4PHTA

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
485
structure length
438
Chain Sequence
RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEADKEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAGEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
molecule keywords Type II secretion system protein L
total genus 127
structure length 438
sequence length 485
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4phtA01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4phtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phtA03
4URXR 5JSZB 2PLFA 2ZRGA 3SQWA 2VF8A 2VYFA 1KI3A 4RKFA 5C18A 1RVDA 2WIAA 5EE5B 1TTTA 4LJ5A 1HH4A 4WXRA 1GAJA 2O8CA 3AVVA 1YRBA 4IKEA 1OFHA 2YYZA 2IBMA 2N42A 4URUR 1DEKA 3KB1A 1Z0AA 1S1CA 3FVQA 3OF5A 1IN7A 3ZJYA 2XTZA 5JS7A 2XGJA 3EWAA 4ESVA 1EFRD 3NKVA 1NN1A 4HAZA 2C2HA 4E03A 4JL6A 3E70C 3F3YA 2ZRLA 4LV8B 2ZE5A 4Q5IA 2ZJ5A 3AVPA 4MKGA 4L9WA 3UWOA 1VPLA 1QF9A 2XB4A 2J45A 4WOPA 4BZPA 1DAMA 1I2MA 3RWOA 3KL4A 1WA5A 2YOHA 2EFDB 3LW8A 1TX4B 3DVLA 2H5EA 2IYUA 4XH9B 2FJUA 2Z83A 2ZRHA 3W8RA 3TKLA 4D4KA 5JFGA 2AXNA 2ZS7A 3EA5A 3T61A 1Q57A 3PUWA 4NCNA 3EW9A 1Z2CA 1AN0A 4DBLC 2GZHA 5FTLA 2LKDA 4F4CA 4AKIA 1EG7A 1U9IC 3TUJC 3EASA 1Z6XA 3GLIB 1NI3A 1FNNA 3VFDA 5FI1B 2ZI3A 1SKYE 5KDLA 2JLRA 2FSHA 4Q00A 1G7RA 2OFOA 3QJYA 3GJ3A 1ZU5A 3P20A 4D4LA 4C0BA 1YZNA 1E9EA 1N6LA 1U2RA 3OEHD 3BXZA 3CBQA 3KQLA 1GKIA 4DLVA 4HLDA 3B1YA 3UXMA 5BN4A 4V0KA 4EPVA 4C0LA 2ZEJA 5HKKD 1COWA 1JBKA 2PEYA 3VNUA 4HLQB 4N3NA 4QBIA 2QTFA 1PJRA 1F48A 2YKGA 1YQTA 4X8LA 5AK0A 1OJLA 2G9NA 3IPYA 1L4UA 1Q1BA 1AQYA 2PMDA 3RAPR 4US2R 3I73A 2QPOA 3K8YA 1YR7A 4MITA 2V1UA 1Y3AA 5HE8A 5CYPA 4II7A 3I32A 3B7GA 1KAGA 1XEWY 4TMTA 4LPKA 1ZD8A 1R2QA 5SZHB 2IXGA 2R8RA 1JAHA 3QXCA 5BN3A 4ZCIA 3EZ2A 2ZUBA 3C41J 3W90A 2ATVA 3O8BA 3A58B 4B35A 2ZJ8A 2E1RA 1VDZA 2ECKA 4MDEA 5HCNA 5JJKA 4JS0A 1XX6A 2KBFA 4WW0A 1NG1A 4AYTA 2BCGY 1E9RA 4BFYA 3ZIAA 5FTMA 1CR4A 2A30A 3HP1A 4GOJA 1W0KA 5IT5A 3ZH9B 3AVXA 1KDPA 1U0LA 1XD2B 5TMPA 2ONKA 3AVQA 3LX5A 3BRWD 4D0NA 4E09A 2WSSD 3AUYA 4LY6A 2WJGA 4NHOA 3KXLA 1SZPA 2IL1A 1R0ZA 4OHXA 2JJ2D 2ZANA 3F5FA 4JLKA 1QDEA 4HEJA 4D25A 2CE2X 3HU1A 2QBYA 4CDGA 2JDIA 4EPYA 2BMEA 4BFTA 1YRAA 1NRJB 2OBLA 1JR3A 1Z6AA 2FH5B 2GEDA 1FFHA 5KTYA 1YR9A 1JJ7A 2BEJA 4YMVA 2IUSA 2ZYTX 2IYTA 1ANKA 1OLOA 3WBKA 2VHUA 5K8LA 2OBMA 3PVSA 3NHBA 1JALA 3TSWA 2D27A 4B3DA 1RRFA 4R2HA 5KHOC 5K8IA 4C7OB 1II8B 1FZQA 1P7CA 2R65A 5EP4A 4C0AC 1PLLA 4Q9LA 4Z8XA 2IEYA 4DCSA 1UKZA 4ZDIA 1R5OA 3U44A 2WPDD 2RGAA 1CJKC 2IYWA 2JLQA 2OBNA 3VX4A 1EGAA 4IDHA 4I1OA 4YDHB 3WNCA 1HE8B 3K0AB 3MWJA 5DH9A 5EP3A 2ZIAA 2CNWA 1T3LA 1UDXA 4OQXA 3R7WA 2ZI4A 1SVMA 4P3YA 1TUIA 2EYQA 4ARZA 2B8WA 2ZXUA 1N25A 4YMWA 5L3SA 1Z6TA 2RGNC 2ZAOA 2BMJA 2ZRDA 2P6UA 1IOZA 3ECCA 2OLJA 1K5DA 1XPRA 5L3QA 4B2IA 3EXAA 3LRPA 1YR8A 1KY2A 3LVQE 2DWOA 1K5GA 1MH1A 4ILEA 1RRCA 3B85A 4LOAA 2QZ4A 4Q1FA 4Q4LA 4RJLA 2J0UA 2CEAA 2QT1A 5A0FA 3AP2A 1NMXA 3U2QA 5AUPB 1GUAA 4GBMA 4PQYA 1G7SA 1E2NA 2PMKA 3GJ0A 4B76A 5E3HA 1U8AA 5CK4A 4MRVA 3R9WA 2WIBA 1R8SA 5P21A 1Q3HA 2Q21A 1XD8A 2FSIA 1VECA 2JEOA 1RPZA 3B78A 1IM2A 3A37A 1OT3A 1L2TA 1Z0IA 3RSOA 3AH8A 2QMUA 2FFQA 2VP4A 4DUGA 1XJ0A 4U00A 4E07A 3EZFA 3N2IA 4HSEA 3GLIE 3DM5A 3MWKA 4ACAA 1YHNA 1E2HA 3ZZUA 2IWRA 5L3RA 4F38A 5JZVA 2CCJA 4Q4JB 1MKYA 1N0VC 2X1VA 2ZRBA 2W58A 4DLUA 2WWWA 4US0R 1JEEA 4NYIR 1Z0KA 2AFIE 3RRZA 5GJWC 2FSGA 2OG2A 3V4RA 2B7BA 2JCSA 2V1XA 1CS4C 1G5RA 4DKXA 4JVLA 1LF0A 5CB6A 3SN6A 1ELOA 2DFTA 2PCLA 3K53A 2WM9B 4HB4A 3NDBB 3KX2A 1E79A 1ZRHA 4QJ5A 3KQHA 3UG6A 1JB1A 2G3YA 4QFMA 2NO6A 1EWRA 1NVVQ 3IHLA 4KSCA 3LQQA 5GJCA 1KSGA 1GVNB 3X1XA 1Q21A 1T3SA 5JWRA 2BJVA 1S3GA 5CDFA 1P9WA 3C15C 3RABA 3SR0A 1TQ6A 2WVJA 5FPYA 1U98A 1T9HA 3FKQA 3LLUA 3TBKA 5KUTA 5TARA 1F60A 3WHKA 3DEFA 4JLAA 1MABB 2FMXA 4LGMA 1DAGA 4DLZA 3CNNA 2GNOA 1OYYA 4D4JA 2KB0A 3ADCA 4PAMA 1OB5A 3CWQA 3QUSA 3QXHA 3HR8A 5EP1A 2J7KA 1F2TB 3AVYA 4URZR 2D74A 3C5CA 3T5GA 1ESNA 2QMEA 3CH4B 2RGNA 3LX8A 3LBIA 1KK1A 4HAVA 3MRSA 4JZKA 2GA8A 2WKPA 1E2FA 1P6XA 1D9ZA 2CMKA 4YMTA 4PO9A 4V0OA 3HYRA 4WAUA 1OFUX 3THWA 3HDTA 3X1DA 1Z83A 1NLFA 4IDNA 2J46A 1D5CA 3FMOB 3VX3A 5HR5A 3CRW1 3SNHA 4ACBA 1R0WA 5IHPA 2ZSBA 1RIFA 3N5CA 1XXHE 1G64A 3IBYA 5JCZA 1UBFA 3A1WA 2W0MA 3ZS8A 1Z0DA 5BWMA 3U60B 2C03A 2UZ3A 4Y0VA 3OAAA 4GOKA 1U8ZA 2YHSA 4C9BA 1ZM7A 1W0JA 1CTQA 2BHRA 1WMSA 3I8XA 3QG5A 4HAYA 1AS0A 4DWJA 3HYTA 5LD2B 4JYBA 4IFEA 5HZKA 1YR6A 3HU3A 4IDPA 1CP2A 2AD5A 3TUIC 4JMPA 5D3MB 2W2TA 2CHVA 4PHFA 4RVCA 5FH9A 4N1AA 4RD1A 1G7TA 3CONA 2QAGB 2VA8A 4UNQA 1X8JA 2ZRCA 3BE4A 1JJVA 4X8MA 2FFBA 2ZRNA 4H1VA 4PC6A 1ZM9A 3RHFA 2F55A 1NIJA 4XVQA 2WJYA 1SHKA 2GHIA 4WXPA 4LYHA 4EJSC 4V03A 2GILA 1GSIA 2CVFA 3QY0A 2YJTD 2XTNA 4JVSB 2H7VA 3GQBA 4MYUA 2ORIA 3WHLA 3FHCB 4A8JB 1C1YA 3FMFA 1G8GA 2C98A 5DI9A 2BJWA 4I1VA 3Q8XB 1E2JA 1FUUA 2AK3A 2JA1A 2NZJA 3DMNA 2ANCA 1OIWA 2FFAA 2YC4C 1FW6A 2KBEA 4ZPXA 1E6CA 3IBGA 4CGZA 2FG5A 3CIOA 3Q7QA 4XWKA 5LDDC 4M1TA 1E94E 1S9HA 3CPHA 3UMFA 3DZ8A 1QHHB 2D28C 1FL9A 1N5IA 3HPQA 3UMRA 2C9YA 1KSFX 5JEEA 4Q01A 4B2LA 3FHTA 2GEVA 1NVXQ 1PUJA 1F2TA 5K8UA 2GZAA 3BH6A 4C0SA 1TQ2A 3CW2A 3OHMA 2QT0A 3QBTA 2Y8EA 4P31A 3PEYA 3F8TA 1GNQA 1I4TD 4B47A 3KTAA 4EPWA 4IOJA 4JJKA 3IHWA 1Z22A 1R6BX 1ZAKA 5EE0A 2QMOA 2Z5FA 3KKPA 2WJJA 2VF7A 5JECA 1BOFA 3L82B 2Z4RA 5JEDA 1UM8A 4OQLA 5DHAA 3LBHA 3QPWA 4KLNA 1M7HA 1II0A 3U4QB 2WHXA 2WAYA 2FPLA 2IUTA 2JLXA 3VQTA 5LB4A 1XZPA 5H70A 4IXMA 2Q9BA 5A5GA 1XCPA 3V9PA 4KYIB 1TADA 5EQTA 3A36A 2C96A 2WWHA 1UFQA 2CK3D 5FOUA 2J7PD 1E1QD 1W47A 3TE6A 4E22A 1IN6A 1G7CA 2QM7A 121PA 1VCNA 1VG1A 4EPXA 5FL3A 1F3OA 2AFHE 4HYYA 1WBBA 4OJKA 4D2IA 3GLGE 4DCNA 4NPHA 1E2MA 3U7EB 2RB4A 1KI1A 4QRHA 4NZYA 4QGAA 2G1KA 1SGWA 2QMHA 3TR5A 2GJ9A 4ASUA 3QKUA 2W00A 2JIZD 4OL0A 3HJNA 221PA 1UBEA 1LV7A 2RCNA 3IQXA 1VYUA 1ZM3A 4RCZA 5J5CA 4WZBE 3GLFA 1EX7A 3SI7A 4URWR 3EWSA 4ON9A 1DADA 4JBYA 4ZKDA 3LO5A 1OF1A 3LY5A 4XSHA 1NBMD 3JVUA 2MSCB 2NOAA 3EIEA 4LWZA 3SJZA 2BM1A 2RGCA 4TMVA 4PAQA 3L8ZA 4DIDA 2NO1A 1JNYA 4HAXA 5CDFE 1JXMA 2F1JA 1GNPA 3EG5A 3FWYA 4L5BA 5AJXA 5FTNA 1IQPA 4C4PA 1UDWA 1N0UA 3VR5A 1HQCA 2WWGA 2RGBA 2REOA 2V7QD 1SXJC 3MJRA 2Z43A 1VG9B 3K9NA 2CBZA 3QEOA 3DOEA 4KYUA 2IF0A 2XNDA 5DI3B 3RC3A 1QVRA 4JLJA 3TIFA 4CEHA 3KQKA 1XTRA 1W46A 4QBHA 3QVVA 1G1MA 5EXTA 3BH0A 4DLRA 1E0SA 2HUPA 3FGNA 2YC2C 4WZ6A 2O8DB 3VR4A 1KDRA 2O8FA 3MD0A 2ZJBA 5AJYA 1J99A 2JJ2A 1KI8A 1T91A 3PEUA 3CO5A 2QGZA 1BIFA 1G21E 1KSHA 2DR3A 2QA5A 4NONA 2GEUA 4G5QA 2JDID 2XNSA 3UATA 2R9VA 2HV8A 3I61A 4ZKEA 1KIMA 3RRNA 3W6PA 4FMDB 1TU3A 1Q22A 1SVSA 2BWJA 1Q1QA 3Q7PA 3WYFA 4AG6A 2H92A 4A15A 1UKYA 4Q21A 3CB4A 2O8BB 3J81k 2G83A 3QF4B 3ZVLA 1J7KA 2BBTA 2RGXA 5GADl 5GJVC 3WRYC 2G77B 1H8HA 3WMEA 3PEWA 4N0EA 4C0QC 2PZEA 3LNCA 4MUBA 4NCJA 2P3SA 4G1UC 1OPXA 4JBWA 4HAWA 2AWOA 1WQ1R 4Q4AB 2V54A 5E95A 5EXPA 4S2EA 4QHTA 5AWFC 821PA 5G40A 3EC2A 3OAAD 2IHYA 3REFA 2IYQA 1G41A 3GEHA 4Q4JA 4OYHA 1SQ5A 2ZE8A 1XXHB 2X8AA 3CX7A 1FOEB 3SU8A 1NVVR 1UEJA 2GRJA 3THWB 3TSZA 1NN3A 4WBSA 3T1VA 1HY3A 2HLDA 1Z29A 2VHCA 4LSGA 2D62A 4C2UA 1EESA 4WA7A 1OXVA 2NPIA 4B6FA 4D26A 1QZXA 5A4JA 4DHEA 2P67A 4TZ6A 4NYIQ 5E7MA 1DAFA 4IDQA 4R7ZA 4NDZA 4A2PA 1R10A 1ZNXA 5K8TA 4MUAA 5KYKA 3BGWA 4D82A 1GG2A 3PUYA 3AM1A 3C8UA 1TQ4A 4Z51A 4I1UA 4XVUA 1OYWA 2NGRA 1KI6B 4QC2A 5JMTA 4HLUA 4OI2A 2ZVPX 2JLSA 4RY2A 1II8A 5H8WA 1HYQA 1K6MA 721PA 4DB4A 3CZQA 2UKDA 4OI4A 5J40A 2QAJA 3K9HA 1E69A 1R8QA 1X1RA 2OT3B 3BH7A 4FINA 3TW4A 2G0NA 4J0QA 3U3MA 4OHZA 3UPUA 5CB8A 3REGA 1D2MA 1KNXA 4Y0AA 4U5XA 5D3QA 4G5SA 5J4VA 2ZM5A 2IYVA 5H68A 1OIVA 2ZRKA 3R7WB 2ZJOA 5KU1A 2HCBA 4KBGA 4PSVA 3M0EA 4EAQA 3A1TA 1XJQA 5BYKA 3TVTA 2EFEB 2QP4A 3OEHA 2XSZA 3CRRA 3KFVA 4JL8A 2C9OA 4NYJR 3LXRA 4PXAA 3Q72A 5CLLA 3QG1A 4DSNA 5HKKA 2BMFA 3ADDA 3RRYA 3SC3A 4W5JA 4BFVA 1LFDB 2BOVA 4GRAA 2R6AA 3OFND 1XMIA 3C5HA 4GL2A 2BDTA 1H8ED 2KI5A 4LBVA 4PPNA 1QG2A 4KFTA 1HV8A 5JRZA 1EK0A 1IBRA 2HXSA 4Q48A 1GKUB 1P75A 1KI2A 4JJZA 4MKHA 3ASZA 1E99A 4JLVA 3K1JA 5JJIA 2AR7A 2IS1A 1ZNYA 3CF0A 1Z3IX 3CNOA 3DKPA 2V8OA 3SHWA 1XEWX 3H86A 3I5YA 4BFWA 2J9RA 4UNPA 2RH5A 1N6NA 2AL7A 4TYNA 4DDWA 2P0EA 3FKSD 4JLNA 3R8CA 2NPFA 2QBYB 4RD0A 2ZYWX 3U7GA 4L16A 1N6KA 2EU8A 4GZLA 4BPBA 5C46F 4LC1A 2HCJB 3WP0A 3O8CA 5DIFA 4BFUA 1YJ5A 1ZNWA 1XXHA 4TT3D 3D8BA 1T6NA 3Q5DA 1S2MA 3GLGA 4IOLA 3THYA 5B64A 3CNLA 4MYCA 2OHFA 1KI7A 1R0XA 4DB2A 4Q1EA 1E9BA 4P4TA 1JR6A 2QU8A 4TL7A 2ZJ2A 2ZSEA 2A5FA 1ZCBA 1M6NA 3VKGA 2VP2A 3B1WA 1D9XA 4DDUA 4CIDA 3B1XA 2CLSA 3ND9A 3N70A 1FMJA 3HPRA 1E1QA 1DAHA 4M9SA 3K09C 2R2AA 1ZNZA 4EFNA 4FCWA 1G8FA 1I4LD 1Z6GA 4LJ9A 2QI9C 1MT0A 4KBFA 4M1YA 1XU4A 3BFVA 4MRRA 521PA 1ZVQA 3QEJA 2BV3A 2P6RA 2CJWA 3TW8B 1N6HA 1AZTA 3EPHA 3C7KA 2VP6A 2ZYVX 2VSXA 2ZR9A 1MR3F 1N2CE 3A1VA 3P4XA 4OHVA 3T06B 3T5DA 2TMKA 3NC1C 1BS1A 1KI4A 1LS6A 4BLOA 4L4UA 4EFMA 2OLKA 5F2EA 1ZIOA 2IHBA 4GI7A 3VR3A 5BW8A 2YV5A 1X8KA 4EDHA 2F3TA 1G3UA 4D0LB 2VHJA 2YWGA 3QF7A 2AX4A 4L8GA 4DDTA 1E9CA 2CL0X 1OH7A 1PVOA 3SE0A 1XF9A 4PZYA 4A2QA 2JLUA 4HDOB 1W36C 3NEJA 2ZS8A 4DSOA 1LVGA 2OILA 4PZLA 3UWKA 1N6PA 4G0NA 1P73A 5DISB 2A7QA 3FFBA 4IEIA 4DCTA 3SZRA 3QSYA 1WB9A 1ODFA 2V6IA 2OE2A 2QRZA 4PPQA 3L2OB 5DHFA 1X6VA 1RC8A 3S1AB 4LHVA 4PC7A 2FWRA 2CL6X 3GLIA 3W5JA 1A1VA 1VHTA 2VLIA 4HLUC 4PAOA 1YZTA 1HUQA 2BKEA 5JSZA 1I4DD 2IF2A 3SHFA 1Z28A 1N5KA 5BXQC 2CLCX 1V5WA 2WICA 1IN4A 4FN5A 2CXXA 4M9QA 1KO8A 1RYFA 2QQEA 3FKSA 1R7RA 2QORA 4HZUA 2YWFA 2VSFA 1E1RA 4Q18A 1COWD 5GJBA 1K8RA 5BYJA 1MOZA 2BC9A 3NTUA 3KB2A 5JCPA 1NSTA 1XNJA 3EIQA 3P1JA 3THOA 3TSOA 4DCUA 4DUGD 3AV0B 4LJ7A 3BFXA 1R5BA 4CYMA 2R6DA 1BMFD 3ND8A 1US8B 4CT5A 3GLHE 2H17A 4AYWA 1H8HD 4CW7A 3IGFA 4YDSA 4B71A 2QG6A 1QHGA 2QTHA 4TQ9A 2D7DA 3KXKA 4NH0A 1Z47A 2OFWA 2I4IA 3DZDA 2FEMA 4LHWA 2GTPA 1ZP6A 4AKEA 3ZZTA 1E96A 1ZINA 4MQBA 3CRQA 4O2LA 3TGPA 4I99A 4P4SB 2ZAMA 2EFGA 3SYNA 3GJ5A 3SOPA 4A36A 4CRWB 2QTVB 3OIWA 3ADKA 3X1WA 2QSZA 2ZRMA 2FSFA 5TV2A 3SEAA 3ZS9A 4NE2A 1J8MF 3CF6R 1UEIA 2QUZA 4YMUA 1T3HA 5LBIA 2X19A 1S3SA 4EKDA 2C9CA 1KKLA 5B58C 2C77A 1DE0A 2QE7D 1PLKA 3UG7A 4BRUA 2HF8A 5FOTA 4TTQA 4M53A 4P33A 4M1WA 4EPRA 4KVGA 4NL4H 4ASUD 5CIQA 1F6BA 3IEUA 4QL3A 2OFXA 2ODWA 4RD6A 2DFLA 2LKCA 1KNQA 5AUOB 1NBME 5F98A 4OHYA 4A0GA 2V55B 2QRNA 4JVNA 2CL7X 4OJQA 1DAEA 2L0XA 3CRVA 4RFSB 2A3RA 3NH6A 3X1YA 4LDJA 5JHGB 4LBYA 1IXSB 2NO9A 3BC1A 2IK8A 2Z0MA 2HDNB 5KNDA 3QNUA 4G5GA 4AD8A 4AKHA 1CJMA 1SVOA 1U81A 1ZYUA 2Q3HA 1UKEA 1US8A 2QL6A 1LTQA 4XD7A 2O0HA 1I2DA 1CJVC 1W2GA 5EXSA 1ZUNB 4MGYR 1AZSC 1XTSA 3T34A 3PITA 1ETUA 3CH5A 5H1YA 1HQYE 3NHAA 4TMXA 3I62A 1PUIA 4DJTA 4XTRA 3QXJA 5DN6A 4Q7LA 5KPDA 4FMCF 3QKTA 3TAUA 3CR8A 4KLZA 4PHHA 4ZO4A 2XZLA 2GF0A 2J59A 4P4UA 1EX6A 3B2EA 1VYVA 3KJHA 2P5SA 4MKIA 3OIYA 3CX6A 1AKYA 1XTIA 2FZ4A 3KJIA 4EQ6B 3RRMA 1B23P 1H8EA 3B13B 1EFRA 1Y63A 2IC5A 3DO6A 2OCPA 2VSOA 4DEXA 4LZZA 1W4CA 4LCBA 3RSLA 1RFLA 4CT4B 1S9DA 4G5RA 2FZLA 5G53C 5LD2C 5FPSA 3KKQA 1P61B 2GESA 4DT1A 2G88A 1HT2E 3D31A 3P27A 4LV5B 2QM8A 2FX3A 4GMXA 3NBZC 4E5UA 4TWZA 1ZMXA 1P9RA 1OXUA 5DSZA 1S96A 1FP6A 3K9LA 5HCIA 4DIEA 1G20E 4Q1BA 3KXIA 3NC0C 1IY2A 1ZBDA 4PC2A 3B5JA 1P2UA 3LFUA 5KNBA 1TUEA 4AWXA 2WJHA 2WWXA 1E9DA 4M22A 3LV8A 1CEEA 1X86B 1GRRA 2W83A 1XMVA 2NIPA 2OEPA 2RHDA 4FCVA 4B3BA 1DPFA 1M7GA 2VP5A 1KK3A 6Q21A 4AIIA 3GLFE 1DS6A 1KAOA 5FTKA 3ICQB 4Q66C 5FBLB 2VO1A 2ERYA 4JSYA 5EXXA 4DLSA 1KJYA 4A0FA 1RE0A 5IDVA 4IHQA 4TLDA 3ZVMA 4KU4A 3ZYCA 3LWNA 3K0CC 3GFOA 1QHNA 1OW3B 4IVPA 1G17A 4W7SA 2IT1A 4JSTA 3O8DA 4QGGA 4HUQA 4TQUS 1NJFA 4PR0A 1SULA 4GZMA 2RAPA 2ZJAA 2F1IA 4A0RA 1MRNA 1DG3A 2WBLC 3ZD7A 4H1UA 3I72A 5J4HA 1DELA 2Q0HA 3BORA 3AF2A 4JLOA 3EZ6A 3Q3JB 4DLWA 2A2ZA 3KUDA 2FN4A 1E0JA 2GKSA 4B3XA 2V3CC 3AF1A 4TYPA 1NVWQ 4N0DA 5JHHB 4FIDA 5AJWA 2WMOB 3GLHA 4W5WA 3BWDD 3QOFA 1GITA 4A8JC 1ZU4A 3SJCA 8OHMA 2D06A 2JJ1D 1ONBA 1HURA 3MGCA 1TNDA 3U7HB 3A4MA 4M1OA 2D4HA 1F5NA 4XTCS 4BLTA 2C95A 4DLXA 1BYIA 4F93B 4PQRA 5TVKA 4AY2A 3M1IA 4KITB 1L8QA 4LJ8A 1GRQA 2W2VA 3QKSA 4BEBA 4F91B 4NU0A 5FBVB 4PHTA 3GMTA 4PZZA 4UXIA 3RYTC 4EJSA 4Q47A 1Q20A 4JT4A 3NG1A 5E7IA 2F43B 1X1SA 2JLZA 4DCVA 3C16C 4FI3C 1G18A 1KK2A 1CRQA 3EZ9A 2HYIC 3DPUA 3W6NA 5KO2A 4YONB 1NSFA 3HU2A 4GOXA 1UF9A 2VBCA 4UJ5A 3T1TA 1HA3A 4UKDA 3NBXX 1VCOA 2VQSA 3L43A 3RS3A 4B6EA 2XSZD 5JWOA 4B3GA 2CE7A 1NF3A 2IS2A 4C2TA 5FR2A 3B8HA 4Q1CA 4RZ3A 1GNRA 2J7PA 4CVNA 3GJ8A 1NY5A 3CM0A 1AS3A 1P62B 5L3QB 2K5UA 2WWYA 4TQAA 4P32A 2X77A 4LHYA 4KCGA 2MSEB 2ZS9A 4HDQB 2CHGA 2KWIA 1XRJA 1E9AA 3WYAA 5CITA 2EWWA 1VKJA 1VG0B 3WNBA 4ARZB 2CDNA 2ZUCA 4LYFA 3U6KA 5EZ5A 2DFKB 1W4RA 4Q4HA 2PEZA 3THXB 1OXXK 1E2KA 1G8YA 1SVKA 5LPNA 1IJFA 2FPKA 2N1BA 1KO7A 3GEEA 3U5ZB 2JLVA 2NTYC 3K0CA 3OE7A 1U99A 3WNDA 2V9PA 3MAAC 3K70C 1VIAA 2O52A 3DKVA 4FMBB 4RD3A 5CIWA 5D3MA 3CKLA 2R6FA 4BQSA 3CZPA 4CEJB 2G1JA 4L9SA 5JI3E 3TH5A 4DC9A 2XXAB 3PCRB 4LI0A 1BH2A 1EXMA 1DAKA 4TLEA 1CJUC 5ANRB 1J2JA 5BN5A 5JJLA 4JIMA 1FQKA 2H57A 5FUWA 1WCV1 2WTUA 2BBWA 3AEZA 4RZUA 1W1WA 2VHQA 4B44A 3C14C 2PZGA 4PANA 1VTKA 4M0LA 1KO5A 2FE4A 2ZI6A 4OKSA 1ZD1A 2XB2A 1GWNA 1DBSA 1NN5A 1U94A 3NBYC 4V0MA 2J41A 1NN0A 4JKYA 4AKGA 1DO0A 2EFHB 3SJAA 3KZ1E 4C0KA 1UAAA 1J90A 3I8SA 4IOKA 3LD9A 1H65A 4OQFA 3U3JA 1WRBA 1V43A 4O25A 1VMAA 2XOKD 2C8VA 2DYKA 4B75A 3IEVA 3RC8A 2XZOA 2QEQA 4M9XA 2JGNA 3NVAA 2OUKA 3A1UA 4MYHA 3RWMB 2O8FB 4KFRA 3OIUA 4F4JA 1GKYA 5FL7A 1KDTA 1S8FA 1W5SA 1Z07A 2AXPA 3SDZA 2Z6VA 2F6RA 3LXXA 4BZXA 2RHMA 3UANA 2R62A 5HTKA 5FPKA 3QQ5A 1KKMA 3SFVA 2J0SA 2QP9X 1SHZA 4B3FX 1KYIA 5DYGA 2QY9A 1TU4A 2VP0A 2P2LA 2AHOA 1A2KC 2WKQA 4JL5A 4Q7MB 4ZCLA 1DG1G 2BBSA 3GJ6A 2IUUA 2ASEA 3EAQA 3D6TB 4TSFA 1IXZA 1MABA 3QPVA 1CLUA 1XD9A 4M1SA 3EPJA 1XFAA 3NWJA 1L4YA 1LY1A 2GAOA 3VAAA 4OBEA 4XIGS 4ESHA 3EC1A 3SBEA 1IJEA 4DDVA 2OXRA 2P65A 3X1ZA 3PJRA 1W44A 3MUFA 1RKBA 4GT1A 1E9FA 1GL9B 2C78A 4B2PA 5DN6D 3EPKA 1WBDA 1J70A 2P6NA 3QKSB 2H8KA 3EIHA 1YU9A 4XJXA 3P26A 4XOIA 2B6HA 5J4YA 1GZSA 2SHKA 3AP3A 1M1YE 1KO1A 1U8YA 2UVQA 2XX3A 3VR1A 2XZPA 4JBXA 1A4RA 2W2XA 3MMPA 4URYR 4G3XA 2WSMA 3OEEA 4F4IA 3OZXA 5CM8B 1EFUA 4LPSA 2RGGA 4PQFA 4IRUB 4LX0A 2MSDB 4DZZA 1N6RA 1O87A 1IONA 1S1MA 3AUXA 4KHZA 4UJ3A 1CR1A 5IF9A 3L0OA 2NO7A 2J87A 1P3JA 2ZSAA 4LJ4A 4TTRA 2BMDA 4Q7JB 4LJ6A 3TAHA 4PC3A 5CLQA 4Z8YA 3OE7D 1TAGA 2DPXA 2GK6A 3QI2A 4ZIRA 2IXFA 3T35A 2WZQA 1NG9A 5TDHA 5AUQA 4UNSA 1MO6A 3WY9A 3KJGA 4LJYA 1NIPA 2UZIR 3VTKA 4A6PA 1FNMA 1RZ3A 2GJKA 1GM5A 1KOFA 3AGPA 4R71A 1GFIA 3N2EA 4AURA 2AD1A 2QPTA 5FPTA 1KK0A 3KJEA 1DO2A 4ZDWA 1PLJA 3BFKA 5FOVA 4QXAA 3AKYA 2JJ8A 4B32A 2Q9CA 2MMGA 5JRJA 4NKRA 2GXSA 3ZVRA 2GXUA 5G3YA 1Q1ZA 4OI1A 4QBFA 1M74A 3AF3A 3L0PA 4YXWD 3BJIC 4A92A 4Q4HB 1MV5A 1BMFA 1JXOA 5F3WB 2VPPA 4FW9A 3L0SA 4Q9IA 1WXQA 2J1LA 3IUYA 1YZKA 4A1FA 3QVUA 4LK2A 2HF9A 3X2SA 2JJ1A 3RS2A 1KY3A 4MRNA 1TMKA 4PO1A 1OKKA 4LUCA 4IFBA 2H18A 2HYDA 1T8UA 3LA6A 1YVDA 4BLSA 1AK2A 2R6GA 4I1SA 5AR1A 1SKQA 3ZQJA 4QG7A 1QHHA 5KSYA 3U44B 1P2SA 3E5HA 4PTLA 2Q3FA 3OEED 1NLZA 2BM0A 4RFVA 2CNWD 4RSGA 4NYMR 4FCTA 2VHTA 1EWQA 1TEXA 3VNVA 4R2IA 2J0VA 1NMZA 4ZCMA 1XCMA 3LW7A 3WMFA 2A78A 2FGKA 1P2VA 1Z0JA 3UIEA 1YZUA 2XJ4A 3FYHA 3MLEA 5TXGA 3IO3A 3O47A 5SZIA 1XZQA 1P60A 1T4GA 4RFSA 4LBWA 1XCGB 4QGHA 1ZM4A 1VCIA 2QENA 4V0ME 3U3KA 1YZQA 1Q44A 1VIYA 2O0KA 4ITRC 3FMPB 4Q7KA 1KJZA 2ZJYA 5EUMA 1KZGB 3H84A 1G6HA 2H1LA 4NCHA 4ERNA 4M2LA 4C30A 1P72A 2AKAB 4AG5A 4HB0A 2ODEA 5EUQB 2GXQA 5FUXA 1IY1A 1ZUHA 4D0GA 2GVDC 1P2TA 4IXNA 1NVUQ 1QG4A 3EA0A 5KDOA 2G0TA 4UXHA 1GL7A 3QKRA 4OQNA 5JBQA 3T15A 1XPUA 4AI6A 4B33A 4YQFA 3IKJA 1ZJ6A 2NO0A 4M8NE 2HT1A 2W0SA 2WJVA 2V4ZA 5FFMA 1E2DA 2W6JA 2JASA 1RRGA 1RJ9B 2B21A 3U6BA 4TTPA 3WRXC 1G3QA 1XEXB 1TEVA 2PT7A 4LBZA 1T5IA 2DCUA 5AJZA 2YWHA 4MKFA 1E9SA 5HPYB 1CXZA 4KAXA 1NMYA 1R4AA 2EFCB 3K0FA 5C1BA 1W7AA 1W48A 1E79D 3QPUA 4DT1B 4FMCB 4TLBA 2YOFA 1OFTA 2D7CA 3AKDA 3CWZA 1XMJA 2ZE6A 1G6OA 1FPMA 3DMDA 4HDCA 1OH8A 1GTVA 3CRMA 4RKEA 1W5TA 3R9XA 4UNNA 4RCYA 4S35A 3CPEA 3GFTA 3I4LA 5GVRA 1M8PA 2IYZA 2HLDD 2WMNB 4QBGB 4PX9A 2IYYA 2O0JA 4O2RA 2O8EA 3QIAA 4TYYA 3PFIA 3IQWA 1ZW6A 1NP6A 4Q19A 4BLQA 1SXJA 2FV8A 1LNZA 1OB2A 2A5DA 1G4AE 4BFSA 2DBYA 2GF9A 3PG5A 1OXSC 3AVTA 2GJSA 2R6CA 4KI0A 1UBCA 3T1OA 3RS4A 3W6OA 3BB3A 2XEXA 4TMZA 4HB2A 4Q9KA 3FMIA 4TYQA 4TMWA 4XWAA 1XB2A 4MH0R 4CF7A 1A7JA 3DHWC 3H2YA 2FF7A 2ZREA 4I81A 3TNFA 4FWIB 4B43A 4PFSA 1EFCA 2JATA 2F7SA 3R8FA 1G9XA 2ZR0A 4DRZA 3UKDA 2ZVQX 3AQ4A 4PO8A 3KKOA 5G3ZA 2I3BA 4EQ6A 3FTQA 1W36B 3AP1A 1RYHA 4EJSB 1XWIA 1II9A 4Z1MA 3K70D 3VKHA 2ZRPA 3EARA 4OI0A 3TRFA 2EVWX 4IVQA 3IO5A 2ZPTX 4URVR 2GK7A 5EE1A 2X2EA 1E3MA 1W0JD 3PUZA 5SZKB 3B1VA 3TJZA 2FGJA 1XTJA 4P0TA 1P5ZB 4NYMQ 5FBWB 2KE5A 3ASYA 3PXGA 3MSXA 2GCOA 2JAQA 5L8VA 4D81A 1OFIA 2OAQ1 3S1AA 2HT6A 1JR3E 2XNDD 5FOXA 1G19A 1E2LA 2BH1X 1S0UA 1E98A 3KQUA 1CIPA 3AKEA 1XJCA 3EZ7A 5DI3A 2PX0A 3G5UA 1D6JA 1MRSA 3TQFA 2GETA 1SXJD 3LQRA 4BASA 4V0LA 3BB1A 4IDOA 2ERXA 1Q0UA 2CVHA 1XEXA 4QHYA 1OH6A 4A6XA 3RS7A 4G01B 5CJPA 4C0JA 4P4SA 1NL3A 1EFHA 3JZAA 1L7VC 3TR0A 4HATA 4FD2A 4KFUA 5JLJA 4HUTA 1DTSA 4QNMA 4GNKA 3FDIA 3ICEA 3QKRB 4JT2A 1G3MA 2ONJA 2OSBA 1AGRA 2ZR7A 4B73A 2ZTSA 5EZ6B 2YINC 1OXTA 2XJ9A 1DVRA 2VH5R 1UADA 3IIKA 1TL7C 4Z1MD 1UBGA 2E87A 2FDCA 2PJRA 4TMKA 2WOOA 3W9YA 1T0HB 4TL6A 2C5LA 1E0AA 2AN9A 5CM9C 2WAXA 5CK5A 3H0KA 1GRNA 3A1SA 2BCJQ 2ANBA 2ZSDA 2YOGA 4ZDJA 4TZ0A 4KODA 2EQBA 3R20A 1JI0A 4UNRA 5JWHA 5KNCA 2F9MA 3M6AA 3PUXA 4H9GA 2WWFA 1E2EA 3K0EA 2A5YB 2I1QA 1HEIA 1BO6A 4HLCA 4F7WA 1D8TA 1SVWA 2DHRA 2NZ8A 3GLGB 2DB3A 3VU9B 2IYSA 3GD7A 4JKIA 2PL3A 2J3EA 4KV9A 3RDPA 4WVFA 1KHTA 3RVBA 5KDDA 3BBPA 2GBLA 3T12A 4TLCA 2QNRA 1GIAA 3K0AA 2WJIA 1KMHA 1Z8FA 3C4JA 4K8OA 4TN1A 621PA 1JECA 2OV2A 1ZIPA 4A9AA 2XTMA 3FOZA 1G8HA 3V00A 4Q1DA 3EPLA 1T5LA 3KTAB 4HI0E 1XPOA 5AJVB 3AF0A 1E1RD 1N5LA 1Q1EA 5DO9A 5EP2A 1IXRC 4NP6A 5HE9A 1SXJB 1DAIA 1M34E 4V02A 3ZIAD 2GCNA 2IYLD 3D7MA 4ZI2A 2OM2A 3ZLJA 5CYOA 5FBQB 5C4GB 1KDOA 1CKEA 3AKCA 4IVRA 4AK9A 4BWYA 4D80A 3FE2A 1B0UA 1CJTC 2NQ2C 5F9FA 2IEZA 2ZSFA 3NDPA 4PHGA 2CJWB 2JIZA 2QPAA 2ZYUX 3CX8A 5FR1A 1N6OA 2BBOA 1E32A 1AS2A 2OXCA 1CR2A 4D4MA 1XTKA 3Q9LA 2ORVA 4CZ2A 2XOKA 4JLDA 1C4OA 3B82A 3A8TA 4TYWA 4POAA 3HWSA 4RZXA 2IWHA 2CK3A 4A8JA 3W3ZB 2GAAA 4QM7A 2PLRA 1N3BA 1P4SA 2HEIA 3AVWA 2A5GA 5FUVA 4OK3A 1JAIA 4MDFA 1OIXA 3CF2A 5F9HA 1A82A 1CRPA 3MCAA 2B7CA 1R0YA 2N46A 2V7QA 2F3RA 3DL0A 1XBTA 2OCYC 2REXB 1JR3D 2QE7A 2VRWA 1Q3TA 2DY1A 4QJ3A 4LRWA 5FOSA 3FFAA 5FPHA 4XWOA 1CF4A 1XTQA 1XMSA 3CR7A 1IAQA 2QAGA 3ETLA 3RNLA 3NH9A 5M04A 1R5NA 1IN5A 3CPJB 2IA5A 1YE8A 5DE3A 2OO7A 3W3AA 5JI2E 1OHHA 1E2PA 4KVAA 1U0HC 4CEIA 5DNYB 2GWHA 5CJ2A 1DOAA 3SYLA 2GXAA 5FBRB 1NNEA 4U7DA 4ZI3A 1E0KA 1MO3A 4LJAA 4BUJA 4OK5A 2CLDX 3UK6A 4OK6A 4ZIRB 1UJ2A 3TQCA 3WP1B 4TT3A 2F9LA 1N0WA 3I1FA 1Z0FA 4B3CA 4YXWA 3QENA 1WE2A 4PC1A 2W6IA 5SZJA 4LV6A 2D2FA 4BZQA 3THYB 2PJZA 2IYRA 2ZUDA 2JLYA 1G3RA 1CBUA 5ELXA 4OHWA 5J4LA 1FX0B 3MJHA 4NTZA 5TY0A 4IW3B 2FEOA 2QQ0A 2VIIA 2FOLA 1Z5ZA 4JLBA 3KKMA 4QOSA 3A4LA 4EPTA 3FPAA 1Z06A 2PBRA 3MG9A 3A6PC 1EFTA 2FFHA 3VR6A 3PQCA 4B74A 1X8LA 4BEJA 4ZV4A 3QXXA 2RMKA 1XD2A 1ZC3A 2AWNA 1TQDA 4W9MC 1D2EA 3VU9A 2ZITA 3K09A 4AC9A 2WV9A 1QBKC 4KSBA 3ZGXA 1Z63A 4DEYA 3QE0A 3SBDA 4B48A 2Q6TA 2RKOA 3TVDA 3TMKA 3TUZC 3PUVA 2RGEA 4BECA 5LB2A 4XD7D 2EWVA 1AA9A 1NKSA 3RLFA 2JLWA 3B9QA 3KKNA 2F43A 2REBA 3ZDQA 1BKDR 1G5TA 3AGQA 3U61B 3G0HA 4XVRA 2GJ8A 2QSYA 4TLAA 3GJ7A 2IX3A 1KI9A 4A4DA 1SVLA 1JPNA 2IYXA 2ZE7A 4UXJA 2VTKA 4G5OA 1SKYB 1BYUA 1CULC 4CEIB 1QVAA 4QHSA 4Q1AA 3IIMA 3U7FB 2ZRJA 1TF2A 1QRAA 1U90A 3AVOA 2ZRAA 1MO4A 1ZM2A 4KJZA 2VEDA 5FOWA 3PV0A 1YZLA 3P32A 4Q03A 4YMSA 4NCIA 5IK2A 2E9SA 5EE9A 5E7JA 1G16A 1NKTA 4MRPA 3EX7C 3GEIA 3QBVA 4BFZA 4IEEA 3GLHB 2FPMA 4BLRA 4K81B 4KFSA 2XAUA 2QP3A 1OE0A 3GJ4A 2Z4SA 2Q3MA 5L3SB 1QHXA 1FX0A 2W6ID 1HTWA 2F1HA 1KGDA 2PZFA 2ZROA 3B9PA 3CUEF 3MWLA 3L8YA 4BLPA 1J8YF 3DOFA 1W49A 1TF5A 2ZRFA 3KQNA 1G5PA 1PZNA 2QROA 3T1QA 3D3QA 2LCFA 1XDBA 5FL7D 2GDJA 3GCGA 3LDAA 4LHZA 5BQ5A 4DLYA 2HJVA 3RS0A 1G3IA 2I1VB 3AB3A 1TF7A 2XITA 3OESA 5EJEA 5J4KA 5HZHA 4QNRA 3H4MA 2KJQA 1G291 1D2NA 3K70B 4TSFD 2DWPA 3B6EA 5KPJA 5IRCD 2J0UB 2B92A 3SQXA 2KSQA 2XXAA 3PR1A 3FHOA 3QF4A 2HJGA 4DSTA 1O3YA 4BE7B 4DVGA 3ZQ6A 3SFZA 1VHLA 4JLMA 4DXAA 5AUNB 3GPLA 1S4QA 1QHYA 3M4YA 2GJAA 2WSSA 4GFDA 4A2WA 3BIFA 4DLTA 5L3VA 3ADBA 2X2FA 1KJWA 4FXPA 3BK7A 3F0TA 2OCBA 1A2BA 1NJGA 1KMHB 4PSAA 3W5IA 3IILA 2F1RA 2MMCA 3FB4A 5DLQC 1HT1E 4V0NA 1VCMA 2C99A 5J47A 1QHSA 3K0SA 2Q9AA 2QAGC 4HAUA 1E4YA 2ZETA 3DDCA 3U4QA 1YKSA 2QN6A 1RW4A 2FA9A 2ODNA 4X8HA 1OH5A 4M21A 2P5TB 4C7OA 3SJBA 1GDDA 2J5XA 3O8RA 3G82C 5KOYA 2B8TA 2LWIA 1IHUA 2ATXA 5JS8A 2O8CB 5DYIA 3BERA 1FUKA 4PPFA 3WXMA 1SVIA 2YZ2A 4ZDKA 3L0IB 1GILA 1GOTA 4GP7A 1FTSA 3GFPA 1AQUA 4YLGA 5KSZA 3LAWA 5C4MA 3KFXA 3HR7A 4W5HA 3ZZ0A 2WPDA 3P4YA 4TL9A 2G6BA 2YWEA 1KZ7B 4PSKA 4US1R 2VP9A 2QGNA 2O8EB 4XSGA 1FTNA 3KDSE 1N5JA 4PPGA 1N6IA 1LF5A 1KMQA 2RGDA 2GBLC 3W8NA 1XEFA 4Z54A 3THXA 1ZCAA 1OV4A 2BIFA 3ZD6A 2ZI5A 2J0QA 2WWIA 1E2IA 4ABYA 5FI0B 4LYJA 2ZRIA 3LBNA 4A0HA 5KSOA 2ODBA 5DGXA 2OAP1 5G41A 3IIJA 5C2JB 1W4AA 4M4SA 2NG1A 4B34A 3V4FA 4EIWA 1OHHD 1W36D 3RANA 3LVRE 3ONWA 1Z08A 2GVZC 1NY6A 1SXJE 4O0MA 4NBSA 4IJMA 4C0HA 4K46A 3H1TA 3VR2A 4AYXA 1G4UR 3A4NA 1DARA 1KI6A 3LLMA 4RZ2A 2BEKA 3GLFB 1W2HA 4JVMA 1ZD9A 4NMMA 1E2GA 3AVUA 3IDQA 1LW7A 3RS5A 3TLXA 2D2EA 4FWTA 4CEJA 2FNAA 4HB3A 1LS1A 3NIBA 3GP8A 2O8BA 5GVSA 1JQJC 4MRSA 2VL7A 1Z2AA 4U02A 1U9IA 2EW1A 4I4LA 1MO5A 3MFYA 2GCOB 1VYTA 4MA4A 2D3WA 3BB4A 1U0JA 3VHXA 3K9GA 3IPXA 1AIPA 1OKKD 4EFLA 3BOSA 2WOJA 1AM4D 1QHIA 2A9KA 1E4VA 4BRWA 1JQLB 1LB1B 3Q85A 1JEDA 4LYAA 4QM6A 3U3OA 3JVVA 3VMFA 4FMDF 4Q02A 5E4FA 3WMGA 1FQJA 4MGZR 3OFNA 2ZU0C 4Q4AA 4LC0A 4R9UC 3DM9B 4F92B 2PX3A 4Q9JA 3E1SA 3BD9A 2BKUA 3SS8A 1PV4A 2GZDA 4RD4A 3U3RA 5B57C 3GJXC 1W0KD 1XP8A 5KSPA 2CCGA 4D6PA 2AK2A 1AJEA 1P9NA 3B60A 3I5XA 1KSJA 2OZEA 3UMSA 1W4BA 4NYJQ 4WIAA 4MGKR 1WF3A 2DFNA 4X8OA 2IXEA 2W6JD 3I3SR 2PCJA 3B1ZA 5EE3A 2ZJZA 2ZI9A 1NBMA 2ORWA 1UPTA 1FP7A 3E2IA 3CLVA 4GDFA 1Z6YA 2HXYA 3PENA 3W34A 1NLYA 4JLPA 2NMVA 2OESA 5B2ZA 4HUQB 3TK1A 3PEVA 3MWYW 1VG8A 1AGPA 5IK2D 3BS4A 4L15A 1Q12A 2YNMA 4M1MA 4HZIA 3SYKA 1ESMA 4LHXA 1KO4A 3ZVNA 1FMLA 2O8DA 3PIRA 4Q9HA 4GPTA 1GL6A 1CR0A 4A82A 3LH5A 1M7BA 1JPJA 1G8PA 1F2UA 2EYUA 2O5VA 4EUNA 1ZC4A 4YC7A 1M2OB 1HE1C 5FTJA 1X3SA 3NBFA 4CEHB 4BGDA 4NCKA 2V6JA 1GP2A 1T0JB 2OCAA 5UKDA 1KTVA 2R44A 1C9KA 4R98A 4MYTA 1OSNA 2IS4A 1A5TA 1CU1A 1WP9A 4WZAE 3I92A 5FUYA 421PA 4C3ZA 2ZQ5A 1AKEA 2CCKA 3WBJA 1WDTA 4GP6A 3K0FB 1T8TA 4M9ZA 2DWQA 2PT5A 2PH1A 3OIVA 3QXSA 1UKVY 3KUCA 4JYCA 4O3MA 4OQMA 1RJ9A 1YZGA 1ZUIA 3BAFA 3AF4A 2H16A 1E2QA 4BFXA 4UQOA 2AKYA 2WKRA 1RRPA 3NXSA 4M1KA 2FU5C 4DSUA 2ZU6A 3NEYA 3VKWA 2A5JA 1F2UB 4GMDA 2ZI7A 4IOMA 3WYGA 2CHQA 2YVUA 4KO8A 5B30A 4HZUB 1IY0A 3Q5EA 4QJ4A 2IS6A 1IN8A 2BVNA 3VHLB 2IW3A 4QKQA 1TPZA 3JZMA 4MGIR 2C04A 4QGFA 4GSYA 4RD2A 4KXFB 4TL8A 2GCPA 5TB5A 3R9IA
chains in the Genus database with same CATH superfamily
2HDUA 3L7DA 5JSZB 4WK0B 3NOQA 2ZRGA 1DQRA 3BXEA 3WKCA 4AP5A 4ZJ1A 1KI3A 2VYFA 3LZCA 1G0OA 2UVPA 2WIAA 3TQQA 1TTTA 2GAIA 3RXXA 1HH4A 2GRAA 4WXRA 2O8CA 4MW2A 1NR1A 2O2GA 4BJ6A 3AEKA 1ICEA 3T1XA 1HR0C 2N42A 3WIUA 1DEKA 2XDAA 2PD8A 1DTWA 4HRYA 1Z0AA 1SUEA 3FVQA 1G68A 2IUEA 4FI3F 3UE1A 2WB2A 2Y1LA 3EWAA 1VMDA 4ESVA 3D02A 4KPGA 2ZJ0A 5CGXA 3LGXA 5KIZA 3BQNB 3NKVA 1UWLA 2V1UA 5K3BA 4ZYTA 4KHPB 1CUDA 1T4BA 1K3FA 2H85A 4KK4A 4LW8A 2GJ3A 2JKFA 2VH2A 3UAYA 2ZJ5A 3OI7A 2P2SA 1P0IA 3BLMA 3PHCA 1TA9A 3CU5A 2IZ6A 4JOCA 1X7WB 2B78A 4WOPA 3GP3A 1DAMA 3GR0A 1I2MA 4ZQCB 3RWOA 4EHJA 1DJCA 3DQZA 1P31A 1N9ZA 1OAOA 4GZ6A 3SIXA 2OB2A 2RHBA 4QFBA 2EFDB 1MXHA 4XH9B 3DVLA 2P2CA 1XKLA 1UL1X 2Z8ZA 3W3AH 3WDMA 1Z68A 1Z5WA 1MC8A 1WSAA 2HA5A 2Z83A 3RF7A 4D4KA 1GPYA 2AOVA 1O92A 1RRVA 2H0RA 2EFUA 2QVBA 3H75A 5FWYB 3T61A 4D9BA 5KVSA 3ESRA 3ONFA 3BDIA 4NCNA 4KQ2A 2X5KO 3ZJUA 2P30A 2I3GA 4JF6A 1UMCB 4XWWA 4R7TA 4JYZA 4K0BA 1K75A 1ULAA 3PDCA 4F4CA 3BCRA 4QYIA 4YB8A 4HQLA 4AKIA 3EASA 3HB9A 3USES 3W4JA 5KOHB 4DV3B 4MKZA 3ZHHA 2G7MC 4YJ2F 4FKMA 4R2MA 4Z3OA 2H28A 5TJJA 2WM3A 1NUUA 5F21A 4IMRA 5KVAA 1CUUA 1SKYE 2M2IA 2ZZKA 3NANA 2INWA 2JLRA 5KDLA 4EYEA 1UMDA 2POCA 5K09A 1ZG6A 1I5EA 3VV2A 1MTOA 3FCOA 4NZOA 1VFNA 3BWCA 4H7JA 3PNBA 4C0BA 1C1HA 1OTXA 2R1TA 3GFBA 4RDIA 5JD3A 5LQDA 1U2RA 4U7TB 2P4QA 4EI7A 3O03A 1NYLA 3FLEA 2ZQ9A 5AI5A 1K2WA 3T99A 3A9UA 3S82A 1PDVA 2QL5A 4DNOA 3B1YA 4YX9A 5I7RA 3RADC 2HSZA 4V0KA 2O2JA 4FN4A 1EWYA 1F1JA 4H17A 5FQJA 3NHFA 3OPNA 4JBFA 2OHOA 1A7KA 2NT4A 4I9GA 4N3NA 1RHKA 3DD1A 3A27A 4GX2A 5FWDA 1YQTA 3PWTA 5L40A 3TE7A 4Y2RA 4ARUA 2IS1A 4JKOA 1EVZA 1R4ZA 4ZI7A 1KRWA 2R6JA 3KE8A 3PTEA 1SA0A 2PMDA 5FPQA 2YXLA 8AT1A 4EUEA 5E1OA 4K0RA 1N2GA 3QBDA 1WUIS 2QPOA 4BVFA 4CWAA 4BEVA 1PZPA 5FI7A 2JAPA 3HCYA 1MJNA 1VE6A 5CYPA 5HE8A 4DBLE 1H5XA 3GTCA 1GPLA 2WB4A 5HILA 1MA3A 1TT7A 4TMTA 1ZR2A 1JH9A 4LPKA 2OGZA 4BO8A 2R8RA 1KDVA 3EIFA 1JAHA 1PL8A 3KLOA 4I8DA 4QYTA 4ZCIA 2HP9A 1M2VB 2ZUBA 3C41J 1TAUA 2VJNA 3JQ6A 4QOHA 4DV4B 2IXTA 4UMEA 2E1RA 1BZAA 2ECKA 3DTTA 2DKFA 1G5HA 5HCNA 4MDEA 2V0UA 1WQ3A 4M46A 3IEXA 3RYHB 4JFAA 1EWKA 4M9UA 1BOOA 3BWLA 4R4JA 5LSAA 4LGCA 2FF5A 4U1RA 2HY7A 2PS9A 5CBPA 2XRZA 4D99A 4AYTA 2GRUA 1YKFA 3BMNA 1YBHA 3FTNA 2BR4A 2DJIA 2PKQO 4H3VA 3DZGA 2FH5A 3QNMA 3BZBA 5KYTA 3JASB 3ZIAA 5BT8A 5A0TA 1CR4A 3COWA 4COOA 1ZK1A 3NMUF 4FS3A 4BU1A 3C8HA 3GEBA 3VZCA 4AXXA 1QWOA 2H63A 1W0KA 5ADWA 5AE2A 4N82A 1EVKA 5EVJA 3HCPA 5AW8A 1ID1A 5TMPA 5DGTA 1D04A 5AOCA 2EQAA 5B58T 2FX5A 2WFZA 2EZTA 1CI9A 5CGSA 4Y9RA 2WJGA 2Q8QA 2GFQA 5DT9A 2W5UA 4E3LA 4Y6QA 2I4NA 1SZPA 1TRKA 2C94A 3BJMA 3MRVA 2IL1A 3NHWA 2BP7B 2G4VA 4OHXA 2SNIE 1MC1A 3AF5A 3SX4A 4JLKA 2C92A 1Y9JA 2QSJA 4B3MC 4P7KA 4YP5A 5D86A 1RLUA 1S4RA 4BL5A 3FBWA 4R0QA 2DXIA 4WASA 4CDGA 3H8SA 4I2VA 3GGGA 4L4XA 4PVDA 3R5XA 3IVXA 1ZKMA 2OBLA 1JR3A 1L5QA 1H6DA 2XH8A 3E4CA 1JQAA 3L7BA 2J3IA 4Q16A 2PGNA 1DCKA 1KZ6A 1Y1SA 2H0YA 1OI4A 4ZOEA 3VR6H 3VR4H 4AXBA 1FFHA 3G49A 1RWWA 2C2XA 2NM0A 4YTEA 1GNLA 3R0JA 2IYTA 2PXXA 2I4LA 3EQ9A 3GYGA 1B1AA 2I7DA 2MINB 3A2NA 3WBKA 4BMZA 3PSAA 4HGRA 3LO8A 2VPTA 3TSWA 5JBIA 2D27A 5CIYA 3UPNA 2W11A 5JYPA 2J3HA 3A2KA 3LXUX 1OBFO 4QAQA 3HKEB 1MENA 5CP8A 5K8IA 4C7OB 3TLAA 1O77A 5GL9A 3FVTA 3MCUA 4RXTA 5EP4A 4C0AC 1PLLA 3I4CA 5IKXA 3DLCA 4DCSA 2IEYA 4ZDIA 4DMRA 5COAA 4D6YA 5GGYA 4WMCA 2JLQA 1FQWA 4D9IA 2B1RA 4KBYA 4YROA 4OHUA 1EGAA 3RASA 1HVBA 1XC7A 5AP9A 4YDHB 4YP6A 3V6MA 3ZHOA 3ZTWA 3V8EA 3C8DA 3D1JA 3ZOZA 4O4JA 3VVBA 4MI1A 4Y2VA 3IX8A 1H66A 1UDXA 4OQXA 4X44A 1RI4A 1SVMA 3F5MA 2H08A 2EYQA 2ZOHA 3SOZA 3WS4A 1HLDA 5C5EA 1V11B 3I6IA 1N25A 2Y1FA 4FXOA 4JASB 4PTZA 2ZRDA 2VQ3A 5L3SA 5DLEA 3GAAA 1IOZA 2BTQB 1KEKA 5FA7A 4RTKA 1QCZA 5AIAA 4RF4A 4BX3A 4BIIA 3T4KA 4C4YA 5A1TA 5HOEA 4B2IA 4XIYA 4EYQA 5E9WA 4QU3A 2XODA 1KY2A 3FPFA 2DWOA 3JRNA 3D9YA 4LVNA 2W98A 4FZVA 2EX6A 4C7MA 1U8EA 2J0UA 2X6TA 4BAGA 3BY8A 3CJTA 3ZIDA 1FMTA 3U19A 5GOTA 1G7SA 1RI2A 3T7IA 3T3HA 4F1KA 1W2WB 4J2OA 3P45A 1T9KA 1R8SA 1P9LA 2WIBA 4PFJA 5TX7A 5KJEA 2Q7DA 4F5YA 1USUA 2V1AA 4ARAA 1FILA 1RPZA 3EH1A 1IM2A 1JX6A 3SHVA 1H2WA 1L2TA 4FWBA 3F8SA 2CLOB 1OD6A 1NWZA 3OJLA 4MDYA 1EFAA 5GLCA 3A31A 3F1NB 2X22A 4U00A 1KGEA 3UXHA 2F4NA 1XLWA 2BKXA 4FR0A 4XX0B 4ACAA 4AJNA 2ZIGA 3OZIA 1YZHA 4F38A 5JZVA 1TAHA 2CCJA 1MKYA 2X1VA 2ZRBA 3AFHA 3UQZA 3A6EA 3UV7A 4AKTA 4GAEA 4NYIR 4S2UA 3HGTA 2HQBA 3RRZA 5AJHA 5GJWC 3NXKA 2JLAA 4FC7A 2B7BA 1CS4C 1G5RA 5JQGF 1XKZA 4JVLA 2DBZA 5CB6A 4BQFA 4DRTA 1ELOA 1QE5A 4IHJB 2WM9B 3AHCA 3FGPA 3KX2A 5CUQA 3S55A 2VTVA 4R16A 1ZRHA 3PAGA 1A9QA 4QJ5A 1M72A 4JM1A 3FYCA 4RK4A 2Y2KA 1JB1A 3PGJA 2P7HA 3D3WB 1YBFA 3S29A 5JBNA 2CXUA 3PUIA 1WF6A 2NO6A 2ZC3B 2UWXA 2VEOA 5A1GA 3IHLA 3UDFA 4ICIA 4YRFA 1KSGA 3WLIA 1GVNB 1Z5PA 1Q21A 3HKCA 3HUTA 4PZUA 2PK3A 4YCAA 2W0NA 4A3SA 5KNLA 5E6UB 4J3JA 2YJ4A 2XQGA 4BV8A 4PPRA 4O4HA 1WS6A 3T1NA 5JXJA 1PS8A 1T9HA 2FOXA 3FKQA 5JPIA 3OA0A 3TBKA 4ER7A 3QVSA 1F60A 2LW7A 5EYPB 4QY6A 3C4PA 1BX1A 3UAOA 1HDIA 3EVEA 1EPUA 2DC1A 2RI1A 1RAGA 3DEFA 3EG9A 4LGMA 4DLZA 1EE2A 1KQOA 5BN5B 1LQLA 5HHTA 2QT9A 1OYYA 1TJNA 2W27A 2ZWPA 3QFSA 3JYQA 2KB0A 4FGJA 4H7HA 2Y2VA 1T5BA 4IH1A 3GROA 3QUSA 3QXHA 4QQNA 5EP1A 4OAOA 2JNWA 4MW7A 1FYWA 1OI7A 2J7KA 3GCXA 3HA7A 5CNMA 3C5CA 3OJOA 2M6SA 1ESNA 1K4KA 4BENA 2DHDA 3O88A 1IEXA 1RRMA 2O3RA 2RGNA 3CUVA 2D5CA 1WSWA 3LBIA 1VMKA 1JA9A 1KYXA 3MYRA 5F5XA 5U4QA 3U13A 3KKLA 4BXOB 3J7AC 1NMQA 2WKPA 4J6EA 1E2FA 4RXMA 3UJ6A 4DQVA 4FDUA 2F1KA 5AVRA 1PSWA 3MS4A 1KDWA 2Y55A 2ZUSA 5E2HA 2VUHB 3H7WA 4WAUA 5FBZA 1C3JA 3X1DA 1Z83A 3C4OA 4Q9AA 1NLFA 3Q2OA 5HIIA 5GINE 1D5CA 1VYHA 1K4EA 1O95C 3IR7A 3WLOA 3ABSB 4R41A 3GFRA 3SNHA 4DPLA 3EQ6A 2PQMA 5DXAA 3JR3A 4TUYB 2VNJA 5H02A 3UMDA 3IBYA 1HT0A 4JCOA 5HJ5A 4C20A 3IKTA 1DX9A 3KWFA 4EDFA 2JF0A 1K3UB 1XYYA 3A1WA 4G6ZA 2XKJE 4A8PA 5BWMA 4CUJA 1HDXA 2C03A 5JU6A 3OY7A 2PU4A 1GQSA 2BCEA 1PHRA 4KQJA 1K6JA 3BMQA 4C9BA 5F23A 2CDCA 4DZTA 4ZCQA 1XLVA 5F76A 4PLYA 4DUYC 3ROKA 1T9AA 3QG5A 1GD1O 5FL7A 3EERA 4OHBA 4DWJA 4ZC8A 3WB9A 1W73A 5HZKA 4QY5A 1YR6A 2JK1A 1CP2A 1Y6RA 2E49A 4PAUA 1SBYA 2SCUB 3PRKE 2HMAA 2R1ZA 2W2TA 1FJGC 3Q3GE 4JMPA 1CY4A 2R5WA 4L8FA 3CX4A 1V9YA 2DTDA 3IJEB 4J49A 1E4EA 2DYJA 6GPBA 1G7TA 5T67A 1PHPA 2Q2QA 1DAOA 4KVZA 1P19A 2GEFA 2VA8A 2WE7A 3AUKA 4XWGA 1JJVA 5FHQA 3SBOA 2FDXA 3GMDA 4PBTA 4H1VA 1UEXC 1ZM9A 2C1ZA 4BBAA 1NIJA 5JH7F 3NM5A 2JKTM 4NV1A 1IYSA 2HQSA 4BCBA 1SHKA 4S24A 3W5HA 3D1LA 4Z4HA 2XEPA 5F5YA 3AM4A 4QATA 5BSHA 1DC8A 5LXTA 2H9YA 1DC3A 3FPEA 1KEUA 2L0WA 4ESPA 1NMSA 4V03A 4YV0A 5BYAA 1GSIA 3SZUA 3QY0A 1RMYA 3SVTA 2PY6A 3G13A 1BX0A 2XD1A 2R96A 3WHLA 1A8QA 2MSKA 4MQ6A 4A8JB 5ITZB 4IHJF 3GLIB 5AM3A 1D2CA 1ENOA 1AUPA 2BJWA 3Q8XB 3NDIA 4XLLA 2AJCA 2ESRA 2XMDA 4E6XA 1K57C 2H31A 4MS1B 4C6RA 1B74A 3LDUA 5J63A 4DPMA 2DZDA 2PGJA 5CT8A 5K0ZA 4ZPXA 3AF6A 3FCXA 1FZTA 1GA4A 2FG5A 3ZU6A 1AXEA 2QW1A 2PN1A 3Q7QA 2X5XA 4JGGA 2NLOA 3PFFA 1ZN2A 2JKRI 3W4OA 3EXIA 3OQ1A 3EFOB 2DCMA 1Y81A 4HTFB 1E94E 2A0UA 4RW0A 1S9HA 1NLMA 3D4LA 3HPQA 3UMFA 3UMRA 1ATIA 1CVIA 1N5IA 1HRDA 3PQ4A 1KSFX 4V3CA 3T54A 1QYDA 3E4PA 1MB4A 1ULUA 1ZA2A 4MWOA 5CZXA 2OVFA 4HRAA 4RPJA 2GEVA 5EWMA 4B2LA 3IEPA 2C5AA 4C05A 2I9KA 2Y2UA 3WMXA 3TXXA 1R4NB 3BH6A 3R7NA 3EHEA 1QBGA 3T38A 1IEWA 1L5VA 1SZJG 1Y6ZA 2HV9A 4WN9A 3CW2A 1SXIA 4Y15A 1DT3A 4DB4A 3VOYA 2QT0A 2OYCA 4C7JA 4DLAA 4P31A 1KKGA 2TYSB 1MGOA 1GKKA 4AUNA 3ZK7A 4OYYA 3KTAA 4OLJA 1VEUA 2R2GA 3VM6A 2GF2A 4BJ3A 3QPAA 4LFUA 1BMDA 3PP8A 3WGZA 4O8GA 3DUFA 3KT6A 3GRUA 1D03A 5JRDS 4EBLA 2XMGA 4K3UA 4PZCA 1R3DA 3QV1A 4ND1A 5DMHA 1GGJA 5E2BA 4Z7OB 1P1FA 1BOFA 4M89A 3M9XA 4FZRA 4QD3A 4BQRA 3OPHA 3MKFA 4EVIA 1FW8A 3O3OB 2IYPA 4OQLA 5DHAA 5A2QD 3GR2A 1SFRA 1J9EA 1II0A 1O97C 4JJAA 3H5NA 1YAXA 1ECFA 2JLXA 3VQTA 1WEHA 1T3GA 2G06A 2QY6A 3NO4A 5JAMA 1UXJA 1RGYA 1L8AA 1XCPA 2PL1A 1FDOA 1TOAA 2H7CA 4J94A 4Y1RA 1IRIA 1H2YA 1UKAA 1YONA 1TADA 1TCVA 3BCSA 3GRYA 4NJOA 2HA6A 4DW8A 1UBLS 2C96A 4HDKA 1FVHA 1UFQA 2CK3D 5DU2A 1V39A 5DSTA 5FOUA 4X56A 1MKIA 4R01A 4CM8B 1E1QD 1GSVA 1VHDA 1W47A 4D9JA 3OIGA 4GQBA 2PQ0A 1Q91A 3PKZA 1UDCA 2HF2A 3VHRA 5BNWA 1LDGA 1F8GA 3DFUA 4XZ3A 3H9QA 3L06A 2G8LA 3WWZA 2B7LA 4DCNA 2ZBEA 1E2MA 4NFYA 2JFUA 5A71A 4WDRA 1ZS9A 4NZYA 4GD3Q 4TVSA 1JFSA 2G1KA 3CZCA 3TCNA 4KAAA 5HQJA 5LJIA 4DE3A 2JIZD 2W00A 2X1LA 1QPZA 2IRWA 3IQXA 1MWSA 2ZT5A 4EELA 1Q0QA 3CYFA 4WZBE 3DL4A 1UXKA 3NKLA 3PA6A 3G6OA 3C6XA 5LYJA 1RM4A 3WE7A 5BR8B 4B09A 3EEOA 4ON9A 4BC1A 1DADA 1TT5B 2IEIA 3KJQA 1KXJA 3FCCA 2C7BA 3LY5A 3LNVA 2FPGA 2V6GA 2YRXA 3FTCA 1JMYA 4K6GA 4XSHA 4B4ZA 5TT1A 4JBHA 1NBMD 1N4AA 3EUFA 1PK9A 2JAXA 2MYPA 2R60A 2NAFA 3D4NA 1TIBA 4HBUA 3NEPX 4LWZA 2WRZA 3SJZA 4WJLA 3PKIA 3KPWA 5HJEA 3C4QA 5CDFE 3T7CA 3OKFA 5JYCA 3F1OB 4ETWA 3PPVA 5TEVA 3EG5A 3FWYA 2ZDGA 4L5BA 5EKXA 3M3DA 4C4PA 2XKBA 1I3KA 1UDWA 3PR2B 2PV0A 1HQCA 4XDZA 1EUCA 1Q92A 2V7QD 4LOIA 4EF4A 1M83A 3S2EA 2I66A 3A9WA 4M36A 1MQ8B 1GV1A 2XNDA 3ZCZA 3M70A 1O95D 1YVEI 3BEBA 1R4MB 2O57A 4F3CA 2J3QA 1NSYA 1P7VA 2K7ZA 2P74A 1RM0A 1T8PA 3NHLA 3GRZA 4HZGA 3WL6A 3EJ6A 4UDYX 1K7YA 1UOQA 3WVNA 3GX1A 2HUPA 5KIAA 4WZ6A 1NYTA 2IVZA 4P34A 3T5MA 1QJ4A 3KQTA 3QFFA 4UFNA 2ZJBA 2DWUA 1V7QA 2ISQA 1S4SA 2JJ2A 2JH9A 4N7RA 4W8OA 3BFEA 1T91A 4HSGA 4MVJF 4MVYA 2QGZA 1KJ8A 2FWJA 4G67A 4ERXA 2DR3A 1U2PA 2QA5A 2QVZX 3WFJA 5FAOA 5FLXA 4R3WA 1X77A 4FSDA 2XNSA 3SLRA 1VRWA 2HV8A 2RAUA 1SG6A 1BLHA 2PU7A 3AI7A 3CAXA 5CRIA 5F78A 3W6PA 3JASA 4HP4A 1NATA 2DX7A 3LHIA 3E03A 2H92A 4IHAA 3QU4A 1KOLA 5KJFA 3DBIA 2Y0CA 2HJRA 1Z88A 5L4NA 2J30A 1SNYA 3ID6C 2G83A 4NFHA 1MDBA 2QZ6A 2C8KA 2X7XA 4KXMA 3SKYA 2QJWA 3Q87B 2XWJI 3WKDA 1AMUA 1EM8A 3QP1A 1MNAA 2G77B 1H8HA 1AU9A 2CFSA 1GAXA 5B53A 3MTDA 2J48A 3LHDA 3CH6A 3HEBA 3FSJX 1PV4A 5E95A 1WQ1R 4QT0A 2V54A 2II6A 4L75A 4AX8A 2D5IA 3L7NA 2R5NA 2YQ4A 5IJZA 4LKRA 3FZEA 1X1BA 4HJXA 3NHMA 2BFFB 1AF4A 1JLSA 1SUCA 1YUMA 2O3QA 4MWGA 4OYHA 3SS5A 4B9OA 3ZXIA 1OTAA 1OX4A 2R84A 3AOGA 1XXHB 2X8AA 2VPZA 5IFLA 4LTNA 2SKCA 1M6KA 3GQZA 1VJDA 1WMEA 2GRJA 4ZI7B 3W5DA 4WBSA 2D7VA 3T1VA 1HY3A 4I9HA 4BNHA 2J9YB 4HYQA 3AUSA 1JYSA 3I2GA 2NPIA 5K8VA 4GPEA 3GJTA 3DEZA 3T9DA 5TRTA 5AVKA 2QL9A 1JBQA 3I8OA 4B31A 2HRRA 3HJHA 3OHSX 4NICA 3PGMA 3M2PA 4KR2A 2P9GA 2FPOA 3PL1A 3WDLA 5I9LA 4I9UA 4R7ZA 4RHYA 2PUTA 4NDZA 1QVWA 2GN9A 1O4WA 2BHSA 2JHCA 2R66A 3IUQA 3P9PA 3Q98A 4OB8A 4D82A 2W4MA 1IOWA 2V6FA 3N0TA 2EGGA 3C8UA 3PNLA 5GAJA 4Z51A 4O2BB 1WCJA 1OXMA 1OYWA 2GPYA 2NGRA 2WZBA 1KI6B 2JAUA 4MZDA 4DA0A 5BUQA 5IN5A 1BC5A 4HGZA 4HH4A 5B12A 5EZYB 5JZBA 2ZJ7A 3JQAB 5B36A 3HABA 4RY2A 2QN3A 2XCOA 5DHSA 3ZV4A 5H8WA 4TWIA 3BSWA 2NXNA 1HYQA 4II3A 1K6MA 3NAQA 3MXSA 2G76A 5GZ3A 3CZQA 2BASA 4FHFA 3I28A 2PNJA 3T7KA 1Z7WA 3DXFA 3ZNYA 3K9HA 4IM7A 1E69A 3U3MA 1DJBA 2AOXA 2CMHA 3BH7A 1FRNA 2G0NA 3OQHA 1XWFA 4FINA 4K9NA 1FU7A 1UMKA 2B5OA 1VJ5A 4QLAA 3AB8A 1D2MA 1L7MA 3UZUA 4UBLA 1IUNA 1SUBA 3MWDA 2ZR8A 5J4VA 2ZM5A 4ZYXA 2HHLA 5H68A 1OIVA 1N9NA 1IEVA 4GXTA 1RDFA 3BFPA 5BR7A 1LBTA 2I9PA 3IHBA 3GBSA 1L4BA 3TBFA 4EAQA 2P9FA 4DBZA 4J6FA 3T4SA 3AR5A 3KT8A 4ETMA 4QU9A 1PO7A 1JUDA 1QLJA 5DHQA 1R6XA 3P9CA 3Q9UA 4J4HA 1ZIDA 1PS0A 4PUGA 5EPUA 5ER9A 3Q72A 2IEAA 1PDOA 4ALLA 2BMFA 3ADDA 2ZL1A 1U5BB 3BHMA 3BIXA 4BFVA 1MVNA 2FWIA 3AINA 4GRAA 4AUEA 5K01A 4XUCA 2PUBA 2IYOA 4KR3A 3HVUA 5JLAA 3GMWA 2OENG 2FW9A 3HJIA 3C5HA 1RXWA 1H8ED 2KI5A 3WO0A 3WQRA 4TRMA 3V7YA 1E62A 3VU1A 2PRZA 3STHA 3ZVTA 1E7SA 3GWGA 3MBIA 3LT4A 4W1SA 3LY7A 1N0IA 1HV8A 4IJGA 1EK0A 5JRHA 4BCAA 5DF9A 2CNDA 2HXSA 2O8VA 3NIGB 3Q07A 2G9ZA 3ASZA 5BUSA 4I1YA 4BY9E 5KOHA 1XKXA 3MMZA 1EVQA 4UU1A 5AI6A 5CGZA 1XFNA 2H07A 2HMSA 2P91A 4MS3A 3K6RA 1VFPA 3TTVA 3V8MA 4JI7B 1J0BA 1KE0A 2D0OB 4N54A 3QHYA 1X1TA 2X01A 1KVTA 1XZBA 2XB8A 3L7KA 4HNQA 3SHWA 4BX2A 4BFWA 3GSGA 2J9RA 4NI5A 2AT1A 4QIHA 2RH5A 4ZVRA 4H15A 1YJCA 1LSJA 2AL7A 2MOKA 3IH5A 3T7RA 1RWBA 4DDWA 5KYWB 3U4DA 2XWSA 2ZYWX 3D1VA 4FFLA 4L16A 1S8AA 5ICSA 1LTHR 2X1HA 5JG7A 1Y3IA 3FUXA 1F9IA 4LC1A 1BNCA 1I3MA 1RNLA 2FSVC 2ZJ3A 4QNNA 1ZNWA 4QUIA 1XXHA 3MWDB 3VU8A 5IDXA 4JXZA 1T6NA 5K4GA 3QP5A 4IOLA 5FO0A 1A77A 3K72B 4QICA 5KQLA 3DTVD 5B64A 2PKCA 3K2EA 5FLXD 4GXQA 1JSLA 1KI7A 4U7FA 2WYVA 3SXPA 4K0WA 1FDIA 3FYUB 2Z6DA 4Q1EA 4XGRA 3V8BA 2FUEA 3JSAA 5AM2A 1E9BA 5E4JA 1XGKA 1CY1A 1GGVA 3GNQA 3U2AA 4LDZA 2WY2D 5JQGA 4KZ9A 1EZZA 2X5OA 4TL7A 2H2WA 2N9UA 2Y0BA 3E4QA 1T1JA 2JBFA 3NTLA 3P0HA 4JROA 1YI0A 4U8HA 3B1WA 1KMNA 1D9XA 2OOLA 2I99A 2P75A 2W6OA 3F6BX 3OSUA 4J9UE 3ND9A 4MWBA 2WIDA 4PIVA 1N34C 1SUSA 3BHJA 1E1QA 4XXRA 3N7TA 3H2JA 3QGMA 4LYEA 3K09C 1QP8A 3KR0A 4PYOA 3BIOA 1X39A 3ZGYA 1J6UA 1NXYA 1I4LD 3VSLA 1SOVA 4UVHA 2IVFA 1MT0A 4KBFA 4TRRA 5EFWA 2P2ZA 3DOHA 2B69A 5BYBA 3NORA 1ZVQA 3QEJA 1WB5A 1ZX1A 2BV3A 1WJGA 4QYXA 4G89A 5ESDA 2R68A 1AZTA 2JCBA 2VP6A 3HSSA 2YN0A 1JJBA 2VJMA 3CEJA 2H54A 2O9JA 3NYWA 2HH9A 5I48A 2VDRB 4C6SA 1RXIA 4ZDXA 5HW3A 2FB9A 2TMKA 4P4GA 3ZE9A 4JCCA 1F14A 4UPEA 3GVPA 4B7UA 5EM1A 3N8KA 4YWHA 3VR3A 1BCRA 5AQ7A 1JZTA 2PUGA 3AHEA 1FSGA 3TJMA 4FT2A 3ODGA 4D0LB 2P0AA 5CVJA 2VHJA 1ML8A 1VLJA 4PM4A 4D9KA 1SWWA 1R64A 3A7DA 2PH3A 4FYMA 1GARA 4GZ5A 3SEFA 1EQAA 2CY1A 3G2HA 4E4RA 1XF9A 4IGFA 2NYVA 1ULHA 3K3PA 3SGLA 1PZMA 1VRVA 3I6BA 4HDOB 5DOZA 1SCQA 4EO9A 5HM6A 4EOGA 1EX1A 2Y8HA 1FYDA 1YCFA 3RNOA 2ERCA 1N6PA 4N5MA 1AUXA 1ZUWA 4ND7A 4G0NA 3OKPA 1C9NA 4UAJA 1JFTA 2ZULA 5EL0A 3SZRA 3GLKA 3L6DA 3QSYA 1MOQA 5DHFA 4QLOA 4KZ4A 1YFZA 3L2OB 1ULTA 2JGDB 1BS2A 3S1AB 2FWRA 2WVAA 4MR7A 2CL6X 4B3MB 5EZSA 3C1AA 3L01A 2E4UA 3OPXA 4PAOA 4IJKA 2HJ9A 4O2AF 5FJIA 3SXUB 5MFZA 1SC3A 4HO1X 3TW6A 3TQTA 3SSOA 1YLPA 1F7UA 2IF2A 4NBLA 2JRLA 3NHRA 4OHOA 4P8RA 3M82A 4YUZA 1H5QA 1V5WA 2X2PA 2BD0A 3L40A 5KNCA 3HO8A 2GPBA 3PC7A 3LOPA 4N3BA 4C6TB 1V8ZA 2IP1A 3FKSA 1R7RA 4HKTA 4NDAA 3BXPA 2VSFA 1JMKC 3HFGA 5GJBA 3GOQA 3O84A 3ZYTA 4R38A 2WYOA 1E6LA 1XMXA 2FFRA 2PBLA 4RLHA 4TS1A 2X8LA 3DCYA 4YAGA 4K9RA 4XDHA 4CM6A 3A0UA 4UEJA 3RSCA 4DUGD 4OXNA 4C01A 1DLJA 1F9AA 1L4GA 1PG3A 2H4FA 3EWIA 5DK6A 4BP1A 3NNSA 3E4OA 2VAXA 2J3TC 1Z2PX 3FWNA 4KN6A 1NVKA 3ZDRA 2Y3IA 2IZ7A 1A4IA 1BMFD 1GLNA 1VHWA 1TA0A 4LV1A 2PAVP 2H17A 3EMDA 3TTYA 2ZQAA 1RWKA 1WCWA 1H8HD 1S1YA 5AK3A 2M6KA 2FI1A 3DDHA 4C21A 5C7IO 4ZV4A 2D7DA 1ADBA 4C7VA 2VHVA 2H1CA 1WWKA 2OBBA 3MS2A 4J0HA 1M0EA 4TVBA 1RHQA 2BF7A 1ES4A 1IMJA 2QYHA 2X41A 2YHBA 3V32A 3ZZTA 2NVUB 1QKKA 3G2IA 4MQBA 4O2LA 1XCJA 4I99A 2AQKA 4E6EA 1X7YA 4RTSA 1T4DA 2QTVB 3ADKA 1YACA 3IXQA 3URMA 5KJ1A 1IU9A 2BZSA 3P8ZA 4JA0A 2ZRMA 1DY6A 5ARCA 2LXNA 4KPYA 4CQLB 3EVTA 5C80A 3KETA 4EZIA 4GKJB 2L1MA 4HPJB 1EWTA 3AXSA 4LQDA 5B58C 4Y98A 2C77A 5IAKA 3SO4A 1DKOA 1W5BA 4EHDA 4L3OA 2HA3A 4ECAA 3JVEA 4BRUA 1PA4A 1S02A 3E35A 2PT9A 5BN1A 3DFKA 1YOVB 4YREA 2FW0A 2B02A 4XWYA 1MDFA 3CITA 5CIQA 5K8JB 4Y7PA 2D8AA 1RYEA 1MPTA 1DRVA 2AR0A 4X94A 3K6JA 3MAGA 3OZFA 1O7EA 4NENA 3V4VB 3UGJA 4RD6A 1Z8HA 1HDOA 4Z53A 4LXYA 2G8NA 2JC7A 3STWA 1KNQA 5LA6B 3JY6A 2RKWA 4D8YA 5CX1A 1KARA 2FYTA 2V55B 4HP9A 3A70A 1U4OA 4QU5A 5A4IS 1ITZA 4YI5A 2G28A 3GZJA 2FWMX 3FZGA 5EFOA 3KQMA 1ONHA 2ZVJA 3LEZA 3X1YA 2Q2OA 2VTDA 5JHGB 4L6IA 4MP3A 3UUEA 1UQRA 2V5AA 2NO9A 3BC1A 3GD5A 3BAZA 4UBOA 4EJ6A 3T3OA 2RIRA 3H5IA 3OLZA 1P1CA 3IAFA 3PD0A 4H35A 4Z6KA 1GSXA 1O03A 4AD8A 5CVDA 4AKHA 2PYDA 1C2TA 3NDJA 3BD6A 2VJOA 5LP6A 1SWVA 4G23A 1MMFB 4E94A 1IZ9A 4FDTA 2QL6A 5NLLA 1O6ZA 3F3KA 2LZ0A 4AULA 4C29A 4DYHA 1I2DA 1CJVC 2BSAA 3MM4A 1ZUNB 3DV0A 2OVBA 4GBGA 5G4KB 3T34A 4GKBA 1ETUA 2Q29A 3ULFA 3NONA 3CH5A 3SDSA 4OLDA 4OTZA 3CC8A 3KZXA 4TMXA 5H82A 3TZKA 4ZZ0A 4DJTA 5HK8A 5IU1A 3BMOB 3R5TA 2B2XA 3ZKWA 5KPDA 4R05A 1Y54A 2GLTA 3QKTA 4X41A 3HJCA 1CHDA 1L5OA 3CR8A 4KLZA 4PHHA 3JYOA 3ZW7A 4CIVA 3GC6A 2W90A 4H3HB 1BWPA 1HEYA 3CNEA 3C6KA 1Z12A 1SK8A 2MR5A 1B8OA 4PYJA 4GDBA 1GGNA 3L1UA 2P5SA 3S7TA 3UNXA 2XCRB 2VUUA 3CX6A 3H0EA 4RUKA 4NABA 2WTEA 2HF6A 2YH2A 3M8KA 2DETA 4O8CA 3KJNA 3STUA 1H8EA 2ZYRA 4ZVLA 3DO6A 2TMDA 3H1GA 1FXWA 1LXCA 5EI5A 5BQOA 1J0XO 4LZZA 1W4CA 3NATA 4G2NA 3A3EA 4RA6A 3HHPA 3QZUA 3JVDA 3M4JA 5EA2A 4DUYB 2HU2A 2W9XA 4I19A 4G5RA 5EGSA 3RUIA 3L18A 3ZCTA 3KKQA 4FVTA 4DT1A 1KOUA 2G88A 4WKGA 5KHLB 3TQSA 2HV1A 3U62A 2QM8A 4BQEA 1JHXA 3CLTC 4CLCB 4E3MA 1C8LA 4E5UA 1P9RA 2Y2NA 1SIOA 1OR8A 1S96A 4D43A 3K9LA 1M2NA 3MTAA 5ETJA 2JGJA 3KXIA 1ZBDA 3AYXB 1YH3A 1PGPA 5KNBA 3QLUA 4RV5A 3LQYA 2OOKA 3A4VA 5LIRA 3LV8A 1XZLA 2G4CA 3K96A 1PQUA 1XMVA 2Z2JA 1DPFA 3HACA 1M7GA 2M5OA 4S2NC 1JR2A 3H8JA 1CQAA 4BUZA 1E5QA 3V7NA 1FIUA 1VJ1A 5F2NA 3ZGZA 2OHXA 5ILGA 1RMTA 4KLCA 3G5TA 5ICMA 3ICQB 3KSFA 5TQJA 4KR7A 3MT0A 3SSMA 3SH8A 3GH1A 4DLSA 3RYCB 5KYWA 2HL6A 1IOUA 1ZG4A 3T4JA 5IDVA 1IDN1 2HBRA 4X95A 4F97A 4TLDA 3TSCA 5A3JA 1Q6ZA 1MFZA 3W2ZA 2LE0A 3K9BA 5D01A 3DULA 2XQFA 3O8DA 3QI7A 4QGGA 4HUQA 5F51A 4FE7A 2NUAB 5B1EA 4NEGA 4Z0PA 4QHCA 3BHNA 3DAPA 3JWIA 4PR0A 1RYZA 2IPOA 4J2HA 4ATNA 5DM70 3LC7O 2ZJAA 4V39A 2IIQA 2ZP1A 2BYTA 1V16A 2PZLA 2PIAA 3G4PA 3NM6B 1A8PA 1YZFA 4K9DA 3BMOA 4A0RA 3KV1A 2RH4A 4H1UA 2Q5FA 3I72A 1P17A 4LQLA 1SCJA 4PW0A 3OC2A 2Q0HA 1WUHS 4K6OA 3KELA 4YXFA 3V1UA 5LQSA 4AZ3A 2OC9A 1UBUS 1L7XA 3FWLA 2WV7A 3ICOA 4TWBA 3Q3JB 2X13A 4BNFA 3LFTA 3C7UA 1P39A 4MPPA 4ENTA 1BRMA 1E0JA 1L4LA 2E7ZA 1H2EA 2XECA 5J4EA 4KV7A 2I7CA 4ND4A 3G5LA 3JQBC 5IC6A 3I5AA 4GI2A 3W9SA 5JHHB 2X14A 3HJAA 1I7SB 1SBTA 2WMOB 1CZLA 4LY9A 1GU7A 1VE7A 3EDRA 4W5WA 3G79A 3QOFA 1Z5VA 5ALWA 4A8JC 4CV1A 3O86A 4QPRA 3BGIA 2G08A 5IKEA 5J43A 1I94B 2DWCA 2D06A 1ONBA 4ENRA 3C3MA 3Q4GA 4YV1A 3UZ0A 1GG9A 1TNDA 1P0QA 4AO8A 1ZY2A 3DYIA 3OIFA 2GYYA 1LPNA 1ZK2A 2WUVA 1OUMA 1NZDA 1SOUA 3KOWA 3CVWA 3PIDA 3RO7A 2AIRA 2XA7S 4ZV9A 1C7RA 4MLCA 1FCJA 1QTIA 3ETEA 2GN4A 4N6OA 4M88A 2DFPA 1Z2EA 5TBMA 1DJQA 3TG8A 1YASA 4KQ6A 4TXHA 1GNVA 1L8QA 4WERA 1GRQA 3QKSA 3PBKA 4ZAZA 5AVSA 3FX2A 4E3IA 3F7MA 5C37A 4PR3A 1WZ2A 3I0NA 5DGHA 4UU0A 3E2LA 3WYCA 2ODPA 1R9JA 4NU0A 5LZ5A 4IIDA 3RYTC 5D00A