4PHTA

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
485
structure length
438
Chain Sequence
RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEADKEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAGEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
total genus 127
structure length 438
sequence length 485
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4phtA01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4phtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phtA03
3KKPA 4B43A 3B1VA 1F2TB 5DN6D 1CF4A 1DARA 3OE7D 521PA 1XJQA 3A8TA 1KSFX 1RRPA 5AUQA 4IOMA 3LH5A 3W6NA 3CUEF 4YMVA 1KOFA 3LVRE 4GOKA 1NIJA 3KJEA 1GZSA 1T6NA 2AX4A 5D3MB 2P0EA 3U7HB 4FMCF 1U8ZA 4NBSA 2DCUA 4S35A 3WHKA 4D0GA 2D7DA 1RJ9B 5KSYA 2NQ2C 3KTAB 1W0KA 1D9XA 4B3GA 1XD2B 4GFDA 1NLFA 2HEIA 4TYYA 2CL7X 4M1SA 1KIMA 1QDEA 1ZU4A 3M4YA 2EW1A 1P9WA 5IK2D 2J0QA 1G291 1S3GA 4B2PA 3GCGA 2OZEA 4JMPA 3QSYA 1DTSA 2VHTA 3MJRA 2WSSA 1U99A 5AK0A 4KI0A 4B6EA 1Q1BA 1W4CA 2I1VB 4YMTA 3RS3A 5JFGA 4V03A 3MWLA 4FMCB 2GETA 3MRSA 3BFVA 1RW4A 1Q3TA 3SJAA 2WOJA 1MABB 1W44A 2AXPA 5TMPA 1QHXA 1LB1B 1NG1A 2ZI7A 5H1YA 4RKEA 3ZLJA 1Y63A 4CYMA 2JGNA 5FPKA 3O8RA 1SVOA 2QNRA 4LYFA 4TL6A 1L2TA 1EX6A 2RKOA 1MT0A 1P9RA 3KDSE 2XOKA 2FA9A 1OFUX 4JZKA 5EZ5A 3BK7A 3VKHA 1KZGB 1JR3E 4BLTA 3V4RA 4G01B 2QTVB 1N6PA 2O52A 5FUXA 4C0JA 1QVAA 2RGNC 4US1R 1AQYA 1F48A 4LPKA 1G21E 3H0KA 4CEJB 3FMOB 3CM0A 2FX3A 2JDIA 4MA4A 3T06B 1W2HA 4ZCLA 2O8FB 4UXJA 1Z6AA 3A36A 1TEVA 2P2LA 1T3SA 5A5GA 3PEUA 1EWRA 3WNBA 5IRCD 5B2ZA 1OSNA 3B13B 3CX6A 3BGWA 4L5BA 4XSGA 2WBLC 4S2EA 2J7PD 4XTRA 2GXSA 2XNDD 2ZUCA 2KE5A 3A6PC 4B76A 2QTFA 3I5YA 1Y3AA 1AQUA 4UQOA 2WHXA 1XXHB 1KDRA 2OXRA 2V6JA 3BD9A 4BFYA 3ICQB 2IXGA 4TMWA 5JHHB 3CNOA 1BMFD 2ZITA 2JLRA 4R71A 2W6IA 121PA 4OBEA 4IEIA 2VHUA 3OIUA 1CEEA 2WOOA 1QHSA 2QI9C 3KL4A 1ZC4A 4IOLA 3U3RA 3OESA 3LLUA 4M2LA 2O0HA 4NCKA 2WMOB 3Q8XB 5DI9A 3B5JA 1UFQA 1P4SA 1UBCA 5FOWA 5J4KA 5G3ZA 4KU4A 2WWHA 1OF1A 2BBOA 4G5QA 3QY0A 1XRJA 4IXNA 3QPUA 1GM5A 4NH0A 4OK3A 3SJZA 1E1RA 4NL4H 1G8PA 1PLLA 1E9SA 5CYOA 3ZVRA 5DI3B 4A2QA 1VCMA 1XEXA 4NP6A 1ZUNB 1DAHA 3C5CA 3LBHA 1IXSB 1E0SA 5C4MA 4Q9HA 2ZAMA 2IYQA 2QGZA 1OB2A 3T1TA 1N5IA 3QG1A 4KODA 3L0IB 1W2GA 3HU1A 2Q21A 3IIKA 2EYQA 4BLQA 3TJZA 4EQ6B 4PPGA 4QC2A 5HZKA 5EP2A 1S96A 2EU8A 4QNMA 5LDDC 1UKVY 4LC1A 2V7QA 4Q7JB 1U8YA 2HDNB 5BYKA 5TVKA 3NEJA 3SBDA 2A5YB 4IFEA 4G1UC 2D2FA 2WJHA 4OJKA 4OHWA 4WZBE 1XTKA 2JLWA 5KHOC 1RYHA 3IHLA 4DIDA 3NBYC 1HURA 2N42A 5BYJA 3HP1A 2ZE8A 4IVRA 4EPWA 2ZANA 1VHLA 4EPYA 3AKYA 2VRWA 3BBPA 2W00A 3NEYA 2IA5A 3WMGA 2F1JA 3I8XA 4M9SA 5TB5A 3MGCA 2FMXA 3L0PA 221PA 3A1SA 4HDQB 4CEHB 4RD2A 3P27A 1AS0A 4R7ZA 5EUMA 4Q1BA 3IBYA 2PJRA 2UZIR 3SZRA 4LK2A 2HF8A 3KJGA 1IM2A 1KI6A 3QKTA 2W0SA 3ZIAD 1FPMA 5DO9A 3K9LA 4UNRA 4ZPXA 1ZW6A 4CGZA 1E79A 2CL6X 2J45A 4U00A 4JYBA 2HJGA 4URZR 2PBRA 4F38A 1QHHB 1W36C 2X2EA 4KBGA 5BXQC 2QUZA 3F5FA 4RJLA 2GJ9A 3AVPA 1Z3IX 1K8RA 2O0KA 2ONKA 1MRNA 4MRVA 1XMSA 1JAHA 3K70D 1VCOA 1KI2A 3RS7A 2GXUA 4A1FA 1OXUA 2J41A 2JA1A 2YWHA 3GLHA 4L9WA 2B7CA 1U8AA 3SI7A 3EIEA 2G1JA 3QF4B 3GLFA 3B1XA 4EJSA 3H4MA 1E0KA 3K09A 1DAMA 3Q7QA 4URVR 1DAEA 1PUJA 2IYXA 2ZUDA 3CRW1 3VU9A 1FMJA 4FMDB 5KDOA 2DBYA 4AURA 4XSHA 3ICEA 5AJZA 3GJ5A 1QRAA 3Q5DA 3KKQA 1DADA 4IVPA 3IGFA 2H5EA 4JLKA 1MO5A 1SXJD 1NKTA 3AVYA 1GILA 3C16C 2IUSA 2VP0A 1JI0A 3I3SR 3QOFA 4EUNA 4P4SB 4PC2A 1DOAA 4BLSA 1NJGA 1TF7A 5AJXA 3E2IA 2V1XA 3ADDA 2QPAA 1N3BA 3U3JA 2JIZA 2IYZA 1GNQA 1N6LA 1OIXA 2BMFA 4Q7KA 1LS6A 1IY0A 1KJZA 2C03A 2CHQA 1W5SA 1GRNA 2VP9A 1VYUA 1XXHE 2IF0A 5HE9A 1EXMA 4GDFA 5SZIA 5C1BA 4H1VA 5ELXA 2O8DA 1RIFA 2OLJA 4RCZA 3W5JA 4BUJA 4EPVA 2IK8A 3L82B 4P31A 1HTWA 5J47A 5J4HA 1WE2A 1NL3A 3N5CA 2P5SA 1DAGA 3CF0A 3T34A 1GSIA 5GVSA 2QBYA 4BASA 4C30A 4BRUA 5A4JA 4I4LA 3WRYC 3C4JA 2FZLA 5ANRB 1AKEA 3WNDA 4DSUA 2J87A 2H7VA 2D74A 2VHJA 2ASEA 4II7A 2WMNB 2OM2A 3RABA 5LBIA 4BEJA 1COWD 1RVDA 3LV8A 1DE0A 1ZM3A 4BFXA 2FWRA 1E98A 4BFSA 3EAQA 5GJBA 2FG5A 2ZROA 4HAUA 1GRQA 2AWNA 4JIMA 3HR7A 3EPHA 1JR3A 2W2XA 4P4UA 1OV4A 1GFIA 2ZJ2A 3UATA 2N46A 2WJVA 3T5GA 2C04A 1Z0IA 4U02A 2ERXA 3DHWC 3TAHA 1UDXA 4IW3B 2IUUA 2REBA 3L8ZA 4A8JA 2YZ2A 1XX6A 1UM8A 2GBLC 2ZJ5A 3LAWA 4FXPA 5E95A 4PTLA 4AD8A 2RGNA 3CWZA 5E7MA 3RRMA 1OH6A 5KUTA 3CZQA 5EXSA 4O3MA 4BLRA 1TUEA 1KSHA 4XD7A 4GOJA 1Q1ZA 5JS7A 4D6PA 2G77B 2BHRA 1O87A 1E0JA 4JLDA 3NWJA 2E87A 1XDBA 2OSBA 1HV8A 2W83A 2RGCA 1G7RA 5BN5A 4P4TA 4V02A 2DHRA 5TARA 4LJ7A 4QOSA 1AK2A 1AS2A 4JVMA 4JLVA 1X1RA 4HLDA 2WWYA 4C0KA 5BWMA 2BCGY 2I4IA 1RRCA 3ASZA 2WM9B 1AA9A 4D82A 1ZD9A 3A37A 3OEED 1S9HA 3UMFA 3LQQA 4FD2A 2OESA 1KGDA 3PIRA 4RD3A 2P6RA 4E03A 1XCGB 1LTQA 3LFUA 3LXXA 4MRSA 3PUWA 2B7BA 1R5OA 2K5UA 3HWSA 5J40A 4KVGA 2RGXA 2XTMA 2WJYA 5TXGA 4G5SA 3L0SA 1ODFA 3OEHA 3ZS8A 4KO8A 2OFXA 3PV0A 1XB2A 1E2FA 3KQLA 2WWWA 4O25A 3WBJA 2Q6TA 4NU0A 2JJ1A 2V9PA 5JZVA 4TZ6A 1US8B 2ZRDA 1UAAA 1PZNA 5FBVB 1KSGA 3VFDA 5FBQB 4AG5A 1G7TA 1GG2A 4PPQA 2CNWD 1Z0FA 1QG4A 3MD0A 1AGRA 5EXPA 2ZSBA 2FU5C 1FMLA 3TUZC 4HUQA 3MCAA 5HCIA 4TTQA 1E69A 5HR5A 1Z63A 4ZV4A 3SN6A 1S8FA 2ODNA 1U9IC 1P2TA 4URXR 4DLWA 2J7KA 3CRVA 3AF0A 2ZE5A 1HH4A 4A2WA 2XNSA 3S1AB 2R6CA 2GCOA 2ATVA 2IYLD 1F2TA 3FPAA 3FB4A 2IUTA 4B6FA 2FV8A 4ARZB 4GMDA 2WJGA 1ZP6A 3RRYA 2YINC 2WVJA 5F3WB 3JZMA 4XWKA 3K8YA 4UXIA 1FNNA 3MG9A 2HLDA 1ZNXA 3VX4A 1IN8A 1G8HA 5D3MA 5EP3A 4HLCA 1ZCAA 3RS5A 1RJ9A 1P9NA 1RRGA 1ZAKA 2EFDB 3DDCA 2C9CA 1A82A 3KTAA 3OIVA 4HAWA 4I1VA 1XD2A 3CONA 3PEVA 4AIIA 1NKSA 2YOHA 2BBWA 2I1QA 4A0FA 3I8SA 3WXMA 4KCGA 4B44A 2PEYA 2R6GA 2F6RA 1KHTA 1V43A 3OIWA 2PLFA 1W5TA 2GCPA 2JCSA 3F8TA 3K0FB 3TSWA 4PAQA 2KSQA 4F91B 2QZ4A 4AWXA 4KAXA 4AYWA 4M9QA 1NN5A 2AN9A 2QMOA 3BH6A 1W0KD 2C95A 3GFOA 1MABA 2ZI6A 3RRZA 5HZHA 2FFBA 4HAZA 4DBLC 1OYYA 2OO7A 4ON9A 4B35A 3EZ9A 4MKGA 5K8LA 2GZHA 5AUOB 3EPKA 3KUDA 2LWIA 1GP2A 5L3VA 3U6BA 2WSSD 1WCV1 2GK7A 4PSKA 5FOSA 5KSPA 1V5WA 2XJ4A 3SFVA 2F7SA 3K1JA 3WP1B 1XCPA 1R0XA 4CEJA 1JXOA 1U0HC 3DO6A 4FN5A 2O8FA 4EPTA 3IO5A 3P26A 2MSCB 4CRWB 1WP9A 3QQ5A 1FTSA 5BN4A 3GEEA 1KTVA 2JLQA 4OHXA 2XOKD 3UANA 3X1YA 3EW9A 1ELOA 1TMKA 5JLJA 2ZYVX 4ACBA 4UJ5A 1Q21A 1KI9A 4D2IA 2IYVA 2KBEA 3TQFA 2ZYTX 1OB5A 1G6OA 3TUJC 3UG6A 1XTRA 3CNLA 3WYGA 4PANA 3EA5A 2DPXA 4LYHA 1E32A 1P3JA 1XXHA 4M8NE 4UNSA 2EVWX 5B30A 3OAAA 5G40A 2JDID 3WRXC 4OHVA 3P4XA 2FDCA 2ZYWX 4K46A 2HXYA 2YJTD 4LHWA 4B74A 4DCTA 2XX3A 5FBRB 1JJVA 4E22A 4M1TA 4DLVA 1AKYA 2VP6A 1L4YA 1MO3A 1W48A 2O5VA 2OXCA 3WBKA 1IOZA 4QKQA 2GXAA 3VX3A 2YC2C 3B7GA 2ZJAA 3SU8A 1VMAA 2BKUA 4OI2A 4Q5IA 1KO1A 1Z5ZA 1N6HA 4EAQA 2AKYA 1CR1A 1T8UA 3E70C 1T8TA 3NBZC 3NKVA 4U5XA 1XPOA 3EWAA 3RWMB 3RAPR 3BE4A 3REFA 1TNDA 1U90A 2W6ID 3EG5A 5DI3A 1NI3A 1S9DA 1FUUA 2H1LA 4MRNA 2QTHA 3ADKA 4Q4HB 4RD0A 1Z83A 1YZKA 3AGPA 1Z0DA 2VIIA 5CK5A 3GFPA 4L8GA 1Z08A 5FPYA 5JCZA 2G0NA 3VNUA 1OXTA 1VECA 1RZ3A 3RC3A 3PG5A 4B3CA 3DMDA 3BFKA 2AR7A 2G9NA 1Z29A 3T61A 2OCAA 1Z22A 3UXMA 1QHGA 1E1RD 5CLLA 5DHAA 4MKIA 3EC1A 3VR5A 4EQ6A 2R6AA 4MITA 1W1WA 1HQCA 5DH9A 3CW2A 3IHWA 5SZJA 4O0MA 2RGBA 2ZXUA 1BO6A 4HYYA 4QNRA 3KXLA 4Q00A 5LPNA 2HYDA 2ODWA 2D7CA 2G6BA 4GP7A 4I1UA 4B34A 1GDDA 4LUCA 2ZSAA 1NF3A 2GJSA 1G64A 1NVWQ 3SQWA 1NMYA 4PAMA 3CRQA 3DPUA 3RWOA 4N0DA 3BERA 2FGJA 3B8HA 1ESMA 2KJQA 4NYIR 4YLGA 3T1QA 4RKFA 4CZ2A 5J4LA 1NBME 2V7QD 1JEDA 3KJHA 5H68A 4CEHA 5G41A 1M2OB 2Q9CA 4B3DA 4W5JA 3KFVA 3KX2A 2FN4A 1X1SA 1XJCA 5FTKA 4CDGA 2RB4A 4D0LB 1E9EA 1G8YA 4HLUA 2R8RA 2PX3A 2YHSA 1N0VC 2MMGA 4JLOA 1OXVA 3H84A 1MO6A 1XZPA 1ZBDA 4PZLA 4Q01A 4V0ME 1AGPA 2P6NA 1Q3HA 4Q4AB 4JLAA 1KK0A 4OQFA 1T4GA 1QHHA 4V0KA 1CXZA 1H8HA 3BIFA 1R0YA 2MSEB 4DLSA 2QU8A 2IT1A 2BMJA 4TQUS 4TTPA 1X6VA 1Z6YA 4GI7A 3Q9LA 1ZNYA 4L16A 1LV7A 4C0QC 5FTMA 1XTJA 5UKDA 4B32A 3X1WA 5EP4A 4XH9B 3AF2A 4KV9A 3NDPA 1E79D 3QF4A 3UMRA 1N2CE 4WBSA 4FWTA 4O2RA 1SKYB 4PAOA 3BH0A 2QEQA 2IS6A 3U7EB 1CRQA 2LKDA 1T0JB 1F2UB 4LCBA 4YMWA 4A6XA 3RC8A 1DO0A 2D27A 4F7WA 1EGAA 2CDNA 3BC1A 4JL5A 1OIWA 4A4DA 3CB4A 3U4QB 1KI3A 1U9IA 2GVZC 2E9SA 2PMKA 4LV6A 4JLPA 1KDTA 3B1ZA 4LY6A 1ESNA 3CR8A 4P4SA 2XGJA 2B92A 1YZQA 3DKPA 3AVUA 1YVDA 4AI6A 4PX9A 4TYWA 1OH7A 1SULA 3QEOA 3PUXA 1G20E 5P21A 2A30A 2QG6A 2J1LA 2ZU6A 3D3QA 2OBLA 1B0UA 2ORIA 3LA6A 4NKRA 4QGGA 4DZZA 1JB1A 3NVAA 4GZLA 2P6UA 1D2EA 1MOZA 1OXSC 1HUQA 2CCJA 3IPXA 3QG5A 3NC1C 2WAYA 5J4YA 3GD7A 4URWR 2D06A 5E3HA 2JIZD 4I1SA 4A0HA 1W36B 4B33A 3CH5A 4A82A 1R2QA 5JHGB 4PO9A 1DEKA 4WA7A 2ZRLA 3IPYA 5CM9C 1M34E 2QY9A 2RGGA 5CB6A 2O8BB 1XJ0A 5L3QB 3T15A 3GJ4A 2IYWA 3REGA 3T12A 3VR6A 3DOFA 3I92A 2ZR0A 4JBXA 1G9XA 1XTQA 4MGKR 1SVWA 3B85A 4MRRA 2Q3FA 2YYZA 1JQLB 1KMHB 4A0RA 821PA 4F4JA 2IWRA 4Q7LA 3EASA 2QM8A 2HXSA 5JJKA 2JLYA 3AF3A 4IEEA 4JVSB 3ADBA 3GLGB 3B82A 5FUWA 1OHHA 5TV2A 5EUQB 3B1WA 4AG6A 1MV5A 1NY5A 2IYYA 2YC4C 4HSEA 2V54A 1SVSA 3UWKA 2MSDB 1OIVA 3C7KA 2OCYC 3G5UA 4LBVA 3JVVA 2H17A 2ZREA 3ZZ0A 3GJ0A 4M21A 3I61A 4CEIB 3O8CA 1IONA 4G0NA 1JR3D 2AWOA 1ZIOA 2BEJA 2IYRA 1AS3A 3AUXA 1IHUA 1L7VC 4Q1CA 3KQHA 2QRZA 1Q22A 2ZAOA 3TUIC 2HV8A 3B6EA 3PITA 3QJYA 2ODBA 4IDQA 3BRWD 4GBMA 3C14C 4FMBB 2J5XA 4JLJA 1TAGA 3CRMA 4MQBA 5FI1B 4BWYA 1YU9A 4XD7D 3THOA 1C4OA 1OKKD 4ZDWA 4HI0E 3EXAA 1UDWA 1NJFA 1UBGA 1G6HA 1W49A 4ASUA 1JBKA 1E9AA 2VQSA 4JKYA 4M9XA 2ZJBA 1X3SA 1I2MA 4Q4JB 3HYRA 2IYTA 5HPYB 5KNDA 2V1UA 3NDBB 3VTKA 1Z0AA 5KNBA 1YZLA 4AY2A 1E9CA 1EESA 1E96A 3FYHA 4DT1B 4NCJA 5CLQA 1CLUA 2C96A 3P32A 2DB3A 1US8A 2QPTA 4RZ3A 4TSFA 4WZ6A 4Q02A 1FOEB 5FR1A 3RSOA 2DYKA 3AQ4A 1IY1A 2QAJA 1WF3A 1XD9A 2EYUA 1VTKA 2FJUA 3LX8A 1E2LA 4B75A 3OEHD 2XSZA 1I2DA 3KZ1E 3CPHA 1N5LA 1SKYE 1GUAA 4Z1MA 4BFWA 3I62A 3Q72A 3FHTA 4PQYA 3GEIA 4WXRA 1E9FA 2JJ1D 2IL1A 4LI0A 1VIAA 3S1AA 1LF0A 4EFMA 2VF8A 1W46A 4Q19A 1EFCA 3SYLA 2QROA 5KDDA 3C15C 3AVOA 4TYNA 1EFRA 3C8UA 1NN3A 3NBXX 4D4JA 4JVLA 3K0SA 4ARZA 1P2UA 3TAUA 5DISB 3U5ZB 3IDQA 1LS1A 1OH5A 4I1OA 2R6DA 1FQKA 1VKJA 4GT1A 1NN0A 1S2MA 1NBMA 4N1AA 1KI1A 4IDOA 2V8OA 1S3SA 3CH4B 3SDZA 4B2IA 3OFNA 4RFSA 1WBDA 1AJEA 1XU4A 3SJCA 3LWNA 3LO5A 4C0BA 3K70C 4C3ZA 2EFEB 4TQ9A 2BOVA 2GVDC 2QE7A 2CE7A 2Y8EA 1G5PA 1XMIA 4AKEA 1E9BA 3IQWA 1N6KA 1VPLA 5EP1A 3TW8B 2JATA 4V0MA 1TQDA 1VDZA 4TLBA 3PEYA 3K0FA 2A78A 2HLDD 3SYNA 1R8SA 5DNYB 2HCBA 4LZZA 4WXPA 3EPJA 1OJLA 1LF5A 1LVGA 2OCPA 1N6RA 1P6XA 2ZS7A 1RPZA 1ZC3A 2JJ8A 1NY6A 2ZU0C 3A1UA 3CPEA 4OHYA 1XZQA 1SXJC 3I32A 3AKCA 3ZZTA 1BH2A 2XAUA 3W3ZB 1FP6A 4TYQA 4KFSA 2CVFA 3QE0A 3CZPA 5FH9A 2A2ZA 2CK3A 2PT7A 4TMVA 4BECA 4GL2A 2RAPA 1RE0A 1HEIA 2CEAA 5EE0A 1ZU5A 1PUIA 3CNNA 3AH8A 1YZUA 3ZDQA 3U2QA 1R10A 4BGDA 4XWOA 2BV3A 4ABYA 3GLGE 2SHKA 4BE7B 1E2JA 1VG1A 4NCIA 1WBBA 2ORVA 2Z4SA 1R6BX 2FSFA 2YOGA 3ONWA 4RD6A 4OHZA 1CIPA 4ZCMA 2QRNA 2VF7A 1TX4B 2A5GA 4DLUA 1Z06A 2BVNA 3Q5EA 4QBIA 4RZ2A 4RZXA 5EE5B 3GPLA 1A2KC 2OLKA 1QHIA 5L8VA 1YZGA 1ZMXA 2R62A 1CRPA 1TF5A 5CIWA 4B3BA 3LXRA 2ZRBA 1C1YA 5IT5A 3KKMA 1II8B 4OYHA 4YXWA 1JEEA 1TTTA 2V6IA 4H1UA 2IXEA 1GRRA 1ZM2A 4Q9KA 4NYMR 2CJWB 1XMJA 4ZKEA 3CX8A 1SVMA 3UWOA 2GXQA 3MFYA 2XXAB 4JLNA 1VIYA 4FIDA 4ZO4A 3AVTA 4X8MA 2IYUA 3ECCA 1N6IA 2J59A 2NZ8A 1KI4A 2ECKA 3KB1A 3L43A 3DM5A 1UKEA 4AK9A 4R9UC 3IBGA 4D4LA 3EX7C 4B3FX 4DDUA 4XVUA 2GF9A 3BAFA 2YKGA 4BFVA 1MKYA 1NP6A 4NYJQ 3VQTA 2RGEA 3C41J 4Z8YA 1KY2A 1XEWY 2PCLA 3UK6A 4HUTA 4RCYA 3U3KA 3G0HA 5H70A 1U98A 1KO7A 3ZGXA 3OAAD 1ZUIA 5FPHA 2WKQA 2WV9A 3M6AA 3PENA 5CK4A 1DO2A 5G3YA 2C99A 3TQCA 4RFSB 1J7KA 3ND8A 3QEJA 4PFSA 6Q21A 5K8UA 2NGRA 4HEJA 3ZD6A 3SNHA 3DZDA 3BORA 3I73A 4GOXA 3FMIA 4JVNA 4Q4HA 3FOZA 2KB0A 1CJTC 2GAAA 1JXMA 4LPSA 2ZPTX 3TNFA 4QHTA 4NE2A 1DAKA 3LW8A 2ZSDA 2PH1A 1BIFA 2IYSA 2WWIA 1A4RA 3NIBA 1UJ2A 3KQUA 4R98A 2XZLA 5FR2A 2BWJA 3MLEA 5HE8A 1ZM7A 1NVVR 4HLQB 1Q44A 2Z43A 4CF7A 1NSFA 4DCNA 1G3IA 1HA3A 4BZPA 1F3OA 4DCSA 4N0EA 1AN0A 2ZSFA 3CKLA 2FPLA 1KDOA 4G5RA 4KSCA 3BFXA 2ZQ5A 2CMKA 4C2UA 3Q7PA 1I4DD 1AZTA 2FFQA 1NVXQ 2RHMA 3W6PA 3KJIA 4HZUB 3WNCA 2XB2A 4HB2A 4LJ6A 2H16A 3QKUA 5AWFC 3V4FA 4W7SA 5B58C 1TQ2A 3FWYA 4B48A 1XPUA 1SVLA 5CITA 3HJNA 3MWJA 2V4ZA 4L4UA 1G16A 4G5OA 3IO3A 1GL7A 1YQTA 3UIEA 1PLKA 3RYTC 1W47A 3FFBA 1HQYE 1SZPA 1EK0A 2FE4A 2WIBA 3NBFA 2QMHA 3NC0C 4PSVA 5FBWB 3X1ZA 4KSBA 2IS4A 2D28C 2OFWA 3E1SA 4DWJA 3LX5A 2B21A 3CF2A 4WZAE 3DVLA 2EQBA 3NG1A 5FBLB 4MGYR 3KKOA 3SOPA 2D62A 1YZNA 5BN3A 1KJWA 5TDHA 2G3YA 5JJLA 1E3MA 1GKIA 3KFXA 3AKEA 2WIAA 3LRPA 4GZMA 3D31A 2VPPA 4Q4AA 3QVUA 2B8WA 1SVKA 4RD4A 4W5WA 1VG9B 4G5GA 2O8CB 4DCVA 3BH7A 4LJ9A 3PVSA 5KYKA 4IDPA 1KSJA 4J0QA 4PO8A 1HT2E 1Q57A 1TEXA 2PX0A 2R6FA 3TVTA 5C46F 1I4TD 2ZI9A 4F4CA 4M1YA 1KKMA 4LHYA 2R44A 4TMZA 4AKHA 2ZRMA 3WMEA 8OHMA 2HT6A 2JJ2D 2OG2A 1KAOA 4M53A 4XIGS 3V9PA 2F55A 3K9GA 3ZD7A 1WRBA 3IILA 1JPJA 2QP4A 1H8EA 2BJWA 2DY1A 1ZM9A 2IF2A 2Z6VA 4LSGA 4Z51A 1H8HD 4TT3A 1E4YA 1CS4C 2ZVQX 1UF9A 2EFGA 1F2UA 2VH5R 5HCNA 3CR7A 3QF7A 4PZZA 3UPUA 5AJWA 4ESVA 1FNMA 2PJZA 4LOAA 1X8JA 3U4QA 1E2DA 5JSZB 2GKSA 4A15A 5FPSA 1GVNB 2FEMA 1Q0UA 3DMNA 2J0SA 1NVUQ 4KITB 2F3RA 1YRAA 4ITRC 3FHCB 4TYPA 4MYHA 4PHFA 2WICA 1TU3A 4WAUA 2O8EB 3X2SA 1G17A 2HF9A 4M4SA 1T0HB 2ZE7A 2GDJA 4YDSA 1RRFA 3W9YA 1KNXA 1L8QA 5CB8A 4A36A 1B23P 4KYUA 4OI1A 2WWFA 2BIFA 3SEAA 3Q3JB 4A2PA 4DLRA 1XP8A 2CHVA 4HB4A 2PZEA 2X77A 2QQEA 5EXXA 1DELA 1ZINA 5E7JA 3HPQA 3VR4A 5J4VA 5F2EA 4RSGA 2XZOA 1T5IA 4FINA 4A9AA 1YE8A 2VHQA 3W3AA 3VKWA 4GMXA 1N0UA 1XFAA 2Z5FA 2N1BA 2C9OA 4UJ3A 3PUZA 4IKEA 4XVRA 4Q18A 2O8BA 4NONA 2VO1A 3FGNA 4JBWA 4M1OA 1CJVC 4OI4A 5L3QA 1G1MA 4MYTA 2DFNA 4BZQA 1P7CA 2ATXA 3N70A 2GRJA 4TLDA 1CP2A 2AD5A 4IFBA 2VSXA 4X8OA 2WTUA 3LD9A 4DB4A 1VCNA 1YR9A 5E7IA 2XJ9A 3TW4A 2CE2X 4O2LA 3OHMA 4QBGB 1KMHA 2ZI5A 3RNLA 3PJRA 3RRNA 1D8TA 5EE3A 3GLGA 3X1XA 2XB4A 2GZAA 3ZZUA 1J90A 4LJ4A 5FOVA 2D2EA 4P32A 4I81A 4DLZA 2ZETA 1ZNZA 3QNUA 1UPTA 3B9QA 3R9XA 2IW3A 4RZUA 1G7CA 2R9VA 4PZYA 4W9MC 2VSOA 3W6OA 1W7AA 4CEIA 2IS1A 2H57A 5F9FA 4D0NA 1U94A 2UZ3A 4QJ3A 4R2HA 3NH6A 2KI5A 4ZDJA 3QXSA 3GP8A 4LBYA 5JRZA 1OHHD 2FGKA 1ZVQA 1UKYA 2FPMA 1E94E 1CR2A 2GESA 4HDCA 4QGFA 1J99A 4DB2A 3W34A 3EIHA 5JEDA 1TPZA 4KFTA 4LX0A 2P3SA 1KI8A 2VHCA 3R9WA 1IN6A 2GZDA 4BFTA 1Z6XA 1Z28A 2YVUA 4DSTA 4NYIQ 4GNKA 4DC9A 2AL7A 4Z54A 3THWB 2RMKA 1RKBA 5JRJA 4LV8B 4WIAA 4ACAA 2BEKA 1LW7A 2IX3A 4MDFA 1G8FA 2VEDA 2AFIE 1LY1A 3AGQA 4DHEA 3KXIA 3DKVA 5KTYA 2NO1A 3TIFA 4EPXA 4Q4JA 3MAAC 1M1YE 4LBZA 2OFOA 2RCNA 3EPLA 2ZR7A 3NH9A 5L3SB 2ZRNA 2FZ4A 1E2KA 4YMSA 5M04A 4Q1EA 4DT1A 2TMKA 3CIOA 1OFIA 2ZEJA 3B1YA 4NHOA 2E1RA 4LV5B 5KO2A 2PLRA 4BFUA 2VA8A 3U44B 1N5JA 1YHNA 4TL8A 5F9HA 1MH1A 2O0JA 3AP2A 1G5RA 5IDVA 2OBNA 4QGHA 3LDAA 4PC3A 4HATA 4KFRA 4ASUD 1YR7A 4CW7A 2P5TB 1M7BA 3SBEA 2DFLA 1NLZA 2A3RA 1CKEA 3NHAA 3PUVA 2GBLA 3TSOA 5JEEA 1NG9A 1UEJA 1T91A 2WJIA 3THYB 3AKDA 3LLMA 2OT3B 2H92A 3W90A 4GP6A 3IEVA 2AD1A 2FSGA 2LKCA 2QMEA 1GAJA 4LBWA 4TLAA 1YR6A 4TSFD 1S1CA 4LJYA 3R8CA 5LD2B 2DWQA 4L9SA 3U61B 2GTPA 2ZTSA 2QQ0A 5FPTA 1OT3A 3X1DA 1PJRA 4CVNA 3QBVA 1CU1A 1DVRA 3IEUA 1QF9A 2PCJA 3IIMA 1MRSA 2VLIA 5CJPA 3PFIA 4HDOB 4Z1MD 4D81A 3VMFA 1VYTA 1W4RA 5KNCA 2A5JA 3QXHA 3TSZA 4JL8A 1M7HA 2C5LA 2GILA 3PCRB 3T1VA 2QN6A 1KZ7B 2CLDX 4LJ5A 4D4KA 1MO4A 2ZUBA 4KLNA 4ILEA 2Q3HA 2VL7A 2VBCA 1IY2A 4JSTA 1ZNWA 1TQ6A 3QVVA 2VSFA 3CF6R 1G5TA 4KXFB 1NBMD 1CJMA 4HAVA 4TQAA 3THXB 1BS1A 1E2PA 1SQ5A 3OFND 3P1JA 1W0JA 2OAQ1 4Q1DA 1U2RA 4TN1A 3VHXA 4JKIA 2OCBA 2V55B 1G8GA 4US2R 2QE7D 2J0UB 4LHZA 1W4AA 3SHWA 4LWZA 2DFTA 3NTUA 2ZE6A 4Q47A 1AZSC 5FOUA 4PC1A 1E6CA 2A5DA 4ESHA 4F4IA 1F60A 1J8MF 3K09C 1G4AE 4JS0A 5FTLA 5HKKA 2CLSA 2ZRPA 5CJ2A 5J5CA 1WXQA 2AXNA 2BBSA 1XMVA 4PQRA 4BFZA 1FUKA 2JLUA 4OK5A 3ETLA 2EFCB 1PLJA 3BOSA 5JECA 3ZVNA 2ZRIA 4OL0A 2F1HA 2AHOA 2BBTA 1FX0B 1E1QA 4W5HA 5B64A 1P75A 2CK3D 4P0TA 4TMKA 4FCWA 4TTRA 4YQFA 2GJAA 2MMCA 2WKPA 1IN7A 4DDTA 4DLYA 1P73A 1II8A 3K9NA 3RDPA 2ERYA 2QAGB 1FQJA 1GNPA 2GAOA 2CJWA 2YV5A 2VTKA 3BXZA 4OJQA 4Q21A 3K70B 2XXAA 1M74A 2ZJZA 3B2EA 1BOFA 2Z83A 2ZVPX 3GEHA 3MJHA 1D2NA 3ZYCA 1CULC 1KK2A 1SGWA 3RS0A 3K9HA 4Z8XA 1N6NA 2XTNA 4Q1FA 1Z6GA 1Q20A 1FZQA 4OQNA 5IF9A 4MDEA 3FKSA 2ZIAA 4YXWD 2AFHE 3N2IA 1VCIA 3BJIC 3QI2A 1JALA 3AB3A 1YR8A 4EIWA 3B78A 2C78A 4DCUA 2QSYA 3SQXA 2IEYA 1SXJB 2G88A 1TU4A 2QSZA 3CRRA 4PC7A 5SZHB 3JZAA 3WP0A 3RS4A 4CIDA 1RC8A 1WB9A 1X8LA 2NO0A 2H18A 5TY0A 1YJ5A 3A1WA 4IDNA 2AK3A 4CT5A 1A1VA 5GJVC 5B57C 1R7RA 1KDPA 1ZCBA 4FWIB 5DHFA 3A4LA 4AKIA 1ZD1A 3SS8A 1E2MA 3H2YA 3LW7A 1TQ4A 4U7DA 2BM0A 4BPBA 5GVRA 3A58B 4QHSA 1HYQA 4PC6A 2JLSA 2DWPA 2PZGA 3LNCA 4HAYA 4MUAA 2R65A 3OIYA 4Q9IA 1OYWA 2Z0MA 1EG7A 4A8JC 2REOA 2X1VA 1VG8A 1ZM4A 2QMUA 3MWYW 3WMFA 4F93B 4NDZA 1EWQA 3DEFA 3GJ7A 3GLIB 4QXAA 2GEVA 5BW8A 2F43B 2UKDA 1G3UA 3TK1A 3H1TA 5LD2C 4JLMA 3K0CC 3MUFA 3RSLA 2NO7A 3SHFA 3A4MA 3UG7A 4DLXA 2D4HA 4C0LA 3QKRB 2J46A 4HZUA 2FFAA 1Z07A 3RS2A 5KOYA 2NTYC 3IIJA 2CBZA 1BYUA 1XEFA 2QA5A 4FI3C 4ZDKA 1KMQA 1J8YF 3EWSA 3TLXA 1S1MA 3BB3A 4PPFA 1G3RA 2FSHA 3OZXA 1JR6A 5DLQC 1KI7A 3LBIA 1Q12A 4NTZA 1N25A 3AVVA 1IXZA 2NPIA 1CTQA 2QT0A 1KJYA 4YC7A 3R7WB 3T1OA 4DUGA 2C98A 1G18A 1Z47A 3QKSB 2QP9X 2P65A 3WHLA 1AM4D 1TL7C 4L15A 1P72A 5AJVB 1ZRHA 4E5UA 1XF9A 5FOXA 4IOJA 3SFZA 4EKDA 4OI0A 1KK1A 2REXB 1S0UA 4KYIB 2OBMA 4TMTA 3ADCA 4LRWA 3P20A 4JLBA 3ZJYA 2O8CA 1Q1QA 1J70A 2QM7A 4HAXA 3PUYA 2WPDA 4JJZA 4XJXA 4LYJA 4ZIRB 2JASA 2RHDA 1K6MA 2GK6A 3LVQE 4NZYA 2J0VA 2PL3A 4WVFA 4FCVA 1X8KA 3KB2A 2OHFA 2W6JA 1IJEA 3FDIA 4EFNA 3O8DA 1OH8A 2JLXA 4HB3A 4TWZA 2EFHB 2D3WA 3U7GA 4TLEA 5AUNB 2OILA 3FMFA 2G1KA 2ZYUX 4LGMA 5KPJA 2H8KA 4QBFA 5JSZA 1P62B 2IEZA 3LY5A 1GL9B 1R8QA 3VR2A 1JNYA 1ETUA 2Z4RA 1XTIA 5H8WA 2OE2A 2QAGC 621PA 1H8ED 3QPVA 3VNVA 4TT3D 2O8EA 5FL7A 4BEBA 2ZRJA 1NMXA 1GNRA 3A1TA 4FW9A 2IXFA 4QM7A 3PQCA 2VYFA 2YWGA 2JLVA 1KY3A 2RGAA 5KPDA 4NYMQ 1CR0A 4OQLA 1KO5A 1CJKC 3ZVLA 1D2MA 1KK3A 4Y0AA 2RGDA 4FCTA 1IN4A 4M22A 5D3QA 1N6OA 1R0ZA 2GA8A 3UKDA 3G82C 1X86B 3FFAA 4JL6A 1OFHA 2EWWA 4RVCA 5KDLA 1E2EA 4C7OB 4QBHA 1MR3F 1P61B 3HPRA 4OKSA 4TZ0A 4MUBA 1EX7A 4P33A 3T35A 3Q85A 5JCPA 2JEOA 5A0FA 2FH5B 4FMDF 4B73A 1E2GA 2A5FA 5GADl 2DWOA 4MRPA 3TVDA 1SXJE 1O3YA 5DN6A 2B8TA 2QP3A 1N0WA 1DPFA 4MH0R 5DYIA 3OE7A 4MYUA 3ZH9B 1XD8A 3AVQA 4TLCA 3KUCA 3K0AB 4G3XA 2BMEA 1UBEA 2CL0X 2QGNA 4JBYA 1W36D 2B6HA 1Q1EA 2GJ8A 2NOAA 4BLOA 1JJ7A 5CDFA 2ZRCA 2ZSEA 3MWKA 4X8LA 4XWAA 5JWHA 2IS2A 2CHGA 4OQMA 2J9RA 2NIPA 2Q0HA 4QG7A 4OQXA 3QPWA 4EPRA 4LHVA 2FF7A 1C9KA 5IK2A 3W8NA 5F98A 4E09A 3HU3A 2GJKA 3QIAA 4M1KA 3U3OA 3GLIE 4OK6A 1QVRA 1NVVQ 1OPXA 2BDTA 5FTNA 4M0LA 3QXCA 3DL0A 1SHZA 1R4AA 4B2LA 1VYVA 3ZQ6A 2QORA 5DYGA 5L3RA 1IXRC 4H9GA 5FOTA 1FW6A 3QUSA 2X19A 4MGIR 1IAQA 1XNJA 4MKHA 2GNOA 5CIQA 4C4PA 2QPOA 5FTJA 2AKAB 3GJ6A 4TMXA 4POAA 5FL3A 3I1FA 3H86A 1QBKC 2NG1A 2BJVA 1G3QA 2KWIA 4F92B 3K0EA 4Q9LA 2C2HA 3VR1A 1U0JA 5JWOA 3O47A 3BS4A 1DG3A 4JSYA 2ODEA 1HE8B 4NCHA 4BZXA 3THWA 3KQNA 1A7JA 1II9A 4V0LA 5FI0B 3IQXA 2I3BA 1AIPA 1L4UA 4YMUA 5DGXA 2GF0A 3EA0A 2ZRAA 2ZI4A 3DOEA 2XITA 1GITA 1G4UR 2L0XA 5L3SA 1Z2CA 1Z0KA 3R9IA 1E9RA 2QL6A 1CR4A 3L8YA 4PSAA 3CWQA 5C2JB 2C9YA 2DFKB 3WYAA 2J7PA 3U44A 1G3MA 3W5IA 1XPRA 3TRFA 1KKLA 2XNDA 2VP2A 1DAIA 5EXTA 721PA 2C8VA 3HU2A 2OEPA 3PEWA 1PV4A 1NSTA 3F0TA 3CPJB 4GSYA 1P60A 4JT4A 3EZ2A 3ZS9A 1EFTA 1R5BA 3VAAA 2AK2A 1BMFA 1LFDB 2PZFA 1KAGA 1U0LA 1NN1A 2W2VA 4Q1AA 3THYA 2HT1A 1QHNA 3FHOA 1E0AA 1M8PA 4E07A 4US0R 3FE2A 3K53A 1J2JA 1UEIA 2ZR9A 2P67A 1OXXK 4A92A 1A5TA 3L2OB 4QRHA 1GWNA 1KO8A 3VKGA 3U3MA 1N5KA 2X2FA 3K0CA 4KJZA 4TL7A 3SR0A 1OKKA 1GOTA 2C77A 1FTNA 2ZJOA 3QENA 2ZRKA 2PEZA 1NMZA 2BCJQ 4DSNA 1GIAA 3CLVA 4K81B 2GCNA 3AP3A 5KSZA 3TE6A 3KKNA 3W8RA 1FP7A 2HUPA 3IKJA 4EFLA 1NNEA 3AVWA 5EE1A 4C2TA 1ZJ6A 4NYJR 5C4GB 4NMMA 2Q3MA 1D5CA 4HLUC 4LYAA 4Y0VA 2EWVA 1XWIA 2NZJA 4EDHA 1BYIA 3E5HA 3ZQJA 4DDVA 3DM9B 3L0OA 3GJ3A 2BMDA 3BB4A 5JWRA 1XEXB 3TH5A 4C9BA 4LHXA 4DIEA 3THXA 1DS6A 3F3YA 3RVBA 2YNMA 2ONJA 4GPTA 3U7FB 2ZI3A 3PR1A 1GKUB 4PXAA 5GJCA 3AF1A 2ZM5A 2R2AA 3DZ8A 2W0MA 2YOFA 5K8IA 1Z6TA 2J0UA 2YWEA 4JJKA 4URUR 2CLCX 2Q9BA 3FTQA 4MGZR 1DAFA 4UXHA 5E4FA 1GKYA 3O8BA 4DEXA 5BQ5A 3M1IA 4A0GA 2BC9A 1OFTA 4RFVA 4ERNA 3R8FA 4RD1A 4DKXA 3PXGA 5DIFA 4P3YA 421PA 3TBKA 1Z0JA 1WMSA 2NMVA 2FEOA 4XVQA 1RFLA 1W0JD 4KHZA 4C0SA 2XTZA 1S4QA 2X8AA 4A6PA 5JMTA 1ZUHA 3ZIAA 1R0WA 3LQRA 1YKSA 2WJJA 1FX0A 5AJYA 5HTKA 3BB1A 3WY9A 2IHBA 4IJMA 2PMDA 5HKKD 5CM8B 3JVUA 4QM6A 3TKLA 3AUYA 3J81k 1E99A 2FOLA 1JPNA 4XOIA 1E9DA 2RH5A 4C0HA 1GL6A 4BQSA 2QAGA 1ZD8A 4Q03A 1A2BA 1E2IA 4B3XA 2WWGA 3AEZA 1KI6B 4M1WA 2CVHA 1P2SA 1G7SA 3B60A 4Q4LA 4URYR 5DE3A 2V3CC 1OLOA 4DLTA 1E1QD 4HZIA 2NO6A 5FFMA 2NPFA 2FPKA 1BKDR 2F1IA 3TMKA 1ZIPA 4DSOA 4MKFA 1E2NA 3CX7A 3TR5A 3EZ6A 4DRZA 3N2EA 3AF4A 4D80A 2JLZA 5KSOA 2GEDA 1QHYA 2WAXA 1E2QA 1HY3A 3QXJA 1WQ1R 5JS8A 2YWFA 1HT1E 1FL9A 1SHKA 3GLHB 1SXJA 1K5DA 4N3NA 3HR8A 1JECA 3NHBA 2UVQA 2BH1X 1RYFA 1Z8FA 4Q66C 4EJSB 3GLFB 4B47A 2IC5A 3D6TB 2WKRA 4UNPA 4AKGA 3FKSD 3VU9B 1SKQA 1II0A 4LC0A 5FUVA 4KBFA 5K8TA 1DBSA 2A7QA 1XEWX 4IOKA 4DJTA 3FKQA 4Q7MB 4KFUA 4QFMA 4DDWA 1LNZA 4DXAA 2ANCA 3KQKA 2GEUA 1KYIA 5FUYA 2F9MA 3GJXC 4AC9A 4ZI2A 4MYCA 4QGAA 3GLIA 1EFHA 1SVIA 2F43A 2BKEA 3SC3A 5AR1A 4ZDIA 1QZXA 5DSZA 4GRAA 4LDJA 2VP5A 3GQBA 1TUIA 1UADA 5IHPA 3QKRA 3CBQA 5LB2A 2OV2A 2IBMA 4V0OA 4YONB 4UNQA 3C5HA 3GFTA 3GMTA 2W58A 4V0NA 2ZRFA 3HYTA 1COWA 4IHQA 5AUPB 4D26A 2O8DB 1I4LD 2PT5A 2F3TA 3I72A 4D25A 1VG0B 1T9HA 3AVXA 1W4BA 2CCGA 2FSIA 5CYPA 3B9PA 2JAQA 4NCNA 4ZCIA 3RANA 4BRWA 4ZI3A 2QBYB 4UKDA 1PVOA 4DEYA 3R7WA 2ZS9A 1G19A 2ZS8A 5EZ6B 2OAP1 1Z2AA 4WOPA 3QKSA 4X8HA 4RY2A 3A1VA 1OW3B 2NO9A 2HJVA 4BLPA 2FFHA 1E4VA 3MSXA 1D9ZA 2IWHA 3RHFA 3SJBA 2F1RA 4TL9A 3M0EA 1GTVA 4ZKDA 5C18A 1T5LA 2GWHA 3R20A 2WZQA 1WDTA 3D7MA 4NPHA 4QL3A 3LBNA 5EE9A 2KBFA 1YRBA 1F6BA 4LJ8A 2XEXA 1ZYUA 2DR3A 4ZIRA 4DUGD 5JBQA 4PHGA 3ASYA 4R2IA 4A8JB 2G83A 3GJ8A 2ANBA 3CO5A 5JI3E 2OUKA 1F5NA 4WW0A 2HCJB 2WSMA 3IUYA 1IN5A 2XZPA 4C0AC 2Q9AA 4PHHA 1EFUA 3RLFA 4DVGA 3I4LA 1TF2A 1QG2A 1WA5A 3OEEA 4IRUB 4HB0A 1NIPA 4Q48A 1UBFA 2WPDD 1D6JA 1U81A 4QHYA 4Q9JA 2XSZD 3I5XA 5EQTA 1P5ZB 1XBTA 4UNNA 3SE0A 3UMSA 4CT4B 4JYCA 4IDHA 5KU1A 2BM1A 3NXSA 3ZVMA 3EIQA 1NLYA 4KVAA 2W6JD 2G0TA 1TADA 3OF5A 4QJ5A 3EARA 1H65A 2ZRGA 2ZJ8A 3ND9A 2GHIA 3VHLB 5JI2E 4PHTA 1ONBA 2ORWA 3WYFA 2F9LA 1UKZA 2ZJYA 1XCMA 1DG1G 1EFRD 2QENA 1IQPA 3BWDD 3V00A 3U6KA 5LB4A 5EJEA 1CJUC 2J3EA 4IVQA 1NRJB 3D8BA 3T5DA 5JJIA 2CNWA 3AM1A 4K8OA 4PR0A 2IHYA 3VR3A 1HE1C 2A9KA 1KO4A 3SYKA 4AYTA 3HDTA 3MMPA 1M7GA 2QT1A 2WWXA 3A4NA 3EC2A 3QXXA 2LCFA 1YZTA 1IJFA 4PQFA 3P4YA 2JJ2A 5FL7D 4C7OA 1KNQA 3EZFA 4IXMA 1K5GA 4LJAA 1IBRA 5G53C 3TR0A 5SZKB 3EZ7A 4PO1A 3AV0B 2VP4A 4D4MA 4EJSC 3TGPA 3GLHE 1E2HA 1R5NA 4JT2A 4M9ZA 1T3HA 2CCKA 5GJWC 4KLZA 3AP1A 4I99A 4XTCS 3FMPB 1CBUA 1JQJC 1G41A 3KXKA 4HUQB 4QJ4A 1VHTA 3K0AA 4AYXA 3GLFE 3U60B 1JAIA 5CDFE 1OE0A 1M6NA 3FVQA 2ZRHA 3QBTA 2FNAA 4M1MA 4B71A 1ANKA 1FFHA 1XTSA 2CXXA 4PPNA 4YDHB 2GCOB 2HYIC 2W2TA 1T3LA 1P2VA
chains in the Genus database with same CATH superfamily
1G8KA 1DARA 3RSQA 4ZMBA 5IXYA 5IF3A 1IIRA 3BHMA 2P0EA 1QC5A 2D7DA 4P0PB 3VDMA 1M1NA 1JHQA 1P33A 1XVLA 5JJBA 4AJ2A 1KIMA 3KLPX 1E7SA 1Q7CA 5IK2D 5K6AC 2AHRA 3WS0A 1BVYF 4YMTA 4KNVA 3TD9A 2FMKA 1LB1B 5TF4A 3IQFA 2H1SA 5FPKA 1KE0A 1YDGA 3R76A 3KDSE 1OFUX 4HWSA 5A4KA 5DK6A 5C8YB 2UUAC 1LZLA 3DVRX 4U2CA 5IBCA 3ADOA 2W70A 3UWMA 3K1ZA 3OZGA 3K7EA 1FJGC 4D9IA 4OO3A 3BGWA 2A24B 3GVCA 5BSMA 3FPWA 4UTXA 2XNDD 2OUIA 3A6PC 3BD9A 1X94A 5DF7A 2IXGA 4DDMA 4CIXA 2XNCA 3LHFA 4FZ5A 4IEIA 1USUA 1U7OA 3OPRA 1ZC4A 2O0HA 2XMGA 2I7TA 2BEVA 1RADA 2WAMA 5HRAA 3QY0A 2R6R1 2VF5X 1PLLA 1XZFA 5F5LA 2TMGA 1WXXA 4ZXFA 1IXSB 5IJAA 3NYIA 1E8MA 2ZAMA 4LSMA 3TJZA 3UZUA 4NZZA 2ILTA 1UKVY 3O1JC 2IQIA 2BEUA 3H11B 5I5GA 2IEDA 4D42A 4L2ZA 2Q9NA 2PXAA 4Y67A 1R3DA 2PVPA 3AW9A 1G42A 1AMUA 3FBTA 3NEYA 4LJSA 4DXHA 5WRFA 1F8GA 3BIWA 4R7ZA 4UDOA 3PDCA 2GLTA 1LQTA 3K1YA 5H81A 3ACBA 2P7IA 1V2GA 1NC3A 4ID9A 1QWSA 3CXRA 3T3GA 2GJ9A 2ONKA 1MRNA 3A28A 2IEAA 3M5CA 5KOIA 2AQ8A 4MBKA 4UEWA 5EJIA 1QCCA 2CB0A 2ZUDA 3MGGA 4A2CA 4CMEA 2B4TO 3NDRA 2AOTB 1ZHOA 3PBOA 4L8LA 4RK0A 1MO5A 3A4YA 1DOAA 3IUSA 2V1XA 1LSXA 5HAIA 1I14A 3FA2A 1VYUA 4OV6B 3D5EA 4GDFA 1E89A 1SXIA 1GUZA 3L82B 3D3WA 3UA4A 3O8OA 1WE2A 4B9EA 1S2DA 4L5YA 4G0YA 2D74A 2FOXA 1S0WA 3VI4B 3W9BA 2IPNA 5GM1A 4NX2A 4NATA 3SZTA 3ZK8A 2W2XA 3P0EA 2C04A 5T4HA 1UXJA 4LXGA 2YIVX 2C5GA 3EGIA 4MVJI 2GBLC 1VQQA 3U7QB 5CT4A 2V6FA 2XCLA 3MFDA 1K4FA 2H4XA 3A6KA 1U3DA 2RGCA 1R64A 5JT1A 5BURA 2I65A 3H4TA 3RSFA 4JM1A 1E58A 3GJTA 4HG2A 1DT3A 2ID9A 4FUQA 1TK3A 2PYRA 2B7BA 4GXTA 3NI2A 4IF6A 5CHJA 5FWXA 2HDOA 1T1RA 1J7JA 2R85A 3KQLA 4N3CA 3EZNA 5JZVA 1A7KA 3TG8A 5CX1A 4IVIA 5KOJA 3TUZC 3OCWA 4ZV4A 1ECJA 4QU9A 1S8FA 1U9IC 3ZIUA 1F6WA 4QD4A 3ZYTA 3F8WA 4H7EA 5HD3A 2ICAA 5U4XA 2HJ9A 4XWKA 2H4HA 3FWLA 1XP5A 2QUBA 2ARKA 3KOUA 3SC2B 4P5EA 4ICIA 3M6FA 4A1OA 3ZJTA 2BDUA 3K0FB 2QZ4A 4YN3A 4RY0A 2AN9A 1AU9A 2WIJA 3A2KA 1PR1A 2R9WA 4K9RA 1EHCA 1XQ9A 2ZUFA 2ENUA 3N2LA 4Y8VA 4CEJA 3N8NA 1G2QA 3DO6A 1XDSA 2CVQA 4QB8A 4RIIA 4UQPA 3MQFA 2QYOA 3P52A 2C0QA 3OQPA 3IRVA 3KLNA 2B36A 1Y6RA 1MD9A 4B74A 1M54A 4GI3A 5JNSA 1MO3A 1S6RA 5JU6A 3K32A 2WP0A 1HYBA 3MT0A 4I66A 2EKQA 2VZWA 2BFEA 1XPOA 4JV5C 2C0CA 1NE7A 3RQSA 3WLHA 4FH4A 3BMOA 1U90A 3LR0A 2O3UA 3RWBA 5KTKA 1H8MA 2VIIA 4FE3A 3EC1A 4JUBA 1FJGB 4X62B 1ZB8A 3KXLA 2OAGA 2PQ2A 3D3JA 1Q2QA 5THXA 4PAMA 5GLDA 1TZJA 1THTA 2HWWA 1YO6A 4JWKA 4BTVA 2C2YA 5B53A 4HXYA 3INTA 3WTBA 1ZY2A 2Y1FA 3K92A 5CB0A 3RNOA 3DMTA 1MO6A 3I42A 3S7ZA 1E62A 4Q4AB 4WEJA 4AU1A 4ZRDA 2R5WA 5K0GA 3I9V6 3N8LA 3NTRA 1LSUA 4KV9A 3WISA 5AICA 1BCRA 3BH0A 3K4PA 3UEBA 4EYEA 3U7EB 1O8CA 1T0JB 3I2IA 2H11A 5I9LA 4JLPA 1V4NA 4QOEA 5EIHA 3DCYA 2Q3BA 4PX9A 4QPDA 2J1LA 5CDYA 4NKRA 3RU3A 1ZGGA 1OXSC 3IP6A 1SZVA 3UTCA 3TB6A 4C6TB 1EE2A 4G41A 2KW5A 1TYZA 4UEJA 4JH0A 1M0WA 3VHQA 1CDOA 5HMMA 3F2VA 4EG6A 2I2FA 1KTIA 3CVOA 1CDEA 3BRSA 1Z5GA 1LL9A 4Y9RA 3PTEA 1PBTA 3NUQA 5DNVA 1PX0A 4LDPA 2L18A 3D8UA 3ZZ0A 2EF0A 4D46A 3DYIA 3G7NA 4CG2A 3CN7A 3AUXA 3Q3CA 5KYYA 3GAAA 1JIXA 5IJXA 3VR5H 4PYNA 1YKGA 4WLNA 1R8JA 1V7CA 3UQZA 1X42A 2J67A 1RPJA 4NICA 4Q16A 3QBEA 3RVRA 5H3HA 3A70A 1I3MA 3UY4A 4GICA 3ROQA 4HBTA 4JQZA 4U39A 3PLNA 4NY1A 4JNKA 3SVTA 1E9FA 4DE5A 2IDZA 2XRYA 4JROA 2CKMA 4D02A 1OH5A 1R6VA 1Y98A 1NN0A 1XTTA 4BBTA 1ENPA 1S3SA 2V97A 5BOVA 1MHTA 5EP1A 4CKCA 2GZMA 5F7ZA 5A9TA 4JXJA 3DE1X 3WWDA 4B40A 3RIMA 5IJ0B 2JCXA 3ZZTA 3FPGA 2CVFA 5FH9A 4C6RA 4FNGA 5EE0A 2DLNA 1G66A 3EG9B 5C1PA 3FKJA 1WE4A 3DH0A 3ONWA 1F2DA 3T3IA 1TB4A 4QBIA 4E6WA 5IH7A 3S2ZA 5EE5B 2PBYA 1LW6E 1VLZA 4DCJA 4AS2A 1CFZA 3NOXA 3PGKA 3CVUA 4IFTA 2HV1A 2XB6A 1HDGO 1ISJA 2J59A 2BY4A 4NMLA 4B3FX 1KVLA 3ZUPA 1DEAA 1YXMA 2IPOA 1IXKA 5LP6C 1DO2A 1KVQA 4J4HA 5K8UA 1CG6A 4R1LA 2FUNB 1DDIA 2ONZA 1OYOA 4A5SA 4UM5A 2Q1UA 1NX9A 1PR6A 1BIFA 1Q2XA 3AEKA 4KACA 1CUSA 4FDVA 2PSDA 3NXKA 2BWJA 2C9ZA 1PW5A 1YS6A 5B1SA 4OXKA 3QKUA 3A6JA 5CITA 3PFNA 4JOQA 3IKMB 3IUQA 2AQKA 4D9NA 2W1RA 3IPRA 3X1ZA 2P69A 3HDGA 3OFVA 3E1SA 4AUEA 1FSYA 2EQBA 4JV5B 1CY0A 1YZNA 1U4SA 2PR7A 3D31A 3TL3A 4W5WA 3RK1A 4Y6QA 2B5WA 3PEEA 4PO8A 1IB0A 2ZI9A 2MJ6A 2JVIA 4DWVA 2OG2A 1KAOA 3V9PA 5KOHA 4MOWA 3WJ7A 2W27A 4TT3A 1UF9A 1WO8A 1LNSA 1JDBC 2ZPAA 4HDSB 4PZ9A 4YJHA 1U1CA 2I2WA 2F3RA 4TYPA 4LE5A 4X1MA 4KQ1A 1GA4A 1KNXA 4A36A 2IIBA 2LZ0A 4UVGA 4DPLA 1VHJA 3BHNA 5A04A 4IV8A 4QYXA 3V32A 2C5SA 4FW8A 4JJ6A 4H77A 4MAAA 3W3AA 1UK6A 3PYMA 4XLTA 5LR6A 3KKZA 1MC5A 4IXWA 4M1OA 4OI4A 2P3LA 3ZK7A 5IJ9B 1NHGA 2ATXA 4MV4A 4W5NA 4E31A 1CQIA 2LUOA 4YAOA 3LD9A 4HTFA 4TSRA 4FONA 1TA9A 2XMQA 4TRRA 2M1ZA 2YYYA 1TM1E 4EZEA 5IU1A 4AFNA 1TVKB 4P5DA 1J90A 3LR3A 1TK2A 3MRXA 1ML4A 2FWIA 3JX9A 1TO6A 3R9XA 5I5EA 1RXWA 4DA7A 3WOHA 4HKTA 1MEEA 5BP7A 1CJFA 5BNWA 3I2KA 4LBYA 3OO0A 1DBRA 4QGFA 1E3WB 3G34A 3ZXXA 4ODIA 2VQ6A 5JD6A 1EDBA 1IN6A 1JWLA 3QWAA 4LV8B 4WIAA 1LY1A 3ZCVA 4EYQA 4L1KA 5AVVA 3FLEA 3NH9A 3O83A 3AG6A 1E2KA 2I67A 4TZKA 1N9GA 4TL8A 1M33A 5CGQB 1JSLA 1R27A 4QAQA 1IBKC 4X1IB 3V2UA 4C2AA 4DE3A 3D3EA 3KT0A 1RQRA 2LKCA 2GCEA 2UDPA 1FU4A 2YIJA 4QXQA 2QQ0A 5FPTA 3O95A 3X1DA 1CU1A 3BREA 3KSMA 5SYAA 2PXCA 1I2SA 1LI9A 1O57A 2JW5A 1VYTA 2PGLA 3M4XA 3R7DA 4P22A 3EQUA 3TSZA 3WFIA 4UREA 3IQIX 1KZ7B 2CLDX 1OVMA 5AQAA 3R77A 3DWIA 3DQPA 5FORA 1WEHA 4ALMA 3F6RA 2OAQ1 1KBOA 1UOOA 4FYHA 4JB3A 2NQ8A 2QE7D 4RL4A 1Q16A 1AZSC 5DTSA 5HKKA 4XR9A 3PXDA 1NBIA 4COKA 1PLJA 2FY8A 4RE6A 4XDZA 3HA7A 4HEA6 3M6WA 1XZGA 3A1DA 1TKBA 1U80A 3ZDFA 3AEUA 1P75A 2CK3D 5CCDA 1OWLA 2MMCA 3QK7A 1II8A 4Q24A 2AEEA 5DLDA 2QN2A 1MWTA 2HHHB 1M74A 1BOFA 4YUVA 5BNZA 5EYPB 2UU9C 1WU7A 3HCFA 2O3TA 3DMRA 1PNTA 4MDEA 1QORA 1GHTA 2WT8A 1VJCA 1VCIA 3BJIC 3G0GA 5LMUC 3N2YA 3R7SA 4PICA 5EQJB 3A31A 5JLAA 4DV6B 4XI9A 4WUVA 4U7DA 1YZ3A 2FUG6 2PA3A 4B85A 1FFWA 3ZWQA 1QP7A 1SELA 4YT4A 4JLMA 5HIJA 1Z18A 4LRZE 3GQBB 4U7FA 5F78A 1WETA 1X15A 1JRLA 1J8YF 4G4SP 3OVMA 3ZBUA 1NPDA 1OGIA 4HSGA 2J3MA 1E2BA 2VSQA 2O8VA 1TL7C 1P72A 5AJVB 4HMOA 3K73O 2O6HA 4UQLA 3UB2A 1OT5A 4JLBA 4ZIRB 4R8KA 3AW8A 4S1PA 5AW4A 4G81A 1DCFA 4RS3A 1IJEA 3FTDA 1EBUA 5DTMA 2EQ5A 3WYCA 2JHFA 2Z2IA 2G04A 3ONNA 1PSWA 4YMHA 2ONCA 4XEUA 2WNSA 5KPJA 3U81A 4RQBA 2CLKB 2R79A 4UHJA 4ZALA 5FL7A 4FOFA 4ENTA 4C4TA 4YHHC 3DLPX 4MARA 4UUMA 1KO5A 1MDBA 4R40A 4J1NA 4M22A 4RLSA 2Y2OA 3W2GA 4J0JA 1G8SA 5KTMA 4B73A 4OFXA 1HLFA 3PSAA 2B98A 2RHBA 4F1WA 1O3YA 5BW6B 3TSAA 4MBFA 5ILGA 1VBNA 1TS6A 2ZDQA 1XRRA 4I4NA 1JFFB 1JDBB 3T6KA 2BKVA 2LRHA 4LDAA 4Q3BA 1TA0A 4YS6A 2JGKA 1LPBB 2X9QA 1SC1A 3OQIA 3PXEA 5BQFA 2RSLA 3SLGA 4FSDA 2QRMA 1FW6A 5EVIA 3FW1A 1JDSA 4CUKA 2X41A 4JGBA 1Z37A 3R1IA 4KR3A 3QHAA 2W8BB 2AFHA 3O82A 3KQNA 3SC6A 3QVLA 2WDPA 4PGMA 5A3QA 1GNLA 2ZRAA 2XITA 3ND5A 3I6IA 1Z2CA 3ZCPA 2IITA 3ISJA 1XPRA 1KYVA 1Y5NA 1RY2A 1PNQA 5KNBH 2ACGA 3M2JA 1EFTA 2GUGA 1BXKA 1L8XA 1BXGB 1XZEA 1XJ6A 2YS7A 4US0R 2P67A 4A92A 3WX0A 2PH5A 3W4OA 2C77A 1BGVA 1OBCA 1NMZA 3E22A 3ABOB 3KKNA 3P2IA 2M5HA 2OMKA 2PLNA 1MVNA 3DM9B 3GJ3A 4RTQA 2OMEA 3DDNA 3JZDA 4BLUA 2NUPB 1MO2A 4JJFA 2QZZA 4XGNA 2W2QA 4RZHA 2BGTA 1Z6TA 2J0UA 3GECA 2RAFA 5BV7A 1IBKB 1RM3A 3R8FA 2ETXA 2C7BA 5LIRA 1Z0JA 1L4KA 4J7UA 4FN4A 4UPDA 1V95A 2PZBA 3KQVA 5CCEA 4C20A 4EF4A 5AM2A 1GTRA 2BD0A 2OHHA 4Q03A 4TS4A 3HB9A 2WWGA 5TMDA 3D5QA 3PRJA 4DR3C 1Q0QA 1P2SA 1E1QD 5FFMA 3TMKA 1U1EA 5B36A 1J1IA 3VU8A 2WU0A 4R68A 2A92A 3ZI4A 2IYFA 4OBXA 2DM6A 1HT1E 1DJQA 1SHKA 1L7PA 3FZNA 3KC2A 1ZMTA 4NK3A 1LFAA 4BFCA 3C43A 5HD5A 3FLBA 3K35A 1YA6A 4JDUA 3N8DA 2A7QA 4DDWA 4QUHA 4AC9A 2NXCA 2RH8A 3GEPA 2ZC6B 4OMFG 1TUIA 2PZMA 2I71A 3I45A 2GKOA 2IHTA 4UNQA 3BSSA 2NP6A 4WOCA 4IHQA 4PAWA 2F3TA 2UU9B 1NXPA 4D56A 4W5RA 3I9LA 4CLCA 2OD7A 5LMUB 3ROXA 1Z2AA 2PV7A 4X8HA 1PFGA 4P93A 3SBOA 3U39A 2VTBB 4NXEA 2DSNA 4TL9A 1WZUA 4EW7A 3CZCA 3BHJA 5TGFA 1CZHA 4CIBA 4J3NA 4DUGD 1H2WA 4RCVA 3EOIA 1NQWA 1FE8A 2ZOSA 4X64C 1TF2A 4ID4A 1C0EA 5D3KA 1KZ9A 5H4GA 5BSRA 2PSSA 4P87A 1WMAA 3TEJA 3ME5A 1XNQB 1SAYA 5L7WA 5I7AA 1GGVA 4YIKA 3MERA 3G85A 4X6UA 3VR3A 1G4HA 6PFKA 2P1RA 4U5YD 1M7GA 4Y17A 4G4SO 1YZTA 4REOA 4PQFA 1TD5A 1M1XB 5TVGA 1U5CA 2WABA 4PKYG 3GGJA 3HXQA 4XTCS 2H3HA 3FMPB 2DLCX 1M6NA 3EN0A 4NH4A 3K9QO 4B71A 4ZCQA 1XTSA 4K6KA 4ZHQA 2PN1A 3KKPA 4MO9A 5DN6D 3A8TA 4DDHA 5HWVA 2Q2OA 2VKTA 1CK4A 1NIJA 3OHSX 2AX4A 1JNXX 3WHKA 2DCUA 2GD1O 1RJ9B 4YHHB 2HEIA 3ZV5A 2EW1A 4M8SA 1V39A 1WF6A 3MWLA 4BL5A 1QCYA 4ZYWA 4TL6A 1L2TA 2VPXA 2RKOA 1MT0A 1IPEA 2EX8A 4BLTA 4ZAMA 3GFVA 2R751 4OA8A 3ZDXB 4TWIA 3V7YA 3C1AA 4EKYA 3VZCA 4P35A 3K6KA 3DQZA 1OSNA 4XTRA 4H17A 4HGOA 1QH9A 2IHZA 3HU5A 3O4HA 1FJ2A 2QG9A 4OBEA 3ZN2A 1YBMA 5AJGA 3KBOA 1CEEA 4B4VA 3KL4A 3BAZA 1NQXA 1TJPB 1NXXA 1NWZA 5JAIA 4OJMX 4RZQA 3UZ0A 5G0UA 2JGAA 2WWHA 2BBOA 1UBRS 4QUKA 5L9AA 4AQDA 4MW5A 2YWDA 5IZCA 4NKPA 3FCYA 3NAQA 3DEAA 4YCSA 1ENOA 1W2GA 1PZOA 1FP2A 4EQ6B 3FPKA 5BR8C 4RMIA 3JQBA 4GPEA 1W93A 4K6FA 4ZVLA 1Y3BE 2N42A 4F5DA 2OK8A 1XDZA 2TMYA 3BL8A 3OLVA 2FMXA 4NMXB 3D3OA 1WPXA 3PQ5A 1NBHA 4CU2A 2JGRA 1ZA2A 2OXTA 1H2YA 3TPZA 4HP8A 1HG0A 4ZOLA 1MLDA 1W63M 4D6YA 1CT9A 3M3HA 4CCWA 1WU8A 2P9BA 1K8RA 1CLEA 4YR7A 2IP4A 3BUSA 4G1FA 1MTOA 4O4HA 4YHBA 3ZDBA 3KETA 5K1ZA 3GLFA 1FMJA 1FZTA 2DBYA 4XSHA 3ICEA 1QJCA 2EX6A 3L8HA 3LIDA 2WF9A 3EB9A 1EFLA 4GLJA 2BM8A 2XODA 2HPHA 4OXQA 1IY0A 2MTBA 1Z6FA 4R1UA 1KS9A 3E9RA 1O5IA 3W5JA 3E3MA 1IYPA 5J4HA 5IP5A 3VZBA 1ZR4A 3UBMA 3MWEB 4KRFA 2J87A 2H7VA 2ONFA 2FR8A 3T4PA 1L5WA 4KQ9A 1MTZA 5AJHA 2YHBA 4EARA 3IWQA 4FLFA 2N46A 1IG0A 4GI1A 1TLTA 5CA0B 4HQRA 1IYZA 4AZWA 1XX6A 5E95A 5CHMA 3DFFA 2Y59A 4BLRA 1IEWA 5HWWA 2DU8A 2BHRA 1ESEA 2OSBA 2ZJ7A 5LC1A 1UJ5A 1RCFA 3CG5A 2FPRA 1OBVA 3QFSA 4KQHA 3HCRA 5A92A 3MYYA 4D44A 4UE3S 3HCDA 1ZMOA 3E1GA 1HVBA 3AOEC 5F9MA 3R0XA 1ZRMA 2OZPA 2YMLA 4HADA 2A1UB 2YXBA 3C4VA 2JJ1A 1WVMA 3OLWA 5FBQB 1GG2A 4OYRA 1YQDA 3P98A 3NZEA 3COJA 1BKSB 3SN6A 3EQ2A 4X64B 2Z8XA 4C3VA 3SIXA 2EXXA 1GFSA 1M0EA 4RY8A 2ZIXA 1ZAKA 3KTAA 1U9CA 1XJ2A 2ZIWB 2YOHA 3I8SA 3ELUA 3MTDA 3OIWA 2V7BA 4HJXA 4IQ4A 5DPMA 4EG5A 5KTTA 5E2EA 3WLLA 5F64A 2OO7A 1WQ4A 4KPUB 3ZR4B 1XRAA 4NXMB 3MWDA 4Y0NA 5IG2A 2E1PA 1F0YA 1EG2A 2VSYA 2QN1A 2JH8A 1R0XA 4K3VA 2MSCB 3QQ5A 2PMEA 1SCUA 1PTJA 3HC7A 3KEOA 1WDKA 3PESA 3S7OA 2JHCA 2IYVA 3QP8A 1JEYB 4MN6A 1QZZA 2E37A 2HDWA 3ONDA 3JQAB 4NAHA 1JMVA 3IKTA 3VX3A 2XNHA 2RCXA 5H16A 1SD5A 3JPUA 5KQMA 3BE4A 1Q91A 1PEKE 3DCJA 2W6ID 1U7TA 5DJUA 2H1LA 3VMAA 4S05A 5E2GA 1CRLA 3GFPA 1Z09A 5CXXA 3VV4A 3VR5A 2XKKA 3PVZA 5HSQA 5L2FA 4WJKB 2G6BA 3CLUD 1HKHA 2ZSAA 4QXPA 1NVWQ 4BNUA 1X3LA 5IHXA 3BLMA 1R4MB 2J0EA 2KJQA 3HVRA 5JZSA 3MHTA 1JEDA 1M9NA 4BX0A 4DR7B 5A03A 1XJCA 3DBHA 1LSVA 4R41A 3QOWA 3PC7A 3DEYX 4ITUA 2XEDA 2YHSA 4KQWA 4JOCA 4Z3DA 1AGPA 1K3UB 1SMKA 4INJA 4CG0A 1WSAA 2XOEA 2BFCA 5FTMA 4ENQA 3VUEA 3Q10A 2W90A 4PZPA 1U8UA 1W63Q 3PK0A 3H5VA 3MOGA 4WBSA 5BR8B 3JARA 1F2UB 4L0DA 1IUKA 2HNKA 2Z9CA 1JZTA 4ZZ1A 4XQGA 5REQB 1FP4B 1P0ZA 4Q7QA 4KLRA 3GMDA 5ALKA 2PWAA 1QVVA 1R88A 1PFVA 3IPXA 4KZ3A 5IN5A 1DHRA 1JVBA 2XA1A 4A82A 1H0SA 5EKTA 4ZZIA 4G0ZA 5K0FA 1F1JA 4ER5A 3VISA 4YRZA 1U7UA 1XTQA 1SVWA 4MA0A 4S1TA 4IIJF 1SHLA 2WGWA 2RAUA 3Q2KA 2HXSA 2JLYA 1MIOA 3GRJA 2D1YA 1K2VN 3UO9A 2H17A 1ARZA 4ZYLA 3KQHA 3QOYA 3BRWD 3KV1A 3T3PB 4FTXA 4HWPA 1UJ6A 2QZJA 3UQYS 1W9HA 1AB5A 3HUEA 3PI7A 4FCFA 4XYBA 2JK1A 4D1YA 3BJEA 5M3BA 3P32A 3DZGA 3IP3A 4GPIB 3DEKA 4F9GA 3KZ1E 4YP6A 3CPHA 3I62A 2BTFP 4PQYA 5L40A 5B2EA 3DAGA 2EWMA 2FXVA 2IPMA 3AVOA 4ZDXA 1DP6A 4EITA 2CV2A 4X97A 5MGBA 3OMLA 1LS1A 1EI9A 4F72A 2OD9A 4O4IB 4E1AA 2HU8A 4IDOA 2DUNA 4PZAA 4B2IA 4CLHA 4G1MB 2BR5A 3N0WA 1EK2A 3NM6B 3SH7A 2G07A 2XKAA 4ZI7F 1RC1A 2OLEA 3IERA 3PR2B 5GOZA 4DMRA 5J2TB 1D7AA 3L6CA 2VWGA 3A2NA 2JJ8A 1SC4A 3VHXB 3NCTA 2ZM0A 5FNVA 3UAGA 3CJQA 4JGQA 4PKYA 2QJOA 1BNCA 3PXBA 4PXSA 1DRUA 3P0JA 4QE3A 1EQAA 2VRCD 4XWOA 4UEOA 4RD6A 3SQNA 4F94A 5CEBA 3DEHA 4RLFA 2R62A 1O6CA 5IAKA 5CH3A 3GTCA 4NYMR 4ND5A 5B6PA 4ALNA 1VE5A 3ECCA 3DA8A 3IJPA 2NZ8A 1QH8A 2C5AA 5J2UF 3LEZA 2RGEA 3C41J 2HRDA 3QLEA 4HUTA 1V1RA 5H70A 1ECCA 1TC2A 3PENA 4D97A 3BECA 4CTKA 5CK4A 2AF4C 4G6ZA 2W4IA 4PFSA 4F84A 1C14A 1T1BA 3RRFA 4K40A 4NE7A 5CXWA 4WF0A 4DARA 4G1BA 2R7NA 2YVAA 4MYSA 3A4TA 4HLQB 5AVJA 1NSFA 4DCNA 2P9TA 1E6MA 1F3OA 1PVVA 1AUVA 4B81A 4BMYA 4OA5A 4INAA 2NO4A 1ZCFA 1GL7A 4UEQA 4XM2A 2QTBA 4KG5A 1W47A 2DT8A 2XRZA 1PFYA 4LFBC 1ZJZA 5EPOA 4G9GA 4GN2A 3N6RA 1Z26A 3ROKA 2XQJA 3KKOA 4EF5A 2A3UA 5K2OA 4DQLA 2UXBB 2XYVA 4NV0A 3LG2A 1QCZA 1X70A 4RD4A 1L4FA 4EY4A 3LC7O 5DNUA 2Q8QA 3L0ZA 4YUXA 4J0DA 1QH1B 4M1YA 3ILSA 1GLNA 2JMPA 1YR3A 3WNVA 4B87A 4BN5A 2G17A 3VOBA 3QF7A 3F46A 5AJWA 1X7YB 3MXTA 3CRZA 1F2KA 1NVUQ 3GGSA 2WICA 4OG2A 1UT5A 1MVLA 3FHJA 1L8QA 2AZXA 4EY7A 3N7AA 1XP8A 4Q3KA 2QQEA 1E3UD 2RHOA 2H5LA 3DTYA 5E7JA 4ZU1X 2NYRA 4R84A 1JSXA 1FDTA 1T5IA 2J3WA 4LV3A 4FINA 1OI4A 1XK7A 4IKOA 4NONA 5G1OA 3ECSA 4MCJA 4RX3A 2AD5A 2WTUA 3MCVA 2OV8A 3AJAA 4QBGB 2EG5A 3BDVA 4O8ZA 2FDXA 1DT5A 3TPFA 4IO1A 3X1XA 4QFCA 4MHSA 4OB6A 2QLJA 1LBTA 4EEUA 5LLTA 4YP0A 3QXSA 3OX1A 3IWIA 3H13A 1WB4A 3VKFA 4KKXB 4MEAA 1JTVA 3TZ6A 2W3DA 1NQ5A 4DSTA 2O2JA 3A0UA 5ALFA 3DKVA 4HOYA 5L3SB 3VYRB 3HXMA 1O95C 2GM5A 3KLMX 3BWXA 2PLRA 1HDOA 2H1VA 4MB6A 1MH1A 2PDAA 3C6MA 1D5WA 4CE6A 3OETA 1KFKB 1CKEA 5KNBD 1S2GA 1RXEA 4MWZA 2Z08A 1GAJA 1B2LA 5DK4A 4GDNA 3CKKA 3R8CA 4CFZA 3A9UA 3CPTA 4L9SA 1NFRA 1T9BA 3DCNA 3KT8A 4AB1A 1TQHA 3IEUA 1QF9A 3WRVA 1BHJA 2CHEA 1ISSA 2H9AA 1WPRA 2AH5A 3OX4A 3QXHA 1Y8ZA 2PSFA 2QX4A 3I9FA 2GILA 4LFAC 1XQ6A 3BEBA 3NIAA 2R7MA 4E5NA 1RRKA 1RQ7A 1IY2A 2LD4A 1BS1A 1U6IA 2PQMA 2OCBA 3E15A 2C4UA 5EGNA 3NTUA 1SKOB 3KVNA 3G5MA 1J8MF 3RG8A 3H0CA 1ULBA 1EGQA 4DREA 4FFWA 5JECA 1JFRA 4P0TA 1NYQA 5EHIA 2BR4A 2DPMA 1XHFA 2VDNB 2R5FA 5DHRA 2FWPA 5C5IA 2YV5A 1O7JA 4NXBA 3DOIA 2Z83A 4P7BA 3UH1A 3RS0A 5AM1A 5A9SB 4CUZA 1C1HA 2EARA 2I7DA 2H54A 2NVOA 4CIDA 1JE0A 2FR1A 4H6XA 1AKRA 3W06A 2GEFA 2PWBA 1RLMA 1KDPA 4E08A 3BQ9A 1T13A 3SS8A 1P91A 1M6WA 3UGKA 2P41A 3A9TA 3H1TA 3RSLA 3VFFA 3NU1A 3FF1A 2J46A 2AEMA 3B1FA 3WO0A 1N9KA 4OXNA 1VJ1A 5KQRA 3OF3A 4MQEB 1WUIS 2Q0QA 3L4BC 3R7WB 2XYPA 1M1YA 3WGKA 4L15A 4Q3LA 3SFZA 5BYAA 1UXIA 4AJ4A 1F0KA 2JFVA 1ES2A 3HEAA 3DV0A 2ZUVA 3RH0A 4LYJA 2FE1A 3DJFA 2RHDA 2J5RA 3BX1A 3H6GA 3IQAA 1PL7A 1D2GA 3I9NA 1KY5A 2ROQA 1WKBA 3FMFA 1I6MA 5A6SA 5GGXA 4WLFA 3X43A 4LRSB 2VOJA 3LECA 4ER3A 4UHEA 4DV5C 3OBIA 4GR4A 4PXYA 5LMNC 1IKGA 4HNTA 4FW9A 2JF0A 3I83A 2VYFA 2H9IA 2JLVA 3IXMA 5FAPA 2VXCA 1KK3A 5I7OA 2ZQDA 3PQFA 1AMOA 3RV4A 3OWOA 1X86B 4RVCA 3KQPA 3M6LA 4KC0A 5DM0A 2J07A 2R48A 2IRWA 5F76A 4JYAB 5A2QD 4QU8A 2I9PA 4IIHA 4YP1A 3GK3A 3HWX1 2R1UA 4UMVA 4JBYA 3OPQA 1C5KA 3GLVA 4D60A 2F8MA 1H1LA 2DG2A 3M5DA 4OQMA 4B3MC 1QV6A 5IK2A 1P8JA 4P34A 1O8BA 3D4IA 4BVJA 4E1VA 3RU9A 5DYGA 4Z7JA 3H6KA 4MGIR 3ZWXA 3KWMA 4EM6A 4MNRA 2Y4AA 3PPIA 3MVEA 1J07A 1BN7A 4X91A 2OO5C 4JSYA 2PZKA 2XGGA 4K5QA 1NUQA 5GGYA 4EI7A 5A4FS 5HX9A 1L4UA 1MH9A 2GF0A 3ZGAB 2NUAA 4GNRA 3VNAA 5CLJA 3MFQA 2OKGA 4BC1A 3LP8A 4ZA2A 2XNDA 2A35A 1ORTA 3H5OA 1QS0A 4ZO9A 3BWMA 3FXAA 1KAGA 4QO7A 3HGQA 4QSMA 2VHVA 3BWBA 3OP4A 3QLVC 3L2OB 1V7PC 3MGKA 3C6ZA 2NLOA 3U3MA 1I8TA 4KJZA 1K88A 2GFHA 3BFDA 3MCTA 3AQIA 1W5EA 4I50B 3D6NB 3LZ6A 1X9GA 2WSYB 2PRZA 1L2SA 4C9BA 2N3ZA 2H28A 5CLIA 4MQLA 3Q2OA 3OZHA 4QRIA 2ON6A 3LF1A 1E92A 3NOOA 1PDVA 3S2IA 1RWPA 1JLRA 4B7AA 5F7XA 1GPJA 1WMBA 1E1MA 3CWCA 2AJLI 1DXYA 1W0JD 3U7JA 4A6PA 3Q15C 1YQ9A 3WY9A 1LJLA 3MBZA 5CM8B 4ZO8A 4XD2A 4BGIA 4JFRA 1DQYA 1E2IA 3PTLA 2NQTA 3L1KA 3LOQA 3A2MA 5HM8A 5HTOA 1P1FA 4OJTA 3B60A 5TE9A 2W3GA 4HZIA 3U1VA 1E2NA 1MX3A 1TZ2A 5DLEA 3I0NA 1PQUA 1WQ1R 2EZ8A 1GZVA 5FV4A 4LI3X 1FYDA 4FFOA 4IY1A 4QEKA 2H1CA 4H7IA 4P3XA 3OE1A 3VC1A 3GJSA 2AG8A 4QFMA 2Q5LA 3Q3GE 4MYCA 4YJFA 2F43A 1QQBA 3LI8A 1WYBA 2HDQA 5K51A 5E6SA 4DQXA 2HGSA 3GMTA 4ZQIA 4MS4A 2QE6A 2Y0EA 2E3JA 4ZRNA 3T0IA 1XJ5A 3MOSA 4ZI3A 3BY8A 5KTNA 5TQVA 1UPCA 4YRMA 3QE3A 3A1VA 5HF9A 1WA9A 3SJBA 1DWQA 4ZAVA 4CWAA 1GTVA 2W8ZA 4ZKDA 2ECFA 3ZNOA 4CMJA 2GCGA 2UUAB 1F5NA 3FUTA 4WW0A 4WBNB 5GLCA 4DVGA 1JBQA 1A7UA 3H83A 1XRQA 4CT4B 5BN5B 3RUCA 2O14A 1ZRNA 1XAGA 3GO4A 3OF5A 2ZRGA 1TM4E 3TQOA 1UKZA 3QP1A 5I9NA 1CF9A 1GXSA 1V6CA 2QYTA 3Q7IA 3WLFA 2Y2GA 2B69A 1DINA 1SVNA 3EXHC 4OATA 3VH1A 4IHJB 3GRFA 5AW9A 1C7RA 5E4TA 1CBUA 4QJ4A 3U60B 2C8LA 1JQKA 4MV1A 2GNPA 3S7NA 1ND6A 2H63A 1QPBA 4B43A 2PKCA 4TKUB 3BF8A 1C30A 3CUEF 4MVJF 4YMVA 1KOFA 3QITA 1X1EA 1KAMA 4DV5B 2JHEA 2FXIA 4BXOB 4ISBA 4M1SA 3BIJA 3VU0A 1D07A 5AP9A 3MJDA 4MDZA 2VHTA 4G8BA 1SBZA 4FMCB 2AI3A 2JL1A 1O7EA 1SUEA 1GL3A 4F3LB 3H5LA 4DPMA 4O4LB 2HJRA 2XUOA 1JR3E 3G6KA 4L08A 1FJHA 1YQUA 4B3MB 4UXJA 1Z6AA 4UUQA 1JDTA 1T3SA 1UMDA 5CDHA 2CFIA 3EA4A 3C8ZA 1IOVA 4S2EA 3ABSB 4WTOA 3DTTA 1GZUA 4YDQA 2FZ5A 4BFYA 2VJBA 3D4LA 2X15A 1N2EA 3ONVA 1M8FA 5HW0A 2P4SA 2FEKA 4QTZA 3CJEA 2GHTA 1PSZA 3DC7A 5J4KA 4YT8A 3ZWDA 3CG0A 1TIKA 1ZUNB 3ZE2B 2ZUSA 1QVWA 2Q5FA 3HU1A 1K9SA 2AG1A 1QFXA 3I7JA 3LZCA 1ZI9A 3N4IA 1S96A 3C3XA 2ZCUA 1U8YA 2HDNB 4Z4IA 4WZBE 2WK1A 5G1NA 1SCBA 1N8NA 2ATCA 1K9VF 4BNVA 2ZE8A 4B1FA 5KU7A 3DR3A 1A4IA 4D4GA 3T1QB 3MGCA 4DTCA 3UCFA 3DT8A 3RK0A 1RBMA 2UYCA 4BNMA 2WR8A 1ODLA 2KMLA 5KYWA 3DTMA 3D0RA 4UNRA 4ZPXA 3WS4A 1P81A 2OPLA 3RFTA 1XQVA 4ZOAA 3OBFA 4I9FA 3E3LA 2GXUA 3IAFA 2J41A 5AW5A 1E0KA 3Q7QA 4IIYA 1PUJA 3BDAA 1S89A 5JRHA 2QPLA 3O7WA 3IGFA 3MWGA 3N05A 2UYQA 2XYGA 1SXJD 4KUGA 2G1PA 2BGLA 5BR4A 3I3SR 2IP2A 4JKOA 5MFZA 1PKEA 4RF3A 3WDLA 1N3BA 2HH9A 4ZU3A 4B6PA 4AN0A 4QYSA 1T1SA 3JALB 3LL4A 3E4PA 3IF6A 5ELXA 1J0AA 2OLJA 5DHTA 4DLBA 3UJAA 1H2HA 3AM5A 3GNQA 4HNQA 3OKAA 3JYNA 2C7QA 3AY3A 2ASEA 3AKZA 5LBIA 1EQ2A 3RVDA 4N1XA 1FFAA 5LP1A 2CUKA 3I53A 3G2YA 5FEMA 2EFJA 4A8JA 2YZGA 5FD8A 1TUEA 3HJHA 4BGEA 1Q1ZA 3HB7A 2E87A 4D45A 4HFNA 3AM4A 4Y18A 2IIQA 2QD3A 2MT9A 1QAOA 3GBVA 5IAGA 4RA6A 5ALNA 3MZFA 1PJCA 1DNPA 1M5TA 1F5SA 3ASZA 1X80A 4WLAA 4NE9A 4FXOA 1VL1A 2HBQA 3RQIA 4NESA