKA 2IUSA 1ZD1A 2PT5A 2D3WA 5P21A 1KSGA 3KKNA 1OH7A 3F8TA 3P4XA 4JKYA 1M7HA 3CB4A 1ZD9A 3U7HB 1D2NA 1NN5A 2I3BA 4I81A 4LYJA 1FZQA 4BLTA 4MRVA 4GZMA 1HTWA 1G41A 5FUXA 4B74A 1FQJA 2BM1A 4FI3C 4UXIA 5C46F 1XTJA 2GAAA 3AB3A 1UPTA 4KYIB 1OXTA 3VU9A 1IN4A 4EJSB 1W2HA 1G1MA 2X2EA 3HU2A 2VBCA 1P60A 3VKHA 2D74A 4TSFA 2QMUA 1FNNA 3W8NA 4F4CA 3WMGA 3U44A 1W0JA 1Z06A 3SJZA 3DZDA 1W0JD 1G7RA 2UZIR 1AQYA 1GL6A 2EYUA 2N1BA 2ZS9A 3MRSA 3L2OB 4W5HA 3E2IA 1VCIA 3GEHA 5KNDA 1VTKA 4JVMA 5KNBA 2QAGB 2REBA 3DZ8A 4GOXA 4Q4LA 3RRZA 4NCKA 4PC6A 1Q1ZA 3LFUA 2ANBA 5TMPA 2NPIA 3JZMA 4FXPA 1K8RA 3TMKA 4A2WA 3ZJYA 2DWPA 1KO7A 3R8CA 4AG5A 4Q4JA 4TLEA 2F9LA 2LWIA 1F2UB 1ONBA 1T3LA 2EWWA 1XTKA 4XTCS 3RS0A 4D6PA 4M1MA 2AFIE 1WBBA 1VCNA 1ZCBA 4DDWA 3V4RA 1SXJA 3RNLA 1R8SA 2C9YA 4E03A 2Q6TA 2ZRBA 5J40A 3EWAA 4Q7MB 5JJLA 4UNSA 2OCPA 3P4YA 3RRMA 2J0UB 4URZR 1BIFA 4LC1A 4ZCMA 1KJYA 2GJ8A 3HPQA 4QL3A 3WMFA 2C5LA 2KJQA 4B73A 2PEZA 2JLZA 1N6OA 2TMKA 3H0KA 3BH7A 1ZNYA 3BH6A 4OJKA 1GL7A 1NSTA 4FINA 3K0AB 4Q4AB 3VR5A 5FBVB 1KY3A 5SZJA 3GLHA 4L9SA 2AWOA 4B32A 4EPTA 5DN6D 4Q7KA 2G0NA 2J87A 1NN3A 4YXWA 2AN9A 3AF4A 4YDSA 4PPGA 5FBQB 1HYQA 5B64A 3PEVA 4J0QA 2EW1A 3LBHA 5C18A 4M22A 3RC3A 2HLDA 3CONA 1G64A 1TMKA 4Q9HA 3EASA 2ZRGA 3OFNA 5EE1A 3RWMB 3U60B 4CT5A 2FSGA 1OH5A 1OIWA 5D3QA 2ZJZA 5EP2A 3IBYA 1SVOA 1K5DA 3KJEA 4PZZA 2W6IA 2XNDA 1I2DA 3V4FA 1Y63A 1D8TA 1KMHA 1SHZA 2WOOA 1XMJA 4M53A 1R10A 2PLFA 2AXPA 2PZEA 1E2LA 2B21A 3KUCA 4BRUA 2IYRA 1JPNA 1XTQA 4PAMA 3I5YA 5JSZB 5EUMA 1AQUA 1NG1A 3NEJA 1G17A 5J4VA 5CYOA 2RGXA 2RAPA 2ZYWX 1NKTA 3QI2A 3QVVA 5IK2A 4NZYA 4OHVA 4LHZA 3T06B 3K70C 1KIMA 2KBEA 2PX3A 4NMMA 4QJ4A 2FX3A 3OAAA 4KU4A 4GL2A 2HV8A 4KJZA 2CJWB 1QVRA 4QHSA 4QBIA 4R9UC 3GEIA 4ILEA 1PV4A 1U2RA 2YWFA 4HLDA 3W34A 4ZV4A 3X1DA 2QT1A 5HZHA 3H84A 3AV0B 4V0MA 2FA9A 3NXSA 2OCYC 3TH5A 3B2EA 3RVBA 1BYIA 2ZSBA 2RGNA 1BS1A 2WZQA 4GMDA 1YZNA 4NHOA 4EKDA 3T5DA 4HDOB 5IDVA 2NPFA 4RD4A 1XBTA 4OI1A 2J7PD 1RW4A 2XTMA 4GP7A 1KO8A 1OHHD 2GJSA 4IEIA 1L7VC 2BC9A 2VP9A 3M6AA 4HAXA 3VAAA 3V00A 2AD1A 3ND9A 4MUAA 2A5YB 5GVSA 4M1SA 2ZI6A 5CJPA 1LFDB 3DKVA 4FWTA 2H17A 1E4VA 1T91A 4I1OA 5JBQA 2HXYA 1XNJA 1XDBA 1GFIA 3TUJC 5FL7A 1FL9A 2QM8A 1GNPA 3VX3A 1GSIA 3N2IA 4II7A 2NO1A 1ZW6A 3BFKA 1M6NA 1U94A 2OHFA 4GDFA 5KNCA 3CW2A 2C77A 3CR8A 1T6NA 3GLFB 3T61A 4NTZA 1G4UR 2PLRA 3L43A 3B7GA 1N6HA 4IVRA 3VHXA 1ESMA 1MH1A 1R8QA 2H7VA 3X1XA 4B76A 4DLRA 2HT6A 2G1KA 4R71A 1US8B 1W4BA 1U8AA 3MLEA 1KI6A 2ZS8A 4XD7D 4Q9IA 5JSZA 1JXMA 1B0UA 3NHBA 2IF2A 4DXAA 2RGAA 4MQBA 4IHQA 3SBDA 5KDOA 2XB2A 2ERXA 4PHHA 4TZ6A 4C0HA 4JLPA 4A15A 4PZYA 4JKIA 2XJ9A 2EFCB 3PG5A 4LBZA 2WMOB 4A2PA 3HR7A 3NC1C 1Z6GA 4OI4A 4QHTA 2D06A 3B1WA 1OHHA 3WNBA 2D28C 3K09A 4LWZA 3U7FB 3BH0A 1UM8A 3GLIA 2WKQA 2V1UA 4BZQA 2XZOA 4RY2A 3UPUA 1RRPA 3CM0A 5LD2B 4DCVA 1G9XA 2NOAA 4G5GA 3TVTA 4TL6A 2EWVA 4PR0A 2O8FA 4XSGA 1AM4D 4TMWA 3GQBA 1W36B 3K1JA 1E0KA 2F1RA 1NNEA 4A2QA 2W2TA 4X8LA 1PVOA 2JJ8A 4IOMA 3K0AA 2IS4A 2VRWA 2ZRPA 4LJ5A 2J0VA 2ZJBA 3O8RA 4Q02A 1Z3IX 2AKAB 4WZAE 5L3SA 2MSCB 3K9NA 2RCNA 2QMHA 2HDNB 3FKSA 1R5NA 4DLXA 3B1XA 1A7JA 2ONJA 2WIAA 3UWOA 5J4LA 2H18A 4FCTA 4BRWA 4XH9B 3RSOA 3VFDA 1NVWQ 3AF3A 5DE3A 5G53C 4ZDJA 3AVYA 2AD5A 3GLFA 2V7QA 5FPTA 3I4LA 1PJRA 2XGJA 5BQ5A 2CL0X 2H57A 3DEFA 1TQ2A 3FMFA 4LZZA 3LAWA 4D80A 3WYFA 2MMGA 3B1VA 1S9HA 5DH9A 221PA 1ELOA 3G82C 4O25A 3F5FA 4JVNA 5FTJA 4TMKA 3GLGA 2GZDA 4AYWA 1ZNZA 3QPWA 1Z0JA 1FW6A 3BFXA 1Q12A 3HP1A 2W6JD 1RKBA 1E2EA 2R6FA 2PCLA 1EFUA 2N42A 3KB2A 4LBWA 2Q3MA 2PL3A 4UKDA 3UG7A 1OB5A 1XPUA 1E2PA 3AVOA 2PZFA 1E9SA 3UXMA 3U44B 3O8DA 3FMOB 3BRWD 4V0KA 1D2EA 2V1XA 2PCJA 5FOSA 1JALA 3UMFA 1E69A 1E3MA 1YE8A 3SR0A 3RRNA 4MYHA 4IDNA 5SZIA 4HUQB 1JI0A 5EZ5A 5KTYA 5CDFE 4YMSA 4HDCA 1Z0IA 3V9PA 2B7CA 3ZS8A 2GVDC 2O0KA 4D2IA 1XMVA 4YMUA 2E87A 2QMEA 4DT1A 1Z2CA 5A0FA 2JIZA 1C4OA 5FOVA 1HEIA 5FPKA 1HY3A 3T1TA 1DTSA 2GAOA 3OE7A 5JRZA 1GNQA 1OE0A 4GRAA 2JASA 3Q5EA 4MH0R 4KFUA 4YQFA 2J3EA 1OH6A 4IDHA 4PANA 4Q1CA 5CK5A 4EUNA 1XF9A 2OFXA 4IOKA 2HCJB 5J4YA 5FTKA 2MSEB 2FFBA 1AK2A 1QZXA 2H8KA 4NCJA 2O8CA 3FMIA 4KSBA 2BBOA 1RYHA 1YR8A 3GJ8A 3TW4A 2JLSA 1YZTA 2D7CA 4QGGA 4B44A 3MG9A 1JR3A 3EARA 4E07A 5K8IA 4O2RA 4B3FX 2P67A 4BFWA 1MO3A 5E7MA 1KDTA 2XXAB 1E9BA 4Y0AA 2XTZA 2ZRAA 4LV8B 3WRYC 5FI0B 3AKCA 4TYWA 1DAGA 2IYXA 4A0GA 3SFZA 2ZI4A 3U3KA 2BWJA 1Q57A 1ZUHA 3H4MA 3L8ZA 4D26A 3DM9B 2O8EB 3KJHA 5FTNA 5DN6A 2GXAA 5CB6A 3NBXX 4DLUA 1X1SA 5AWFC 3SBEA 4RVCA 3SJAA 1UEIA 1M7GA 3LBNA 1W7AA 1UDWA 3GLHB 3B78A 1KK2A 3IIKA 2REXB 1R2QA 3I3SR 1XXHE 1SKQA 3C15C 3T1QA 1AGRA 2WAXA 4W5WA 4BLSA 5KHOC 1H8ED 3Q85A 4XWKA 3AM1A 2R6DA 4BLQA 1W49A 5CJ2A 3QF7A 1OSNA 1AKEA 1EX7A 1SVIA 2W2XA 3LRPA 4CEIB 5F9FA 2ZUDA 3W3AA 4KVGA 4M2LA 1NY5A 1T8TA 2J1LA 2F1HA 1XB2A 2WM9B 3KXIA 1SGWA 4OYHA 2YC2C 3LWNA 4TN1A 1IJEA 2H1LA 4HAVA 4I99A 2ZE5A 1F2UA 3A58B 5E3HA 1KSHA 2QP3A 2X2FA 3BGWA 2X1VA 2G77B 4TQUS 4HB4A 4QGFA 3AVXA 3SYKA 4JL8A 4POAA 2FSFA 3BERA 2XSZA 4G5SA 3KZ1E 3B13B 4GOJA 5CIQA 1T8UA 4KODA 2QU8A 3MMPA 1KK1A 3AGQA 2XITA 2BIFA 5TDHA 1EESA 4B47A 1RPZA 1FP7A 3NBZC 5FUYA 5TB5A 1AJEA 2VL7A 1YZKA 3AF0A 4LBYA 4HAUA 4PC2A 4BFVA 1TEXA 4TMVA 5D3MB 1G16A 3R9WA 2QGNA 1A2BA 4B3CA 5E7JA 5JS7A 2CE7A 3AVTA 4A0HA 3LVRE 1DO0A 3MJHA 1RJ9A 4JLNA 4Q4HB 1N6PA 2FFQA 1N6RA 2WKPA 5TXGA 4URVR 4W5JA 2W2VA 4ESVA 3WHLA 1FMLA 2QEQA 1JQLB 3RSLA 4YMWA 4DLZA 4OHZA 1YR7A 2F43B 5JRJA 3GD7A 1VYVA 1NLFA 2GJAA 1TAGA 1IN6A 4PSKA 4HLUA 2GVZC 3L82B 3Q8XB 1T5IA 3KDSE 2NZJA 4Q19A 3THYB 4CEJA 5GJBA 1TF7A 2LKCA 2PT7A 5KOYA 2A3RA 4IVQA 3W90A 3E70C 4JYBA 4JBYA 1N0WA 1QHXA 2JLUA 5HR5A 1P2VA 2J41A 3HYTA 4LY6A 5FI1B 1Q20A 3O8CA 5JJIA 2OBLA 3WYAA 1KK3A 4KV9A 2QN6A 1RZ3A 1YZQA 3K9HA 5FOXA 2AK3A 1E2KA 2W58A 3FPAA 1XPOA 4DB2A 4KLNA 3QUSA 1QHHB 1HA3A 1UADA 3IPXA 4MDEA 2VEDA 4JYCA 1VG8A 4QRHA 3IIMA 3RLFA 5LD2C 1E9AA 5CIWA 3NC0C 3EG5A 2DWQA 1KMHB 4CIDA 1S8FA 5HTKA 1MO5A 3ZZTA 2PJRA 1J99A 1H8EA 3C7KA 2GJKA 3D8BA 5FOWA 4M1OA 2B7BA 1FNMA 4ZDKA 2NO6A 3SNHA 2CJWA 4D25A 3LW7A 4XIGS 1JR6A 5FBLB 3SOPA 4U7DA 5HKKD 2UKDA 1KYIA 3QXCA 3K0SA 4AYXA 1KNQA 2BKEA 4V0LA 2EFEB 4TL8A 4DDVA 1ZCAA 3CNNA 5GADl 4OQFA 5AJXA 5EZ6B 1G3RA 4Q48A 1FTNA 1X8KA 2RHMA 2VSOA 4N1AA 2JJ1A 5DHAA 2W6ID 4G5QA 4TLCA 2IYZA 1XCGB 4D82A 4JIMA 1ODFA 2GK7A 3A37A 4NYMQ 5KUTA 1XEWY 4NCNA 1F3OA 2AK2A 5C2JB 1YR9A 2ZJ2A 3QBTA 3R20A 4MRPA 5LB4A 2OCAA 3EC2A 1IHUA 4DBLC 4TQ9A 3IGFA 1XTRA 2ZSEA 3W6OA 1QG2A 3CZPA 1Q1QA 1D2MA 2FFHA 1RFLA 2JIZD 1DAMA 1JJVA 3AKDA 3KJGA 3T15A 1NLZA 1SULA 3CNLA 2ORVA 3H86A 3Q7QA 1WE2A 3PUVA 1A5TA 3I8SA 1IY2A 2P6UA 4DZZA 2UVQA 4PO9A 1I4DD 2DHRA 4LYFA 5CDFA 1IN8A 2LCFA 2FGKA 2GXUA 3CX7A 1JBKA 1YZLA 4Q4AA 2WTUA 1CJTC 1Z6YA 4DSOA 1OIXA 4L9WA 1CR2A 3QEOA 4BFTA 4US2R 2XXAA 1T3HA 2IWRA 4ACBA 1P9NA 1KAOA 3ZGXA 1CRQA 4BLOA 1GKYA 3L8YA 3TR5A 4P0TA 4MA4A 3SQXA 4OK3A 1A4RA 3KXKA 3TQCA 4AYTA 2VP4A 2JLVA 1G6HA 1DO2A 4TMXA 1OKKD 4HUQA 4TTQA 3SN6A 3FHOA 4CEHA 1MOZA 4LHYA 1N3BA 2VIIA 4Q9LA 2G0TA 4P31A 2GEDA 4DUGA 2CK3A 3QF4A 5JCZA 1G18A 3OEHA 4KCGA 2QP9X 1D5CA 3GFPA 4TLBA 1GRRA 5AUPB 2YNMA 4D4KA 4UNRA 2R62A 2CEAA 521PA 4A82A 2ZANA 3FB4A 1UKVY 4LYAA 3ICQB 2WIBA 2Y8EA 4Q7LA 3CNOA 3EPKA 2IYTA 2NIPA 1H8HD 4DT1B 1NN0A 4ARZA 3KQUA 1UFQA 2ZI3A 5BXQC 5L3QB 2IUUA 4A0RA 3SYNA 1Z07A 2HEIA 5JHHB 2ECKA 2V6JA 4TZ0A 2FGJA 1E2GA 2IS1A 2XEXA 2KSQA 1MR3F 3PFIA 3OIUA 2NQ2C 4BLRA 1IBRA 1NVUQ 2WV9A 2NGRA 4YXWD 3VNUA 1ZM4A 2BMJA 2IYWA 4V0NA 2ZUBA 4A36A 1UJ2A 1KDOA 2FN4A 4AG6A 2JAQA 2WPDD 2WWIA 3C16C 4M1YA 1OXSC 3CF2A 2A7QA 1FFHA 4CEHB 1E9FA 2ZSDA 3CRRA 3EIEA 3FYHA 2ZQ5A 3DOEA 1IONA 2XOKD 3B9QA 3NH6A 2ZS7A 4OI0A 4DC9A 5EP1A 1ZC3A 2VHUA 1Z6XA 3NVAA 1JPJA 1DVRA 2HYDA 3LQQA 4DSNA 2OZEA 3K9GA 5AUQA 3ICEA 1N25A 2WJGA 4UXJA 1CU1A 2ODEA 2ASEA 2FFAA 3EAQA 4AIIA 1TX4B 3W5JA 4DVGA 3OEHD 4NYMR 4LV5B 2H16A 3FFBA 1JEDA 4KFRA 2CHQA 1Q22A 2OXRA 4BE7B 5JCPA 3EPLA 3IEVA 3A6PC 1F60A 3K70B 2YINC 3OEED 3VQTA 4KHZA 1GG2A 2ZR9A 3GLGE 2Q21A 1SVMA 2VYFA 3SHWA 1KK0A 1Q3HA 1HUQA 4URYR 1P2TA 3GJ0A 1KSFX 1GZSA 1XEXB 3PEUA 1P7CA 4QM7A 1JAHA 2DFKB 1VPLA 3UG6A 5L3VA 3GLIB 3UMSA 1BO6A 3LA6A 3IQWA 1NVVQ 1IOZA 3QXXA 2ZSFA 2QROA 3K53A 2X77A 4YMVA 1DOAA 3CRW1 1R0XA 3ZLJA 3L0PA 3C8UA 4CGZA 2OFOA 3ONWA 3QEJA 3C5HA 4LRWA 4NH0A 3BJIC 4A6XA 1OW3B 2AX4A 4A1FA 1AGPA 5B58C 2ZJ5A 1HQCA 1P61B 2ATVA 2BCGY 2WJYA 1DS6A 3PIRA 4GOKA 1LVGA 5KPJA 4TYNA 2IWHA 4PPQA 1IY1A 2BMFA 3MGCA 1RYFA 4D0LB 4JT2A 2AXNA 1ZRHA 1V5WA 5EE9A 2ODBA 3RABA 4LUCA 2IS2A 4EPRA 3N70A 3R7WA 1OYWA 3IEUA 1M2OB 4OHXA 4B3DA 2DFNA 1GL9B 2P65A 1ZVQA 2VH5R 4PC7A 4BGDA 2XX3A 3C4JA 3QE0A 3ZVNA 2P6RA 1ZC4A 1W44A 5AJYA 4PPNA 3DO6A 4LCBA 2AWNA 4M1WA 5AJWA 4L15A 4LJAA 3CLVA 5JJKA 3UIEA 1WRBA 3FOZA 3PUXA 3GLIE 4Q1BA 4LHWA 1DAFA 3AUXA 3ASYA 1EXMA 2KE5A 2GWHA 5AJZA 4FMCF 4BPBA 1QHHA 3PUYA 1KI9A 4IDPA 1TQDA 2X8AA 2F1JA 2IYQA 3KKOA 3Q9LA 4Q4HA 5HKKA 4PX9A 4BEBA 5DYGA 5EXPA 1GNRA 4GSYA 1P75A 1Z0AA 4C0LA 4S2EA 4C0QC 2H5EA 2QE7D 1CIPA 4B43A 1G8HA 2I1QA 3U3OA 2OG2A 1SVKA 1VG1A 1GRNA 3LO5A 4M1KA 4U00A 5EP4A 4I4LA 2HJVA 4MRNA 3ZIAD 4W9MC 3W8RA 2UZ3A 2WWGA 3OESA 2ZVPX 3DHWC 1U90A 1ZUNB 3AUYA 3GJ6A 3ZZ0A 2YC4C 3THXA 1LY1A 3LD9A 4LJ7A 1E1RD 4K81B 4KSCA 5GJWC 1YJ5A 1KZ7B 4MYTA 5JHGB 1KKLA 4B35A 1ZAKA 4RFSA 5K8LA 4LOAA 3AVPA 2DBYA 3DPUA 1W36C 5F3WB 2Z43A 3A1VA 2BMEA 1G7SA 5F9HA 1SZPA 1VG0B 4GMXA 4P4SB 4AURA 1E1RA 2ZUCA 1DAIA 1SVLA 1W36D 1UEJA 2YWGA 5D3MA 5AK0A 621PA 3CRQA 2FOLA 2V4ZA 1GILA 4OI2A 4A6PA 4U02A 1QHGA 1XXHA 1FMJA 2IT1A 5CM9C 3U3JA 3EPJA 4DJTA 4NU0A 2JLXA 3GMTA 4QJ5A 5JWHA 1BYUA 3L0IB 3SC3A 4OHYA 4Y0VA 1TPZA 2PEYA 1Q3TA 2ZRHA 4TYYA 1YHNA 4HZIA 4M0LA 1KGDA 2QRNA 4KAXA 2ZRIA 1SXJC 1OFIA 1Q0UA 4ZDWA 4A8JA 1S96A 1FPMA 4DLWA 1N6NA 1X3SA 1CS4C 4C0BA 2YJTD 1IQPA 4IDOA 3UKDA 1IJFA 4F38A 2JJ2D 2BDTA 3PXGA 2GESA 3BS4A 3MCAA 2Z5FA 5L8VA 4DSTA 2Q9BA 3THWA 2G1JA 5FH9A 5SZHB 2AKYA 2VQSA 3JZAA 4DLVA 3A36A 3MWJA 2JLYA 1AA9A 1Z83A 4PQFA 1IN5A 1GIAA 3H2YA 1CR1A 1Q1BA 2QI9C 4K46A 3VHLB 1OXXK 2IYYA 4GT1A 1D9XA 2CL6X 3LVQE 1OV4A 4JBWA 3NH9A 4NYIQ 4Q18A 5J47A 2C8VA 4Q1EA 3IUYA 1OFTA 3DM5A 4B3BA 2ZYTX 1Z6TA 4HZUB 5DI3A 3QJYA 3LNCA 2ZEJA 1FX0A 1DAHA 5B30A 1GOTA 4BASA 1RRGA 4NL4H 2EVWX 1R0ZA 3TKLA 1CTQA 2RGEA 4BZXA 1VCMA 5FPSA 4M9XA 1UF9A 1E2QA 3IO3A 3U7GA 1UBEA 1EFCA 2WWXA 4XVQA 4I1SA 3VR1A 2A78A 2JJ2A 4Q4JB 2OT3B 5F2EA 4OL0A 4A8JB 2BV3A 1A82A 4US0R 5FBRB 4BFYA 1W4RA 4C2UA 2JDID 4C7OB 2WWFA 5BW8A 1U81A 2O0JA 4M4SA 4RD0A 1TQ4A 2NMVA 1WMSA 3PITA 3SYLA 4PHTA 1CLUA 3ADCA 2DY1A 2PBRA 4OKSA 3SU8A 4EQ6A 1NLYA 3A8TA 3S1AA 3DL0A 1VHTA 1CXZA 1YZUA 2BCJQ 4LBVA 1UBFA 4LHVA 3X1YA 2C96A 3C5CA 1ESNA 3FTQA 2IUTA 3M1IA 2XZLA 3PEYA 4S35A 1EWQA 4TL7A 4AKHA 4PHFA 4QGAA 5M04A 1KY2A 2QZ4A 3D7MA 4P4SA 4V02A 5CLLA 1N5KA 1TADA 3HU3A 4EAQA 2EU8A 2GDJA 2QTVB 1E79D 2PJZA 5ELXA 3IO5A 2RGCA 1WB9A 4RFSB 2I4IA 5SZKB 4RD2A 3TAHA 1AS0A 4HYYA 3QBVA 2EFHB 5FR1A 4KBFA 4RSGA 1L8QA 4IOJA 2IYVA 2XTNA 4ARZB 4BWYA 1N0UA 1SXJE 1FUUA 4URXR 3R9XA 3A1UA 3Q5DA 1GM5A 2J45A 3T5GA 3NBYC 4HDQB 4KFSA 2QSZA 3RS2A 1XTSA 1II8A 3MFYA 1RRFA 5BYJA 3IHLA 2GA8A 3QOFA 3AKEA 3ADBA 1MO6A 4RZ2A 1E2IA 1AZSC 1T3SA 1U8YA 3OE7D 2IF0A 1K6MA 1CF4A 2YVUA 5K8UA 1QF9A 1S2MA 4ZKDA 3PQCA 2GNOA 3I72A 2O0HA 4NKRA 4M9QA 1YZGA 4M8NE 3RYTC 3H1TA 4PFSA 4Q1DA 2G6BA 4IEEA 2WJJA 4QNRA 2JDIA 1E2NA 2A30A 2WBLC 1RC8A 2VLIA 1R6BX 2YZ2A 4BUJA 4ZIRA 4D0GA 5F98A 1EK0A 1WA5A 3CPEA 1OT3A 1P2SA 4C0JA 1ZNWA 3CWZA 1II0A 5DHFA 5TY0A 4HB3A 1XRJA 4IDQA 4IVPA 2CK3D 2CHGA 4OK6A 1BH2A 1CJUC 2ZI9A 4XWOA 4P3YA 1PUJA 5DIFA 3B5JA 4TT3D 4C30A 1RIFA 1NJFA 1WF3A 4ZI3A 4TLDA 2FSIA 4RZUA 2HXSA 4RD3A 3HU1A 2JJ1D 5E4FA 2O8DB 5BN4A 2W6JA 3MWLA 3CX8A 3SS8A 1HE1C 1IXRC 1H65A 2IYSA 4KI0A 4KFTA 2QQ0A 1HQYE 1N6IA 2VHTA 2ZRKA 2ORWA 3IBGA 5DI3B 4ASUD 4JVSB 2GCOB 2A5DA 4UJ3A 2ZYVX 2QBYB 5G41A 2QG6A 2R65A 4EPXA 2ZE8A 1NP6A 3PR1A 3TVDA 3GLFE 3REFA 1ZMXA 2A5JA 2C2HA 1N6LA 2B8TA 1R5BA 3RS3A 2GTPA 3AF1A 4X8OA 3NBFA 1LF0A 3LBIA 5G3YA 3SE0A 4B2IA 5IT5A 4G01B 3Q3JB 3U3RA 5JWRA 2MSDB 4NPHA 3VTKA 2R9VA 3ND8A 2GCOA 1QHNA 4V03A 2ZM5A 1KAGA 4B3GA 1XJQA 3QENA 1DAKA 3EZFA 3VKWA 3KXLA 4TYQA 2QE7A 1XU4A 2FWRA 4DSUA 3CWQA 2WHXA 2IBMA 3NDPA 1XJCA 2VHQA 2ZJ8A 4DHEA 4F4IA 1SQ5A 4NP6A 3QKSA 3U5ZB 2V6IA 3FFAA 3BAFA 4RKEA 2ZJOA 1QG4A 4MGIR 3GPLA 4TT3A 4F4JA 4UNPA 1P5ZB 2FF7A 4P4UA 3K09C 3MUFA 5FFMA 3UK6A 2JGNA 2MMCA 2QTHA 3AP1A 1E99A 1G6OA 3G5UA 1XXHB 4TMZA 5LB2A 4B6FA 1G8FA 1TF2A 4HAWA 3TE6A 1P6XA 2IXEA 1CR4A 1COWA 4EFMA 3BXZA 4RD1A 4WA7A 4FN5A 4IFBA 4PTLA 2RGGA 4LDJA 1GVNB 3RC8A 4FMDB 1EFHA 4FD2A 4MGZR 3QY0A 2EFGA 2VF7A 1U0HC 3DKPA 4JVLA 1NN1A 2GXQA 3TLXA 3ZD7A 2VHCA 6Q21A 4LV6A 1VCOA 2G83A 4MDFA 3VR2A 2WJIA 3DDCA 5L3QA 3RDPA 2OE2A 4MKGA 4C0SA 1G3MA 4DWJA 2XJ4A 1PZNA 3KTAB 3AH8A 5KDLA 3K9LA 4LYHA 1GKIA 4WZ6A 4RFVA 5IK2D 3VNVA 2ZYUX 4Z51A 1QHSA 5EE5B 5FOTA 2IHYA 1GWNA 2FEMA 3ETLA 1T0JB 1G8YA 2FU5C 2GRJA 1OJLA 2J9RA 3W3ZB 4NCIA 1NBME 1OFUX 2YOGA 2ANCA 4AKEA 4HSEA 1ZM9A 2ODWA 4G5OA 3BORA 5BYKA 1C9KA 2QP4A 3O8BA 4PPFA 2GF0A 5KYKA 2IS6A 2Z4RA 1W4AA 2FH5B 3OEEA 4DUGD 3KQLA 1SVSA 4D4JA 1P3JA 5KDDA 3QKRB 1LS1A 4TTRA 3SJCA 4GPTA 3FWYA 3IPYA 3CH4B 4OQLA 4L8GA 5TV2A 2FZLA 2DB3A 2R8RA 1LB1B 3EWSA 2ZRNA 3BE4A 5AJVB 5H8WA 1CJKC 4KITB 2WJHA 4WXPA 3VKGA 4JJZA 1ZM3A 2P5TB 1VYTA 2BBSA 5CK4A 2D7DA 4QG7A 2IL1A 3OFND 3OHMA 4PQYA 4BFXA 3CO5A 4P32A 2WWYA 2XNSA 4JLDA 1G8GA 1Z28A 4ZPXA 4LGMA 5C4MA 5HE9A 2ZE7A 4U5XA 1JAIA 1O3YA 3N2EA 4Z8XA 1J8YF 1HURA 2P2LA 3FMPB 4CRWB 4LPSA 1KKMA 1KTVA 1ZBDA 1MRSA 5CM8B 3LQRA 2Q3FA 2J46A 4HATA 1P9WA 1R7RA 2OLJA 2KI5A 1ZU5A 3CRMA 4ZIRB 2B8WA 3CUEF 2ZROA 5DLQC 4N0EA 2P3SA 3LXXA 1LF5A 2B92A 1QHIA 4IXNA 1XD9A 4Q1AA 5ANRB 4BFUA 4DKXA 1MT0A 2J0UA 2ZR0A 3TSZA 1OPXA 3QKUA 1Z29A 3CZQA 3SI7A 4AD8A 5JFGA 1KJZA 1P62B 3WBJA 2O8CB 4P33A 1C1YA 3J81k 721PA 2QPAA 2ZTSA 2HUPA 1N5LA 1IXSB 4QFMA 4ZKEA 3QPUA 1DELA 2D2FA 3RS5A 4MGYR 1L4UA 4O0MA 4B6EA 4DEXA 5FOUA 1Q21A 2QENA 1EX6A 2GHIA 4N0DA 1F2TA 5IHPA 1E0AA 2P5SA 4LJYA 1ETUA 4RKFA 2XZPA 2OLKA 3PUZA 2QAGA 2WOJA 2AHOA 3U61B 3E1SA 2D62A 3NEYA 5K8TA 3IHWA 2WPDA 3M0EA 3QKTA 1OH8A 3QPVA 1Z5ZA 4JS0A 1E2JA 2J5XA 4R2IA 1I2MA 1V43A 5KSPA 4FCVA 2HF9A 1G3UA 2NO0A 4NE2A 2ZRMA 1LW7A 2CCGA 4JT4A 5KSZA 4DCSA 5A5GA 2CLSA 1OB2A 4DLTA 4QHYA 5FUWA 3QXJA 4GBMA 2DPXA 4R7ZA 3M4YA 3VR3A 4EIWA 3EW9A 5DGXA 421PA 3HR8A 2ORIA 5TVKA 1EWRA 2QUZA 1NG9A 3P20A 3LX5A 1N5IA 5L3RA 3I5XA 3LX8A 1T4GA 4MYUA 4Q47A 2DFLA 2RGDA 4Z8YA 2ZR7A 3FDIA 3MAAC 1E6CA 3I92A 3CX6A 4F7WA 3QF4B 1G21E 1G5RA 3L0SA 4NYJQ 3WY9A 3ZH9B 5HZKA 4CZ2A 3BFVA 4KO8A 3ZVRA 4JBXA 1E0SA 3KL4A 3LW8A 4ON9A 3LXRA 1X1RA 4QBGB 2A9KA 1YRBA 3TSWA 2GBLC 3KJIA 3OIYA 2I1VB 1E9RA 4EFLA 3Q72A 2PMDA 1N2CE 2JATA 5KU1A 2QRZA 3B85A 2CCKA 2NO9A 4K8OA 2V3CC 4DCUA 1QHYA 1L4YA 2FEOA 3K0FB 2QSYA 1SKYE 2RGBA 3QG5A 1JEEA 1Y3AA 1BMFD 3D6TB 2WKRA 4Q9KA 1NMXA 4KVAA 1DE0A 3T35A 3G0HA 1N0VC 3U6KA 5FL7D 4A92A 1E94E 1J8MF 3CIOA 3RS7A 4IJMA 1X8JA 4TTPA 2QBYA 1PLJA 2IHBA 1CR0A 2RGNC 4UNNA 2VA8A 1BOFA 1NKSA 2ZAMA 3SEAA 1DBSA 1YVDA 2JLRA 5LBIA 1JJ7A 2CLDX 4PC1A 3WNDA 4G3XA 3VMFA 5A4JA 1UDXA 5DNYB 3GFTA 1M8PA 4W7SA 4TL9A 3LV8A 3OF5A 5DISB 2GK6A 3GJ5A 1E98A 1I4LD 4LSGA 4DLSA 2WWHA 2CCJA 2P0EA 1XD8A 1KJWA 1ZIOA 2RMKA 3AP3A 4CEIA 4AK9A 4JLKA 1S3SA 4IKEA 3BOSA 4M9ZA 1E2FA 1Q44A 1TF5A 2OBNA 4URUR 2IA5A 3CPHA 2OSBA 3BIFA 4MYCA 4PSAA 4Q00A 4PO1A 4MRSA 4AY2A 4B3XA 1UKZA 3BBPA 4OJQA 4PO8A 3SDZA 4L4UA 4GNKA 4V0ME 2CBZA 2IXGA 1Z6AA 3U3MA 2DCUA 3CKLA 1ZD8A 5JI3E 3FHTA 4Q1FA 4JJKA 2E9SA 1S0UA 4QOSA 2FPKA 4GFDA 3A4LA 1BMFA 4YC7A 4DDTA 2R2AA 2PZGA 4ZCLA 3TIFA 1KSJA 4JLAA 2GBLA 1VYUA 3OZXA 3TJZA 1XP8A 3O47A 3ECCA 4MKIA 1TUIA 1TNDA 1VIYA 5FPYA 4G1UC 3P1JA 1XZQA 1UBCA 4G5RA 4XJXA 4WVFA 4V0OA 1XWIA 2J0SA 3KQKA 2GCNA 3BC1A 1SHKA
chains in the Genus database with same CATH superfamily
4M8KA 3ZVLA 4ROSA 2A2ZA 3L7YA 3S8MA 5KO2A 4D98A 5BN5A 2GEVA 4KWIA 1L5QA 4R6WA 5BUZA 4O2BB 2FG6C 1AQ6A 5E3JA 3TIGA 3WLSA 4J1TA 3AMVA 4Q6WA 3VTFA 2IY7A 1NWHA 2NXCA 3R0JA 4XQ9A 1MX5A 4EUZA 1XFAA 1GTVA 3FZEA 3WFZA 3N8GA 4WOPA 1LBTA 1E96A 1II8B 3BHJA 1AMNA 1S9DA 1H6AA 2NTYC 3DS8A 1V11B 4S1NA 1YFKA 2YV1A 3WBKA 4GZBA 2OV1A 2BLSA 2Y1DA 3DDNA 2AUMA 4ZJ3A 2H51A 3ZEAA 4EQ6B 3E9EA 5BNTA 1BN7A 3ETHA 2F43A 1T0PA 3OUUA 1SG9A 4BNFA 2Y1CA 2JL1A 3EVAA 4KQOA 3TFOA 1QC5B 3LRTA 2AVDA 2J3LA 5H1YA 1SPBS 5LDDC 5ALDA 1VRWA 5JZVA 4B3MB 1ETHA 2HU5A 2WHQA 1DCFA 4JWTA 4FFBA 4NR0A 3IWOA 3GLUA 3P0HA 4RO0A 3DLHA 2EATA 1FCMA 2L42A 3L6EA 4YCAA 2FMFA 3Q2OA 4A9AA 1P77A 2MT9A 4RLQA 3B6JA 3P26A 5T64A 2XTAA 2Q3DA 4KQKA 1YM1A 1D3AA 1Q5PA 2GYWA 2PKXA 3QFTA 4DCTA 5AQEA 2XF2A 1TMOA 4N12A 5CB8A 5CIYA 2C03A 4UNIA 3AVWA 5IAAA 1N2CA 1UBRS 3EEIA 1IY0A 3SIXA 1XTVA 4OQXA 4UOQA 3VU8A 3U6BA 1CUBA 1ULUA 1EX1A 3L7IA 2Z4SA 3MJRA 1IPHA 5KZHA 4OK5A 4HNQA 5CH8A 4CI9A 5CFZA 4DR4C 1J39A 2JHGA 2Q6KA 3MQ4A 2LR0A 2R1VA 2XAUA 1TPYA 1EE9A 4O63O 3RHFA 1J2EA 2GCPA 4WZBE 4HB0A 3AEZA 3ZIUA 1AKMA 1S8NA 2CSUA 3K1YA 3LGSA 3O73A 3UN7A 3DO8A 3C6BA 5C5KA 2SCUA 4HWKA 1ZKDA 2JS7A 2FNAA 2Q41A 3BWLA 3NOQA 4PRZA 4U6NA 4XPZA 4E2YA 4H4DA 1UAAA 4FCWA 3DDOA 1FQWA 1L7XA 5G0WA 5EM1A 1HDYA 3N5KA 1ZH2A 4OSPA 5FULA 3THWB 2QG9A 1U9ZA 1E2BA 1TM4E 2O8DA 1VKJA 5L9AA 2Q2NA 3E9QA 4YT5A 3H1AA 2CN1A 2OP1A 4G4SO 3ZG8B 2E0IA 1OBCA 3TQFA 3HCYA 5C80A 4F91B 4KXQA 3PAEA 4EB3A 4DB4A 2M98A 3A9UA 3GB9A 2MWMA 4GLJA 4IMIB 5TS2A 1WD7A 4NBSA 1CQAA 1P73A 4PMAA 2XVYA 4IJKA 2AE2A 2PRZA 2AXQA 1EW0A 2NU9B 1P1RA 1YU9A 2ZMVA 1YBVA 1YDGA 2QV7A 3FNHA 4FFVA 4DUZC 1KEEB 1LZKA 1XALA 3KUDA 4TS1A 4RHTA 4EG6A 2DU8A 2R84A 3AKYA 3GCGA 1RVDA 4PONA 4D46A 3PEWA 2GBIA 4ZFNA 1UDAA 1V41E 3DXXA 1WSBA 4XFDA 2JI4A 4D6YA 3TZKA 4B09A 4CMAA 1YMXA 2GA9A 4I5SA 4Q7JB 3SBOA 2DLNA 3GVHA 5T67A 3BWDD 3ZQ6A 3RAEC 3OZBA 4AJNA 5KTNA 3KT0A 1BE6A 1FMCA 1UBTS 2FRVA 2SICE 3I2GA 1YA6A 3E61A 3GTCA 3EOIA 2OG1A 3DAVA 4YV7A 1J06A 1SXJB 5CBPA 5J2UB 4UVIA 4K9QA 3OIVA 4EFNA 3LNTA 2ZWMA 3CT6A 1C4XA 1INLA 2NVWA 3DBIA 3LQKA 4CTMA 3SF0A 3RJUA 2C4MA 1THGA 1TJ4A 2BEKA 2ZRJA 5JEEA 5GGYA 1BKYA 1NAIA 1L2TA 3C4VA 1H0MA 2D13A 1IB6A 3VOAA 1XF1A 2XUQA 1F7VA 3ZYTA 4NIMA 3P9NA 3QWAA 3HSSA 4PFQA 1UJ5A 1T8SA 3ER6A 2X4IA 1VLHA 4NOLA 1SU8A 5CPBA 3LUGA 1K3TA 2A1TS 5DJUA 4WD3A 2IU0A 3IQXA 1K7CA 2VGKA 3HMQA 4JUCA 4E5KA 3EZ6A 5NLLA 3ZWKA 1SKAA 4LYYA 3H2JA 4MVJI 3WC4A 5AVEA 4AMUA 4WERA 3ZVMA 3PJRA 1PEKE 4Q21A 2GZAA 3PRYA 4BV9A 1WHSB 1YASA 3NJ8A 4HEFA 1H4VB 2JA1A 1NJ4A 2NYVA 2Q62A 4MEAA 4OGGA 1CWUA 1UAGA 1DTWB 2BOVA 4M38A 5M2QA 1WKBA 4G0PA 3WWOA 1ZLXA 2A92A 5FTMA 5SY9A 1V8PA 5HGXA 2GD1O 4QTZA 3IVGA 4Q3DA 4GL4A 1CE8A 1AQIA 3EZLA 1YAJA 4NF2A 4XRGA 4FFBB 1K0UA 4X68A 1ESDA 2P2MA 1JA0A 4L3VA 4U3JA 4AO8A 2PKQP 3RRBA 4D0NA 3CZCA 3H1GA 1NI3A 3GFRA 4JLVA 4IXDA 4R70A 1XX6A 4JJAA 4LRTB 4CLXA 1FNDA 2CMDA 3GNTA 1U9IC 1HOXA 3JQ8A 3WYCA 4YAGA 2H4XA 2GN2A 4P9NA 1H3QA 3TGPA 1A72A 1PNTA 1BKDR 3QLVA 5MN6A 3EGDB 4OM8A 4OOMA 4MV8A 1KU6A 1M2KA 1H2BA 3H11A 2V6FA 2X7XA 4AX8A 1VSBA 1QCYA 3CNBA 3H9CA 2O2HA 4FHFA 3QWBA 1KAQA 3CZ4A 1ZOPA 1T9HA 3H0EA 4P6VF 4QEKA 1OZFA 4ER0A 1RYMA 1JIUA 2BKUA 2OV5A 4RGBA 4EGQA 5JMTA 4OQPA 1FC0A 1XEFA 4BNGA 2PX0A 4RYEA 1CQJB 3G68A 3VU9B 3Q88A 1P72A 2PMFA 3HHPA 3DKIA 3O3OB 4X8HA 4WZAB 5H3LA 4YLGA 3IR5A 5H3HA 3SE7A 3RFXA 3KX2A 4OSOA 2CHVA 1VE5A 3E98A 4XOUA 1BFUA 4ZVSA 1MOQA 1GCEA 5TLSA 1Y5RA 2EBUA 4LYDA 1GSAA 2MINA 2W0MA 3CMMA 5EXSA 4COOA 5ADZA 4F60A 1XMPA 1JXOA 5DXAA 1RYYA 1VLLA 2J4CA 2Y0DA 3KVRA 5EGNA 1VECA 4QPPA 4AZSA 1TKAA 5F7OA 3AY0A 1VPVA 1XN4A 1EVQA 3ABZA 3MWYW 4P8RA 4AN0A 1J5PA 2P30A 2R1ZA 3V1UA 1MBLA 3MIIA 3QKSB 4M54A 1I7NA 2QD1A 5GP1A 5IARA 1FXWF 2I3GA 4QELA 3LLUA 1N0IA 3UWDA 3MSXA 2V54A 3S7OA 5KYXB 5G1OA 1W52X 4TWAA 3UPTA 3NVKI 3AVVA 2H2GA 1WS6A 5CLQA 4DTIA 5IBCA 2F1KA 1Z22A 2FG5A 1IBKB 4JI0C 1N7JA 2MDTA 1D7AA 4PYNA 1DG3A 1X14A 1IYZA 3C14C 4HVLA 3FZYA 1WZCA 1GZUA 2HOQA 4OCZA 4Z0PA 5IULC 1VLZA 5J2TB 3WWPA 1E5XA 2W2QA 2XH8A 2I4RA 1ZMTA 2NU8B 3EA5A 3T50A 1COWD 2D2EA 2F8LA 2QR2A 2QTLA 1NUSA 1XKQA 3A6HA 4UQPA 2W6MA 3OOSA 2J9PA 4C87A 3BQAA 1T2DA 1GTL1 1DAOA 2QRKA 4R8RA 1F4LA 5JAUA 2GPWA 1XPJA 1D1QA 3BCRA 4HGOA 4DA0A 3THOA 2I3DA 4MX8A 4B4KA 1XJ5A 5LU9A 2NSLA 3EEAA 2UYGA 1A5AB 1B2LA 4IFTA 3EQ6A 1P2UA 4IIFA 5H16A 1HDXA 2PXXA 2QT0A 4MWDA 4OM7A 5DYWA 3WS0A 5DLEA 1EGAA 2O8BA 2WV7A 2HJGA 1CJSA 4E3MA 4PICA 1KKUA 1A88A 3Q41A 1Q6YA 2IQIA 4TZTA 4C3OB 5KJFA 2RGWA 4LAFA 1QHEA 4IY1A 1QF6A 2ZRFA 1DC4A 4YAWA 3L49A 5EWMB 2X23A 1FYWA 1WF6A 3SZ3A 2J7PA 3F1NA 5CGXA 5HDDA 2MSWA 3H17A 3PDCA 2ZITA 3QJGA 4O4IB 5DB4A 4ZRNA 1ZVMA 2BMDA 1M8JA 4RAOA 3WLQA 1QKIA 1T34A 5IASA 2F8TA 1FDSA 1L5FA 1LDBA 2EZ8A 3M7IA 2WGWB 3FDZA 3NBQA 4G0VA 1HTZA 3OJWA 5EUQB 2W83A 3H6HA 4K2HA 4QU8A 1A9YA 5EPOA 1MABA 3FKVA 5G18A 2WT9A 1E2DA 2ZREA 4WV3A 3JWJA 1KERA 1O5TA 3JQGB 5EQTA 3OAAD 4L76A 2JLBA 3H19A 2WHYA 3CPSA 5KQPA 4LX0A 2ZZKA 4QC2A 2VQFC 1AIPA 3FHCB 4OGWA 4LRYA 1PV2A 4B4VA 2HA6A 3LZCA 4IRUB 3TOCA 5TR7A 2VCYA 3HLTA 4P2GA 2AZMA 1KO4A 3LLMA 3NUZA 2A4KA 3A1WA 4QOGA 4YJFA 1VKHA 1TFRA 3FUTA 4A3SA 2VTVA 3RSHA 2D5LA 1GPH1 4QTYA 2AMJA 2R00C 5TQJA 3UMRA 4C0XA 5BWNA 4QD4A 2Q7XA 1CKEA 4WA8A 1ZI9A 1NM5C 4OUKX 4ERXA 2JVIA 3R3WA 2XWJI 3FOFC 3GFVA 4IHAA 1RIIA 4HMPA 4OA5A 1U6KA 1E32A 5DLDA 4MUKA 1TH5A 2GVNA 1M66A 1HYBA 3LH5A 2YYSA 2FI1A 3NDJA 3DC2A 4IH4A 4CG1A 1YAHA 3DMDA 4Y8VA 1VG9B 1BDJA 3OBIA 1UZUA 2A0XA 1TLLA 1YUBA 3O2JA 2DKNA 3I61A 3EF0A 4EW2A 3IUNA 4N5NA 5HCNA 1UQRA 1VL6A 4KOAA 1U60A 2VLBA 4UA7A 1ISHA 4CYMA 4EPYA 1HDRA 1FVXA 3NCTA 3VFFA 2CNBA 4I9HA 1JAZA 2HDOA 1BE0A 2P3OA 2XUJA 1WG8A 3CZ5A 3PXAA 5TE9A 3WYBA 2BCEA 3GJTA 5J4HA 4FB5A 3JVVA 5A71A 1E2MA 4GPD1 1FRQA 4JZKA 1D6NA 1E64A 4Y1RA 4B75A 3HZRA 3ZDJA 4FC6A 4WH0A 5LYJF 1U2ZA 4F56A 5K3EA 1H5QA 2WYHA 3O2SB 4LOLA 1EVEA 5D1NA 2EQBA 1BROA 2BHSA 3PVSA 1IEMA 1VMEA 4JB0A 4BQFA 4G36A 1I2BA 1M34E 1S3FA 2WSBA 1Z6ZA 3MAGA 3QOXA 4G97A 5F7ZA 1NW5A 3BKXA 4TTJA 3FJ1A 1E6KA 1KOFA 5CYPA 1IWBB 1PS8A 1U9YA 5A1JA 4WBSA 2NWQA 1U0RA 2C2GA 3E3MA 2BFNA 3LEQA 3UM9A 5KPDA 1O94D 1CP2A 3OCUA 4EMUA 2LZ0A 5AI4A 3WZ2A 1DKOA 4HEJA 1HBJA 3VU0A 3HJAA 1XPRA 1HPLA 3TIXB 2CV2A 1GPMA 4WY2A 1FQKA 3MTBA 3TLEA 5A4FS 4X6LA 4M1EA 3NV9A 5D8DA 5FP0A 2IX3A 3H04A 1F6BA 1YC5A 1NVEA 2VSXA 4R54A 3SZLA 1XD2A 5DFAA 1N92A 4UJ5A 3UA4A 1KHTA 1AZTA 1K9SA 2WIGA 1G5HA 4QNMA 4MUBA 4OGLA 2Q4BA 3TZBA 3W78A 4J0DA 4O33A 2HHAA 1QCZA 2EX0A 3DVLA 1GUZA 2REOA 1AS2A 4JCOA 5EERA 2AG1A 5HDBB 3AL2A 3PT9A 3VR6A 2V7QD 3W04A 2BFAA 1HZZA 4UOEA 2DFTA 1IZYA 1IN7A 1EFPA 1FVOA 1Z2DA 2L1MA 2CDNA 3HGTA 4CM1A 5JC8A 3O5YA 4OMUA 1P4HA 1J42A 1ZFNA 3R09A 1U8XX 2Z2KA 1PIOA 3T3OA 4XYEA 1U2DA 2IEYA 1D03A 2XOKA 4B3TC 2FZ5A 4NMXB 2YJZA 3PEFA 2QOEA 2UYOA 4WINA 5AKZA 5E9QA 1IVSA 2QBYA 3JYHA 5A9RA 2Q4TA 4MLCA 4X93A 2NO7A 4FZRA 1BGXT 4O4HB 4H8RA 1Y82A 3QFCA 1I7SB 2AOUA 3P4UA 4LTNA 2C83A 2O6HA 5EXTA 4X1IA 3O8OB 3DTVB 1XRCA 1NJGA 4IBXA 1QV6A 2CFSA 4G9BA 4H1UA 4NMLA 4RCZA 3M6BA 3Q11A 3WHKA 4Q1VA 3DR5A 1E1QA 3ZS9A 2WG1A 4BVFA 3UBTA 3BQMB 4QY5A 3MTGA 3OZRA 3NAQA 3T9AA 3SVLA 4L28A 4M9SA 5HWWA 4QBFA 3W4JA 3R6DA 1F0PA 3UZ0A 2OBFA 3WNCA 2WD8A 2B5WA 4HB2A 1JA1A 3HSKA 5B6IA 1YNSA 1X7WA 1VL0A 3FPHA 1FDUA 3KFVA 3VAZA 2A3UA 5FQ9A 4HK4A 3SZRA 1RKVA 2ZJ3A 3VZRA 1NR7A 3VOYA 2XLCA 1ENOA 3MCUA 1FCJA 3NRBA 4IIGA 4D9EA 5LM3A 1FU8A 1P8AA 2I4LA 3IWIA 1SBCA 3O82A 4ALLA 3KRTA 1PGNA 4MHTA 3KIPA 4YPOA 3GUCA 3C7CB 2PH5A 2UZ1B 3IBCA 1W0KD 3NANA 4PSCA 3SCZA 1J2JA 2HA7A 2ZPTX 3KHKA 3PKJA 2ATWA 1XMIA 1C7JA 4ZI7B 1EFRD 1C7RA 1G5TA 2GN9A 2FDCA 1F5NA 3RWOA 3H18A 4B83A 3ASZA 2FB9A 1Y1KE 1RYZA 4I3AA 3OZWA 4OA8A 1KJ8A 4ID3A 4D9BA 2YHSA 1O8BA 2ZVQX 5JAZA 4KAFA 2IJGX 3I9MA 2Z3ZA 1OKKA 2GBGA 4LC0A 4F6LA 1ZW1A 3EH1A 5C3UA 4KLCA 1UWLA 3D3QA 4UUOA 1RJ9B 1TZCA 1EGVB 1W1IA 2VATA 1PZOA 1DTEA 3DP7A 3R3XA 4LF7B 4P3OA 1N75A 1WXGA 1X80A 3AEYA 3HXQA 1YL5A 3E4PA 4FUQA 1NPTO 1T1JA 4TV9A 3ZWNA 4LJLA 1ZHFA 5L3ZA 4BJ1A 5A5VA 1XC7A 3B3JA 1PWHA 3GLGB 1L4EA 1FYDA 1ZC2A 5CX4A 1ZCJA 4KPGA 2HF6A 3HCAA 4WK0B 3BD9A 3A2NA 2HHHB 1RWMA 3BQNB 3QE2A 2IZ1A 4CEJB 1GT91 1W7FA 1MABB 1YQEA 2JCBA 2XOEA 1VP3A 4HVAA 4ICIA 2RH8A 4YAKA 3HJNA 2JIBA 3Q0IA 4HAZA 3GSGA 2Y93A 3STVA 4ARVA 3A6KA 2QJWA 4ZD6A 2GBCA 3TAUA 1B73A 5K05A 2TYSB 3F73A 1M7BA 1XG5A 1PS9A 2E0GA 1SVUA 3QNMA 4NJOA 1IQRA 3UJ8A 3AY7A 2JEOA 3L7AA 4INPA 1PL7A 1WCIB 3N05A 4WJKB 3TRCA 4PGHA 5DGHA 4JQCA 5EHNA 3V7FA 2ONCA 4ALKA 4ZK6A 5C8YB 4DA6A 4CPKA 1HDGO 1HNXC 1OXVA 1QBKC 2D59A 1TC1A 2JN7A 4HQFA 3G0BA 3SC2B 2OAQ1 1U99A 3VDQA 2QZ6A 5B37A 3RQSA 3WISA 3BMOA 2VHJA 4UC0A 4CL0A 4UHDA 1VPWA 1SCWA 1C9EA 1G7CA 1K8XB 3DBVO 3Q9UA 2IPAB 4JU9A 4PZDA 2Q4RA 3QH4A 1YKSA 3JTMA 1I4TD 3IAXA 1SCBA 5JH7A 3G89A 4AT1A 2CNKA 4F45A 1DC5A 4UTVA 5CGSA 4P5EA 3V4PB 2YWHA 3I3OA 4JYZA 3PWKA 2QL6A 3ITEA 1XJ4A 3B8HA 4MKHA 3UAVA 1ZPDA 3AR3A 3CISA 5E7IA 3N7UA 3KDPA 3ZW7A 1KDRA 5EINA 1GKUB 4G4SP 2PS3A 5J2TA 1MQAA 1PEYA 3Q1LA 2BGWA 2O8FB 5AO9A 3U3XA 2GYVA 4D9FA 3LWBA 2P5UA 2FPRA 5BSVA 3WLTA 3KJNA 1GT6A 2GEUA 1KQNA 4H0CA 4YJ3A 5T5QA 3QNUA 5FA5A 4BCDA 4D4LA 3ACDA 3SC4A 1DIGA 1M6YA 3CPJB 3CXRA 5GHXA 3A1EA 4PSVA 3LNVA 2BFDA 3HEMA 5H68A 1GZ7A 3S1YA 3GDWA 3MBOA 1MB3A 2OGZA 4FMCB 2BI4A 3Q8LA 1X39A 3W9UA 1N9GA 3A0RB 1YZ3A 3SJBA 4AMBA 2ZBRA 5TF0A 4RJTA 4L9RA 1KIAA 3G2HA 1ZIPA 5EMNA 3F6YA 1Q16A 5CCDA 1ZMBA 4QSMA 1DARA 3KSGA 1T3GA 2Y76A 3KE9A 3DYBA 2JKGA 1B6TA 4R5HA 1PJSA 2YX1A 4XD7A 3EQVA 2CKDA 3VH1A 4ABYA 3AU8A 1RLTA 3H6GA 3NEJA 2WABA 3QHPA 3TJZC 1MRNA 2P11A 4KPYA 1YS1X 1NQVA 3ADOA 4MVJG 4MBFA 4Q01A 4G9EA 4L8VA 4Y30A 2WUVA 4QPZA 3C7VA 1PQYA 1QTQA 1SKYB 4CM3A 6REQB 1NW4A 4RD6A 2UUBB 1EK1A 2NSYA 1GGVA 1JKJA 3AR8A 3KEFA 4Z1WA 2ACKA 3PFBA 2V20A 1EQ2A 1NUTA 4UDOA 2CE2X 2CLIB 2A5GA 1BW9B 3MWKA 4LA4A 4Q03A 3CVXA 1CG6A 3T5AA 2XRFA 3VR4A 4YR9A 1PZHA 1Z73A 2HJWA 3LTNC 1PGQA 3LAXA 3NFRA 5AI8A 4R2KA 4UU8A 3O92A 3KKNA 2EKBA 4YQEA 1OH7A 3EGDA 3F8TA 3P4XA 4O4LA 4JKYA 4MUNA 3GHYA 1ZD9A 1N34C 3G6KA 1D2NA 1CDZA 4R1NA 6GPBA 3EGWA 4XDZA 3EOAI 3JQDA 4D6XA 4QQNA 1L5WA 1YBMA 3RE1A 3W1EA 1R15A 5CNJA 4B74A 2E8IA 5FI7A 1FQJA 4RMGA 4XDYA 4ZQFA 2BM1A 4UXIA 5TEWA 3U3DA 3V9AA 1M0WA 4MUIA 4CKCB 1Z09A 2HDUA 1FMFA 1UMCB 3FPJA 4KK3A 3AB3A 3WG9A 1OXTA 4JX8A 4DIKA 4F06A 3SP1A 4D8VA 2D5AA 3ABSB 3KOOA 4ZJYA 1YQGA 1VHJA 3NX4A 2PKQO 4B3MC 2Z2MB 2D74A 4TSFA 4IWNA 3NIAA 1J07A 1KDSA 1JG6A 4GQBA 3RJZA 4EM6A 4JNCA 3SJZA 3DZDA 1H0HA 3DFZA 2UZIR 1AQYA 5CU7A 1GL6A 3MRSA 4ZOAA 2H1OA 2V1AA 1O95D 5CVDA 1F2VA 1U7ZA 2VPWA 3GEHA 3K4PA 3C3CA 2Y79A 4Y6QA 1TO1E 4GHWA 1UFVA 4RKYA 4X3OA 4NXNB 1XA7A 1NV8A 4PC6A 1BCSB 1Q1ZA 3R77A 2G7MC 3LP5A 3URKA 3LFUA 1HZJA 4JHXA 4ZEOA 2NPIA 4UMFA 4CLRA 4JI4C 4FXPA 3NONA 1L7NA 5AW0A 2DWPA 1HZOA 2ZMFA 1DOHA 1KO7A 4K9DA 1G42A 5E2IA 5C8ZA 2HIGA 5DNUA 4YJGA 3HVUA 4X24A 4S2IA 2EWWA 3PQ4A 4D6PA 4M1MA 3QHYA 2H2IA 3OMLA 1VCNA 1ZCBA 3WJ1A 1SXJA 4I5IA 3D7RA 5I48A 1R5JA 4P1ZA 1RWXA 3FPWA 1NRWA 3KV3O 5J2TF 4ANFA 5KVAA 3E3OA 2ZRBA 5COQA 1RQNA 1SJ9A 1WTAA 3ZNPA 4QUJA 5K2OA 3OWXA 1CIVA 5JJLA 1LDYA 2ZB2A 5IBRA 4GGOA 5L51A 2YXLA 4URZR 4INZA 4CCWA 4ZCMA 1M6VB 1EJ6A 2PMWB 3WKBA 1UXGA 1FK8A 3ZTTA 1CF2O 3P2MA 3UTDA 3NJRA 4AZ0A 2PS1A 2BKLA 3CX3A 3OM8A 3QFFA 5ECYA 5CXQA 2JLZA 4CPDA 3SMVA 4E46A 4YUAA 3FXAA 2Y91A 3KPYA 2H7YA 3KYEA 5HM8A 1AZLA 1K4KA 4LLOB 1NQOA 2Q3LA 2ZSKA 3AONB 4I5EA 4LGCA 5ILOA 1PR0A 2FEWB 3DGEC 3O2EA 3K31A 3O03A 5ERGB 4B32A 4Q7KA 3FYSA 2J87A 5AM1A 3IKMB 5HQJA 1RHQA 3AF4A 4QFCA 5FBQB 3ZE6A 2G17A 1IUPA 1FLAA 1RHMA 3MJ4A 2PSEA 1PL8A 4M22A 5BT9A 3PNLA 3UGQA 3VYUB 1SKBA 5FEMA 4NMWA 2OFFA 1Z5OA 1V5FA 5DJTA 2HMUA 4NNOA 2FQ1A 3QI7A 3RWMB 3O9ZA 1M76A 1N2GA 2X0RA 1PFGA 5COBA 1MLDA 4IV8A 4OQZA 3N28A 2X40A 3P2KA 1K7SN 1OIWA 2AN4A 1Q7RA 3BK1A 3BD7A 4PFJA 5D3QA 4A0QA 2JLUA 4J1SA 3KJEA 4PZZA 3HY6A 1R6DA 5KAPA 3HV0A 2IELA 1VSQA 3VP2A 2P68A 3VR6D 2I87A 3C0KA 4EFKA 3DLBA 1XMJA 3F98A 2PLFA 1SELA 2FK8A 3LC1O 1V2GA 2H65A 3KUCA 1M1UA 3MS4A 4QTXA 3CH7A 3RB8A 4ENRA 5I7WA 1JPNA 4J4TA 5I4CA 3I5YA 4KJXA 3SEZA 1L7DA 2HP5A 1AQUA 2FPWA 2Q1WA 5J4VA 5CYOA 1YIAA 1UODA 2RGXA 3HI4A 4WFKA 3QVVA 3AF6A 2RARA 5JRHA 4OHVA 1BLPA 4MQ5A 4LHZA 2FZ0A 3T06B 4N3AA 2G2UA 1KIMA 3K70C 4DR6B 2XYHA 3CB2A 5EJ9A 2FX3A 3OAAA 4KU4A 4QFBA 2JMPA 5FJJA 1GPKA 2NYRA 2BGIA 4QBIA 4R9UC 1L4NA 4K86A 4O5OA 3MHTA 3GEIA 2BFEB 2G7UA 4E3NA 1E60A 1U2RA 1R4ZA 3EDRA 4ZV4A 1GJRA 3A3DA 3DEAA 2GZSA 3H84A 1PWGA 3E35A 4LY9A 4P0PB 4V0MA 1H3NA 1C3EA 4L8WB 3Q7VB 4MROA 3W2ZA 3B2EA 4H7IA 3PXDA 4Y98A 4BPRA 3RTEA 3SSAA 1ORDA 4TV8B 2LXNA 5DBEX 1GSHA 1PJLA 1XOIA 1OZ0A 2L4RA 2O48X 2P69A 1L3IA 3IQZA 3A0VA 2RGNA 4FFLA 5IYZF 3EVNA 4NK5A 4QIHA 4GMDA 4NXFA 1BQEA 1HL3A 5M18A 1QZZA 3FNGA 4M60A 3REQA 1WW8A 5EIEA 4O08A 1M1NA 2ZDHA 5IVIA 5C5CA 4YRFA 2FUNB 3QYAA 5J23A 2YBEA 2XTMA 2H0QA 1PHPA 3BIOA 4KRYA 4OYCA 2VDWB 5LP6A 3RVPA 2YXBA 1J5XA 1L7VC 2VP9A 2WJZB 2E7ZA 4IEIA 5CVEA 4B82A 4YINA 3ISGA 3HQ4O 3ND9A 3W2EA 4R4SA 2A5YB 5GVSA 3Q6IA 1AKTA 4FWTA 2H17A 1E4VA 1T91A 1T9KA 4I1OA 6AT1A 2OHOA 1OGJA 4RQ9A 1ZUNA 2F4VC 1IOWA 1YDMA 1DP4A 1H1LA 4EWLA 4L85A 2V03A 3MMNA 1GSIA 3JATA 1R16A 4RF3A 3LHDA 1U94A 3DNPA 3MWGA 4Z5XA 5HIMA 1LNQA 2C77A 2HCTA 3KZVA 4TKZA 1Y8ZA 1M73E 1K2VN 2PDAA 1QR2A 1A9PA 3GLFB 3WIOA 3VC2A 3NULA 1NAHA 4Y67A 1NQ5A 2QYHA 1GU0A 4KHPC 2H7VA 4YR7A 4WOJA 3GAMA 2BW0A 4MNTA 1VKRA 3NT2A 4R71A 3TG8A 4OLBA 4FH2A 1DCMA 4Q9AA 1A04A 1U8AA 2Y1WA 1KI6A 4EGFA 5HOQA 4XD7D 3HLGA 3U40A 1QO7A 3PQ8A 2KOIA 3MSHA 1DJNA 4GF5A 1XMQC 4M87A 2WHEA 5KNCH 5E9JA 2FCRA 2ZBBA 3B5EA 5AVRA 1CUIA 1SD5A 5DW0A 3BYDA 3SHOA 3VZCA 1NC1A 3PDIB 1L5RA 1QAOA 4MN5A 1Q2QA 2ERXA 4H77A 2JCYA 4A15A 1TZJA 4NMHA 1RZRD 1F7UA 1YVPA 3AJRA 2G1AA 3IUEA 1EUDB 2HPAA 2UZ1A 2GHTA 2WMOB 4MW9A 2D0DA 3WLKX 2VDOB 1Z6GA 5HNKA 3D3EA 3RUPA 2NXEA 3ZDCA 3O84A 3WLHA 5TBMB 1QANA 5LA6B 4FSFA 4W99A 3DC7A 3KB6A 2G9QA 2NUPA 3BH0A 5E2GA 1GTJ1 1UM8A 4GR5A 1Y89A 3DE5X 4ODJA 4L4YA 3RIHA 1GZ4A 4CI0B 2NQ8A 3IURA 2XZOA 3WL3A 3DE3X 1ZOIA 2QN2A 3CM0A 5KMGA 5LD2B 4J9UE 1G9XA 4XRRA 5K0BA 4G5GA 5FCDA 2C2WA 1WHTB 3O4IA 4CIWA 3N54B 2QL8A 5CEBA 2P2ZA 1A7AA 3T1SA 3R3ZA 5SYAA 3ZW8A 4ZOLB 2JG3A 1K27A 1BU8A 4BYMA 2Q5OA 4B4XA 2VKTA 3II6X 3RHTA 2JFPA 5IDXA 1HDIA 5TJJA 1E0KA 4K1XA 2IS1A 1QB7A 4X8LA 2MCQA 2JJ8A 1JX6A 4MRMB 1VKZA 3K0AA 4TS4A 2G76A 2VRWA 4W82A 3RKRA 5CDSA 3OY7A 2FMUA 1V1JA 3O8RA 3JVDA 3FJOA 3HXKA 4OJNA 4Q3KA 4CV1A 5L3SA 4AS1A 4BO2A 2HD4A 3LI9A 2JBWA 3EHDA 1DJMA 1GUBA 3UWOA 1GDHA 1H2XA 3OCJA 5TGDA 5IJ9A 4R1LA 1BGWA 1F14A 3D1VA 1X7XB 3WGHA 2E4ZA 3C6YA 3RSOA 3ZHXA 1PKEA 4P92A 2IFTA 5HRUA 2IDMA 2GERA 2VH2A 4FE3A 1OD6A 1R66A 1SBZA 4P93A 3U39A 1CHNA 1H0SA 4NENB 1PQUA 3OQHA 4AFNA 5EN4A 4FIZA 3GC6A 2KZ0A 5B6JA 4R23A 1IYQA 1LA2A 1PR4A 1PJRA 3RFVA 2CL0X 4L8LA 1QMEA 1PAUA 1TQ2A 4V2UA 1OZGA 4IDGA 3UVEA 5C4IA 1C5KA 2GKGA 2MMGA 4O25A 3VTAA 4L4QA 1ZGGA 1CY6A 2BFPA 4LYEA 5T4EA 3V8PA 4G8BA 4JI2C 3UNWA 4Q8IA 1RT9A 2D5BA 2LV8A 3DMTC 3EZXA 4OF4A 1UWNX 3RS8A 3QPWA 1DZIA 2IVZA 4FOFA 4XQGA 1PNRA 3HP1A 5A7HA 1YAXA 5LZ8A 2VQ6A 5EKTA 2W3EA 2I22A 4HX2A 1EFUA 1ODCA 3KOMA 5L4SA 4J0GA 3MKFA 3UG7A 1B93A 2PO5A 5CGQB 2HWWA 1XRRA 5LL6P 1JNUA 1E2PA 1M2VB 3AVOA 5IBPA 3UXMA 3O8DA 4U8HA 3A9CA 1D2EA 3CINA 3CUEC 2P40A 3P5BA 3HWWA 5AK6A 1NVMB 1KIFA 2Y1LA 4H17A 4IO1A 4M0UA 3U1BA 4RTPA 1YE8A 5EESA 5IDQA 1PR5A 3RRNA 2O9BA 3EFOA 4IDNA 4MYHA 5SZIA 2DR2A 1IOUA 4HUQB 5KTYA 1Z26A 1A4UA 1NXPA 3GEMA 5CD9A 1RAHA 1E92A 2RCYA 1H9BA 1XMVA 3ENWA 3CJEA 4RXUA 4D2IA 2E87A 4DCMA 4DT1A 1QPZA 2Y0EA 1C4OA 3GGGA 1VB3A 1NMSA 5DCWA 1U2EA 3T1TA 3GT7A 4I9NA 5F73A 2CXRA 3AUJB 1QH8A 4P86A 1SK8A 2PGXA 4MH0R 2JASA 1CY8A 3KUKA 2ASBA 1Y42X 1Z4MA 3OZCA 3R6GA 2H48A 5CRIA 4L07A 1ZDMA 2OCXA 5CK5A 2IWDA 3WRTA 1QH1B 5EWLB 5FTKA 1HZZC 2C4VA 3R75A 1XZFA 1QIHA 3BTSA 2CNDA 1K55A 3A11A 5I4IA 1L3BA 5K7SA 4JT8A 4E31A 4KSBA 1RNLA 3MC1A 4V2IA 1RYHA 4C2BA 1EP3B 4KXUA 3OVMA 3TZ6A 1TD1A 1TEHA 4G07A 4M9UA 1S5PA 2JLSA 5DSXA 5JDIC 1KQPA 1Y5NA 4BY9E 1JR3A 2O5RA 3DFUA 3RYHB 3V7WA 5FWAA 2P6PA 5K45A 3K9BA 2XE8A 3KOUA 4IHJB 1K86A 5JZSA 1B15A 4CMBA 4NDNA 1KDTA 2IGBA 4K0RA 1E9BA 1L5OA 5JUWA 4J7XA 4LV8B 1TU0A 1UC5B 4L8YA 4M0FA 2P9ZA 1DAGA 2IYXA 2XMPA 3DTYA 5ENVA 3UAWA 4A0GA 3V2IA 1OX4A 3L8ZA 3DM9B 3KJHA 1RXYA 3DL2A 4U6QA 1E6UA 5DN6A 4BC7A 4ZJPA 4L4RA 2CLOB 3NBXX 4DLUA 4LNUB 4ZVOA 3SBEA 3C3AA 1G9SA 1UEIA 4G1EB 1E2UA 4AG3A 2OCLA 1FOFA 1PW8A 1M7GA 3T7TA 5EHIA 1UDWA 4OV6B 2QX9A 1KK2A 3HVKA 3LKVA 1MAHA 1R2QA 3TXYA 5LMNB 5EPEA 3TL2A 1XP4A 1XXHE 1S4MA 3TG2A 3T1QA 1AGRA 1F8FA 3PB3A 1SA0B 2TMGA 2C42A 3NRCA 4PZ9A 4W5WA 3KYQA 1ZZEA 5EY5B 3QEBZ 4JLSA 4OP5A 2R6DA 4YQZA 1MIHA 4RQAA 4EECA 5AW7A 5LXTA 4GLFA 4KTTE 2C2ZA 2OMKA 4L22A 4QLAA 2QJ7A 3H1EA 5JMWA 5G0VA 1IB0A 2AN5A 2C9ZA 1SVIA 1ZIYA 1W5FA 1GA0A 1O6GA 3F90A 2VWGA 3IFSA 1V1RA 3W3AA 4E04A 1T9GR 4KVGA 2NUTB 4D96A 2ZYHA 4EB6B 1J9EA 4LZJA 2J1LA 3CLSC 4U9HS 3ZVKA 1LHYA 5FATA 2WM9B 3IBFA 1OX6A 3NBAA 2P4UA 5D5QA 1ZD5A 2PD7A 3UJHA 4TN5A 2F64A 2YC2C 3NOVA 1DV2A 4FX2A 3PBOA 3KPVA 4I99A 4Y3UA 3VNSA 3LLVA 3A58B 3T3PB 4UZFA 4WBNF 1KSHA 2Z5VA 2I4NA 2N3ZA 3FNBA 3A1FA 2X1VA 3BGWA 3TLKA 5LNK1 1PFWA 1QYDA 1ACFA 2Q8NA 4H59A 2BFFA 4G3WA 4X1MA 4POAA 3BERA 3ZE9A 5EJ2A 5T8SA 1O77A 1XDDA 2E5LC 1VZ2A 2VX8A 3LUDA 1T5SA 3OJFA 3V97A 2FE1A 2R8BA 4G23A 4YCCA 5IZ4A 2ZIXA 5EZSA 1W4ZA 4KQFA 5TDHA 1M6KA 4U5QA 4BQPA 4CTOA 3ZGZA 4LENA 4UA6A 3LMKA 4B17A 1J22A 1EFVA 3M9WA 4YDRA 3T3DA 3CVWA 1AJEA 4S2JA 3UMBA 1YZKA 3AF0A 2DHQA 3MPOA 1NE2A 1CUAA 1TEXA 1UMKA 2Q46A 4FKZA 1DXYA 4QRDA 4DNQA 4E15A 4EW1A 3O74A 3R9WA 4BMVA 2QGNA 1EWYA 5C7LO 1A2BA 5JS7A 2CE7A 2WFLB 4WXHA 1DO0A 2ZQZA 3MJHA 3Q87B 3IP7A 4HRXA 5TXGA 4UATA 4LOIA 4URVR 2C20A 4GI1A 4W5JA 4BP9A 2OORC 3I30X 2OR3A 1LLBA 1DBQA 1TD5A 2QEQA 4QAQA 4IIHA 1JQLB 3F3MA 4B6SA 2CFIA 3OBFA 4YMWA 1V16B 1YBHA 2VYQA 1YR7A 3AHJA 5T8KC 5AW4A 4J2HA 2XFSA 1B74A 1M8KA 1TAGA 3JYLA 5AM3A 5BY2A