4PHTA

Atpase gspe in complex with the cytoplasmic domain of gspl from the vibrio vulnificus type ii secretion system
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
485
structure length
438
Chain Sequence
b'RLPFSFANRFKMVLEVPPVLYYVEPLNAQALVEVRRVLKQTFVPQAIAAEAFEKKLTEAYDFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKILSIRFRVDGVLRDVLSPSRKLAPLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTPVNHDNFRHLISRPHGIILVTGPTGSGKSTTLYAGLQELNSNERNILTVEDPIEFDIDGIGQTQVNPKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAITRLRDMGIEPFLISSSLLGVLAQRLVRTLCQDCKEPYEADKEQRKLFALTLYRAKGCEKCNHKGYRGRTGIHELLMVDDKVQELIHAEAGEQAMDKYIREHTPSIRSDGLDKVLQGVTSLEEVMRVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type II secretion system protein L
publication title Crystal structure of the full-length ATPase GspE from the Vibrio vulnificus type II secretion system in complex with the cytoplasmic domain of GspL.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Protein transport
total genus 127
structure length 438
sequence length 485
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4phtA01
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4phtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4phtA03
2O5VA 3B7GA 4G5SA 1VIYA 2QTVB 3LFUA 5TDHA 3ZS9A 1VG1A 2ODWA 1VCIA 4II7A 4NBSA 3U5ZB 1KSJA 3FFBA 5KYKA 3FDIA 1NJFA 2QUZA 1JXMA 3REGA 1HTWA 4Z8XA 5DN6A 4V0KA 1GILA 4BLRA 3U44B 5E95A 2N1BA 3K9HA 4PPGA 3T1QA 3IBGA 1XZQA 1RJ9A 1AQYA 2FZLA 2ZAMA 4PAMA 4JVNA 3MGCA 4HUTA 3A8TA 3X1ZA 2QGZA 4DLYA 4TTPA 4B74A 1Q1QA 2VL7A 3AH8A 1WRBA 3IKJA 2JAQA 5AJYA 4D4KA 1EXMA 2XB4A 2GXSA 4H1UA 2V9PA 2ZEJA 1CJTC 3DO6A 2YWHA 3KTAB 4BLPA 3VKWA 2QAJA 4US1R 4M4SA 721PA 1A5TA 2WMOB 3CUEF 5EXXA 3U3KA 3ZH9B 3BGWA 1YZUA 4LCBA 1ZD1A 2O8BB 4BFUA 1DO0A 2IA5A 4MKIA 3EZFA 2A7QA 5BN5A 3F5FA 3QIAA 2AR7A 4FMCF 4MDEA 1CRPA 1AIPA 2EU8A 4A9AA 5JECA 3Q5EA 1OB5A 3SYKA 4D82A 1F2UB 2ZR9A 3SFZA 2F9LA 4PTLA 5JWOA 1KY3A 3GD7A 1E79A 4U7DA 2GZHA 3RC8A 4GBMA 4R98A 4BQSA 3BE4A 3GFTA 2J41A 4LRWA 1ZMXA 1XTRA 3GLFA 1M8PA 2W6JA 4KLZA 1XEWX 1ZW6A 1PZNA 4KHZA 4RZUA 3X1DA 1R0YA 5JS7A 1F6BA 4O2LA 3A1UA 2OG2A 2JJ1A 1E2MA 3N70A 4TT3D 1N2CE 3G5UA 1U90A 4QHTA 2NPFA 1GL9B 4PXAA 1OIXA 4TQUS 3KKMA 5EE0A 1FFHA 4Q4JA 4LYAA 2NGRA 4MGKR 4OHZA 2REXB 4B48A 1KK0A 2F1JA 3FHOA 3LD9A 1KNXA 2FGJA 1R7RA 2KSQA 1LTQA 3FKSA 2GESA 5DSZA 1R8QA 2XNDA 1C9KA 4O25A 5AUQA 2CVHA 1Q44A 2ORIA 3B1YA 2JLWA 3TNFA 4JL8A 5K8TA 3PEYA 2BHRA 4GDFA 2XOKD 1N6KA 2A5FA 4DWJA 2ZS8A 1YQTA 1QG4A 2GK6A 2BEJA 3MG9A 1U94A 3VU9A 3EPHA 2FEOA 1R10A 3QOFA 2ZUDA 3AVUA 4WBSA 1EWQA 4H9GA 4W5HA 4ASUA 2WWGA 4H1VA 1TU3A 4AWXA 3JVUA 4E09A 4Q7MB 4DJTA 3N2IA 4EDHA 3AKCA 3K9LA 1AA9A 1BKDR 4GP6A 4L16A 4B33A 3NVAA 1R0ZA 4EKDA 5FL3A 1KAOA 2CVFA 2W6ID 5CIQA 3U44A 1G16A 4Q00A 2OBLA 1N6IA 1R0XA 3LY5A 4LHZA 3BD9A 3ZDQA 4Q19A 1XXHB 4LJ9A 521PA 1LF0A 3R8CA 4CEJA 1E1RA 2JLRA 3SI7A 1A1VA 5L3SB 4TN1A 4DLXA 1M74A 3ASZA 2O8CB 2D7DA 1Q22A 3ICQB 1J8MF 3B5JA 3I4LA 1E0JA 2ODEA 2XNSA 3KTAA 4HB2A 2E87A 2GEVA 2GTPA 4CT4B 1L8QA 5CYPA 1WB9A 3U7GA 2O8BA 1DS6A 2FPLA 2FA9A 2J45A 2ZSDA 5SZHB 2BCJQ 2FSFA 4DCVA 5DI3A 3NDBB 1E0KA 4HB4A 5SZJA 3L2OB 4EUNA 3AKDA 3OEEA 4W7SA 2O52A 4HAXA 4HUQA 2FPMA 4UNPA 3R20A 4ABYA 1QHXA 2O8EB 2QSYA 5JJKA 3QG5A 1F2UA 3VX4A 3EXAA 3I72A 4Z1MD 3THYA 4QM6A 4MA4A 2HYIC 4N0EA 4F4CA 1E0SA 2H16A 4JKYA 3R7WB 1SULA 4URUR 4NCIA 1RRFA 5KDLA 4AKGA 2XZOA 5D3QA 2VH5R 1E96A 4UXJA 2A78A 3AP2A 1VCNA 4LV8B 3WRXC 4I81A 3ZIAD 2ZJ2A 2QE7D 2GZAA 4E07A 1WBDA 1TQ6A 1UBEA 2ERXA 1S9HA 5B30A 3QNUA 3F3YA 2X2FA 5G41A 3I3SR 1TX4B 4LPSA 2PZGA 1MABA 4B2IA 2H92A 4ACBA 3TIFA 5L3VA 2C9YA 1J7KA 3EC1A 1U9IC 4M53A 2CBZA 3T12A 1ESMA 1SZPA 1TAGA 1Z6YA 3V4FA 2ODBA 4MGYR 4NPHA 2P6RA 3CO5A 4CEIB 2P65A 1NLFA 1YZNA 4U5XA 2YOGA 1MO6A 1YVDA 4ARZA 2O8FA 4X8HA 1IJEA 4YMSA 1CU1A 2FFAA 2FF7A 4JLVA 4L9WA 2BJVA 5JZVA 2GZDA 3W34A 1N6OA 1ZM4A 4GSYA 1N5KA 1Q1BA 1KSHA 3W6OA 1EGAA 3GLHE 4B75A 3QSYA 2FFHA 1UEIA 2ZRFA 3VNUA 3AUYA 3FTQA 3LBNA 3FOZA 2A5GA 5JLJA 3KXLA 1G7SA 4DSUA 4TYWA 3GEIA 3QXSA 3SJCA 5KU1A 3RVBA 3TR5A 3SS8A 1NIJA 4A0HA 2YC4C 1AZTA 4XWKA 4FN5A 2C03A 2AWOA 3BXZA 3NWJA 1WP9A 2H17A 3I73A 1T9HA 2HDNB 5J5CA 3VR1A 3TAUA 3G0HA 5FPYA 4G5RA 4JBYA 3CPJB 1XZPA 5LB4A 1ODFA 4QKQA 2FZ4A 3H2YA 3KB1A 4PQRA 2ZI6A 1CJVC 2Q21A 5AK0A 5IK2A 3NBXX 4IXNA 3TKLA 2O8CA 3SDZA 1K8RA 2VF7A 4V0MA 1Z63A 1XEXA 1KNQA 2Q0HA 2A5YB 1NSFA 1E9AA 3QKSB 3GLGB 4GRAA 1NMXA 1R5OA 4ERNA 2OFOA 3CH4B 5E7IA 5GVRA 4A0RA 3UMSA 1OHHA 3UMRA 1XJCA 2HUPA 2CNWD 5C46F 1C4OA 1SVMA 5GADl 2GK7A 3GEHA 1X8KA 2JATA 2JASA 4CF7A 1YZTA 2GEUA 2VLIA 2WJJA 2J1LA 4DCSA 2YOFA 1DOAA 4BASA 4BFSA 5JJLA 2WZQA 4Q4LA 1XP8A 3I8XA 1KY2A 3R7WA 4OQMA 3PEWA 4PR0A 2BOVA 4I1VA 3VHLB 1XJ0A 2H57A 1W2HA 1JPJA 1P60A 1XNJA 4URXR 3HYRA 3NH6A 1TQ4A 4BWYA 3ZD7A 4JL6A 2DFNA 5J4YA 4JVLA 1Z6TA 3OIYA 2FOLA 1CLUA 2JIZA 5KPJA 4KCGA 5FBWB 3EA0A 4MQBA 2J7PA 1ZNYA 3JZMA 3ZS8A 3ADDA 2OCYC 3W8NA 4A6PA 2IYZA 4C0KA 3PITA 4F38A 3TMKA 4TLEA 3QF4B 1IY0A 4CEIA 2V6JA 2BBOA 4BLSA 3UANA 1YRAA 1YR7A 2A9KA 4Q9HA 2R2AA 1E9CA 2P5TB 2B8TA 5EE5B 3LAWA 5CM9C 4J0QA 2ZRLA 4JVSB 4CZ2A 3O47A 5H68A 1JR3A 2GAOA 3RNLA 1GWNA 4DT1A 2QP4A 4YC7A 1CR4A 4C0LA 2C2HA 1Z22A 3OAAA 4C2TA 3GLFE 4Q02A 2C78A 1G6OA 1T8UA 4NL4H 4Q48A 4PAQA 2RKOA 2ZYUX 5EXSA 3EA5A 5CDFA 3TUZC 4QJ3A 5KDOA 3CRVA 4BLQA 5AUNB 1ZM9A 1I4TD 4KLNA 1Y63A 3L0PA 4RY2A 1P9WA 2CL6X 1L4YA 2Z43A 2R6GA 4YMTA 3EG5A 1ZUHA 3EZ9A 4Q9LA 2FDCA 2PZFA 2W0SA 1E3MA 2ZTSA 1KOFA 3GFOA 1H8HA 1N3BA 4JL5A 4C0JA 5JBQA 4DEXA 2WICA 1J90A 4KFUA 4M1YA 4EFMA 3D3QA 2AN9A 1F2TA 3SJBA 1DAKA 5IT5A 4Q18A 4WAUA 2CK3A 3U3RA 3RANA 4JYCA 4WA7A 2GNOA 1NKSA 2R6CA 5JI2E 2PL3A 1ZM2A 1IN4A 3KQUA 2AD1A 1HT2E 1WXQA 5AUPB 1QG2A 3P20A 3T5DA 1X3SA 1AGRA 3C8UA 3F0TA 2HCBA 4HAYA 4TLBA 4ZKEA 3WNDA 4JLDA 2ZQ5A 4M22A 2YWEA 1TEXA 1IM2A 4IFEA 3AGQA 3QVVA 5GJWC 3ZZTA 1RE0A 1Z2CA 1QHHB 1NN0A 1HUQA 1VYVA 2WHXA 4RZXA 4B44A 2VEDA 1IN6A 2A30A 1ZIOA 3U4QA 1J2JA 3P4YA 4I1OA 3BH6A 4P3YA 1MKYA 2CL7X 4DLSA 1Q1EA 1X8JA 1HYQA 2H5EA 4BECA 3OZXA 3MJRA 2G0TA 4URVR 4A4DA 4LHYA 2IWRA 4IRUB 3CRRA 1M34E 3B1VA 2ZI5A 4DRZA 2ZYTX 4L9SA 2PMKA 4DIDA 4FMCB 1H8ED 2ZI9A 2GRJA 1N0WA 3B85A 2IXEA 2GCOB 2NPIA 4R71A 1W2GA 4HB3A 2E1RA 2ODNA 3DL0A 3EW9A 2C8VA 1CXZA 2A3RA 1KKMA 3ND9A 4Q4HB 1W36D 4PPFA 4QGHA 5IHPA 1E4YA 1ZD8A 5M04A 3UPUA 2LKCA 4UNQA 2ZSAA 4IOMA 2OV2A 4ZKDA 1NVXQ 2IYLD 2EFHB 1ZNZA 2XAUA 2R44A 1JPNA 3C5CA 1KI1A 5C4GB 4QL3A 3NTUA 3RABA 2IUTA 5BN3A 2DBYA 2EW1A 2GJSA 4IVPA 2FGKA 1OYYA 3A4LA 1W47A 4XIGS 2WM9B 3RHFA 4OJKA 1IY2A 2B6HA 2IEYA 2ZRMA 4FXPA 4NKRA 3FGNA 4MYHA 4S2EA 3OE7D 3IILA 1AS3A 3QE0A 4QBIA 4ZCMA 1NIPA 2IYYA 3CX8A 2YVUA 2V8OA 1JXOA 1R2QA 2AXPA 2IBMA 1R6BX 4YXWD 4EPYA 1CIPA 4RD4A 4HEJA 1G3QA 2JLXA 5L8VA 1OIWA 1OJLA 3A1SA 1KI6B 4LOAA 5FR2A 2EWWA 1G17A 4XWAA 3R9XA 3HU2A 3GQBA 2V4ZA 1GRRA 4PAOA 4M8NE 3KJGA 4IDOA 4OHYA 4KBGA 3T06B 4BRUA 2HT1A 4W5WA 3NC0C 4KAXA 3LH5A 2F3RA 2QP3A 4LJ7A 2F6RA 1XFAA 2NOAA 1EK0A 3VR2A 2WWWA 4GZMA 2IS1A 2VQSA 3CWQA 1WQ1R 1R4AA 2QMOA 2Z4RA 1FW6A 4TMKA 1QHHA 4PC2A 3VR4A 1YR8A 2PZEA 1P4SA 2QSZA 1P9NA 2UKDA 2WMNB 3KL4A 1W4CA 3IEVA 1CEEA 5CITA 4DXAA 5EXPA 1DAMA 2QT0A 4ZPXA 1JI0A 1OXUA 5FPSA 3ZQJA 1XXHE 4CDGA 4QBGB 2BBSA 3NBYC 2OBNA 4IEEA 3TSZA 3EWAA 2GXUA 3S1AB 1SQ5A 3L0OA 4V0ME 1RFLA 1CJUC 4F4IA 3OHMA 5C4MA 2RGEA 3U7HB 3KJEA 1PV4A 1KI9A 4EPXA 1IXSB 1XBTA 4TSFA 2ANCA 3MRSA 4UNRA 3M4YA 4V0LA 3BB1A 2GCOA 2YHSA 1XMJA 4MRRA 1N5JA 4HDOB 3N2EA 1G8FA 1XTJA 1GKYA 4PHHA 2KB0A 4G5GA 3C14C 5CLQA 1QZXA 1FP6A 3U7EB 5JWRA 4Q4HA 2C95A 4DLVA 3BFKA 2C77A 2JDIA 3IBYA 1EFRA 4ZI3A 4JLKA 1U99A 4GOKA 2OCPA 2R6AA 3TQCA 1BMFD 2P2LA 2XB2A 4PHTA 2AK2A 1P2TA 1GM5A 2CJWB 2CLSA 2D28C 2FV8A 2ZU6A 3PENA 1CJMA 3TJZA 4F91B 5KUTA 1ZUIA 1Z06A 2UZ3A 5JI3E 2GCPA 5DISB 4PANA 4JMPA 4XTCS 1Z6GA 3I8SA 1QVAA 4D6PA 3EC2A 1M6NA 1FX0B 1D9XA 3T61A 5SZKB 2CDNA 1RVDA 1SXJA 2JLSA 1P62B 2JLYA 4AI6A 1Q21A 4HSEA 5FI0B 4LV6A 5BYJA 2RMKA 3AP1A 4RFVA 4Q1BA 3OEHD 3Q3JB 1KI6A 4RJLA 1NBMD 4ZI2A 4Q7JB 1MRSA 3GJ0A 2IS2A 1UF9A 3P27A 5JRZA 3Q7QA 4KXFB 1Q0UA 4GI7A 5FPHA 2AFIE 2HLDA 2AXNA 3ASYA 4FWTA 3VR3A 1DG3A 4QRHA 3VHXA 2ZSFA 3LNCA 3LX8A 3FB4A 3D6TB 1JR3E 2REBA 3RAPR 2PCLA 3DKPA 1E2DA 3Q9LA 3ZQ6A 4DDWA 1LB1B 3HJNA 1TQ2A 4P31A 4WIAA 1HE8B 3DZ8A 2REOA 4QHSA 2WKRA 4O2RA 4FINA 1SKYB 4HB0A 3TW4A 3AUXA 1WA5A 1G6HA 1IN8A 1FL9A 2O0JA 2ZRBA 1V43A 3NDPA 5CDFE 3T1TA 3ZZUA 4QGAA 2RGBA 2YNMA 1MO5A 1UAAA 1A7JA 4TL7A 4MUBA 2WWYA 4OL0A 2WJGA 5FOVA 4KU4A 5L3QA 3PEVA 3WYGA 4RCYA 3OFNA 2AKYA 3LQRA 2Q9BA 1US8A 1X1RA 1R5NA 1OW3B 4Q1CA 3KKOA 4QG7A 3X2SA 4X8MA 1LS1A 4DDVA 4Z54A 1N6LA 2CE7A 3T5GA 2QI9C 4C0SA 4ESHA 4L8GA 4LPKA 4Z8YA 3O8CA 3RYTC 4WZAE 5UKDA 2QROA 1CBUA 5FFMA 2LWIA 2HT6A 5FOWA 2BBWA 1YE8A 4FMDB 2R65A 4E03A 4M1MA 3LX5A 4XD7A 1U81A 3GLGE 2F3TA 4AURA 4B34A 4IDPA 2ZE7A 1CJKC 5KNDA 4AKHA 5HTKA 5CJ2A 2F43A 4F93B 2DFKB 1G1MA 2CCKA 2ZVPX 2ZSBA 4WXPA 3TVTA 5EE3A 1GTVA 1G5PA 3VTKA 2IS4A 2IUSA 1YRBA 1E2HA 2IYSA 1OLOA 2YZ2A 5K8UA 2QPOA 3VKGA 4OHXA 421PA 4W5JA 3KFXA 2WJHA 1E9RA 5FTJA 2QENA 2J7PD 3BORA 1A2KC 1G3IA 2ZJBA 3CNLA 1X86B 3OESA 4Q1FA 2DYKA 3JVVA 2NQ2C 2VRWA 4LBVA 1G7CA 1DPFA 1H65A 2CJWA 1Q3TA 2AWNA 2EYQA 2CLCX 2GJKA 2D4HA 2HXSA 5KSPA 2Q3HA 3SJAA 4PPQA 2FSGA 1NG9A 4M1SA 3ZGXA 1PVOA 4TLDA 1S2MA 2OAQ1 1B23P 2ZROA 1YR6A 1FX0A 2DPXA 2N42A 2V54A 3FMPB 4OJQA 4EPTA 2PCJA 4EJSB 2IS6A 1ZCBA 4M2LA 1ZU5A 3GJXC 2F1RA 1TF7A 821PA 2FU5C 2QQ0A 1VPLA 4LJ5A 4AYWA 1COWA 1AJEA 4QNMA 2IC5A 4A8JB 5IRCD 1LY1A 1NP6A 2FE4A 4RSGA 1ZJ6A 3QXXA 1W44A 1E98A 2WPDD 5J40A 4DUGD 1CR2A 1RKBA 5KTYA 1N6HA 1G8PA 3FKQA 3HU1A 4BEBA 1GDDA 3CRW1 3U3MA 4A2QA 5C1BA 2JJ2A 2BMJA 1KDRA 4DDUA 2OXRA 1IHUA 2PBRA 4U02A 5EZ6B 3K70D 1NSTA 4B73A 1VG0B 1F48A 4QJ5A 1HA3A 1T3SA 4DCTA 1AGPA 2ZR0A 1B0UA 1NI3A 1FTSA 1LNZA 3PFIA 2O0KA 3J81k 1QHSA 3B1XA 2C5LA 2GETA 4Q66C 1KJYA 1QHIA 2E9SA 2YJTD 2QL6A 3GJ3A 2KBEA 2G1JA 1Z47A 5B57C 1JJVA 1MH1A 3LW7A 5J4VA 3GPLA 4JIMA 1FOEB 1K5DA 2ZRGA 5H8WA 2ZSEA 1Z28A 4B32A 4NCHA 2NZ8A 3KKNA 1E2GA 1UPTA 1NMZA 4P32A 3AGPA 4XOIA 3B1ZA 5AR1A 1Y3AA 3MWKA 2BV3A 3OIUA 3QXCA 1T0HB 3U6KA 2IEZA 2NO0A 5HKKA 4LZZA 2J7KA 4OI0A 3T35A 2VHCA 3QVUA 3QXHA 4A2WA 4CRWB 3N5CA 2V1XA 2ZRNA 1P72A 1TF2A 1S8FA 2ZETA 4TYNA 5CIWA 4C0HA 4KITB 4GP7A 3PG5A 1OV4A 5GJVC 1XPOA 1TQDA 1TEVA 1KO5A 3H86A 4EQ6B 3IPYA 1RW4A 3V4RA 4RD1A 3CH5A 2RHMA 2VBCA 1ZNWA 4DLZA 3CPHA 5FUYA 1BYIA 1E9SA 1D8TA 1CR1A 3AVPA 4DC9A 5GVSA 1IJFA 3EPKA 1E2NA 3H0KA 3KB2A 3BJIC 2FNAA 2F9MA 3MD0A 1NMYA 2ZUCA 2IUUA 4Z51A 3SOPA 1G7TA 3P26A 2W2VA 2XTZA 4Q5IA 5EXTA 4HYYA 5FBRB 2VP0A 4TL9A 1XX6A 1NY5A 4XH9B 3CWZA 1KAGA 2QPTA 5TARA 4JYBA 4UJ5A 3KKPA 1S4QA 3O8RA 3PQCA 4B3GA 3HR7A 3U6BA 4TZ0A 1IN5A 3U60B 3TAHA 5DHFA 1ZAKA 2NZJA 1Z0IA 3PR1A 1HEIA 2QM8A 1G8GA 2BH1X 2H8KA 1UKEA 3LW8A 1Z0FA 4DDTA 3AP3A 1DAFA 1G3UA 2HJGA 3KKQA 1M7GA 4ITRC 2NO6A 3A6PC 4IKEA 3VFDA 4P4TA 4GL2A 3HR8A 1KKLA 3RSLA 1SXJC 5EQTA 1OE0A 3EASA 5CLLA 2ZRIA 4HZUB 1VHLA 4BE7B 3UXMA 3LDAA 1I2DA 1CRQA 2OE2A 1JQJC 1MV5A 1PUJA 4BLTA 2LKDA 1W0KA 2VP9A 1RC8A 5D3MB 2R6FA 4LBZA 3AVOA 4QM7A 4A82A 3FYHA 3RS4A 2D2FA 3SYNA 4IDHA 4YQFA 3LBIA 5DE3A 4YDSA 2ERYA 4B3FX 1G4AE 2MMGA 4PC7A 5DHAA 5KNBA 4LV5B 3R9WA 1VYTA 5JEEA 1U8YA 2V7QD 3L82B 4OYHA 3RS5A 1EX7A 1S96A 3O8BA 1JECA 1XEWY 3TSWA 5IDVA 3VNVA 2I4IA 1OH8A 1KMHB 1RZ3A 1U0HC 3LQQA 1QVRA 1S3GA 1VYUA 3QKRB 3SNHA 1ZYUA 4B43A 2WSSD 2VPPA 1SXJE 2YKGA 1Z6XA 3FE2A 2FFQA 3ZYCA 2DWPA 2GXQA 4IXMA 4TTRA 4JLBA 5KO2A 2PEZA 4U00A 2QAGB 5DYIA 4ZDIA 1DELA 3UG6A 4R9UC 4JJKA 5JCZA 3SR0A 1WMSA 2J87A 1Q20A 5AJZA 2HYDA 4K8OA 1TNDA 1E2FA 3H1TA 1W7AA 2FJUA 1GAJA 1E1QA 2C9CA 4HLUA 3THOA 4EQ6A 5JJIA 1NVUQ 1VG9B 2AX4A 2VP4A 2MSEB 4Q7KA 1P75A 1XXHA 4I99A 1JEDA 2IYXA 1VTKA 5FOXA 1QHGA 2QEQA 5JCPA 4JSYA 1OKKD 2J9RA 5BXQC 5FTMA 2WWHA 2QMUA 2J5XA 5L3SA 2RGXA 3TR0A 3A4MA 2X1VA 4C0BA 2GF9A 3K1JA 2XX3A 4TSFD 4DEYA 2DR3A 3BH7A 2EFDB 1D9ZA 4NDZA 5FL7A 1EFCA 1HY3A 1XMSA 2MSCB 1CF4A 2QP9X 4PZZA 4R7ZA 5FPTA 4FMDF 1W5TA 2FG5A 3W5JA 1JBKA 2ZR7A 5A4JA 2VP6A 4B2PA 1W0JD 3TH5A 3GP8A 2VP2A 3ETLA 5ANRB 2UZIR 1GNPA 3EWSA 3FMOB 3KQHA 3ECCA 2O8EA 4JVMA 4Y0AA 4M0LA 4PPNA 2C04A 4B3DA 3B60A 3CR8A 1VECA 4XWOA 5BW8A 1RRPA 2YYZA 3TRFA 1KO7A 2KE5A 4TWZA 2WOOA 4RD2A 2GCNA 1SVKA 2N46A 3IUYA 4UNNA 4B35A 1XPUA 3W8RA 2ZE8A 3LV8A 2PJZA 4LJ8A 1NLZA 3E2IA 2XSZD 3AEZA 3LBHA 3MWYW 3QEOA 5L3RA 5D3MA 5KSOA 1KHTA 3TBKA 2ZM5A 1P73A 3QPWA 3V00A 3ZZ0A 5FTNA 3KXIA 5A5GA 4V0OA 4WVFA 4BFWA 2PLFA 3QPUA 2HJVA 1II0A 3C7KA 4LWZA 2OHFA 1XTIA 3PV0A 4QHYA 3QF7A 2J3EA 1T5LA 3HP1A 1VIAA 3ADCA 1P3JA 2KJQA 4HLQB 3DPUA 3E5HA 1HE1C 3L43A 2PLRA 5TXGA 3W6NA 1DARA 2ZJZA 1QF9A 2K5UA 1T6NA 4CEHB 1GUAA 1KMHA 1JQLB 2H7VA 2W83A 2ASEA 3KUCA 3LLMA 2ZYVX 1QBKC 2XTNA 4BZXA 2DCUA 2HF8A 1N25A 3IQXA 2QAGA 3KZ1E 3QBVA 3LO5A 4Q9JA 3ADBA 2GWHA 1G8HA 3AVWA 5GJCA 3GFPA 4C7OB 1J70A 4ACAA 1UJ2A 5G53C 1NVVQ 4TZ6A 4TYQA 2QPAA 4M9QA 1LV7A 1UKYA 4B47A 3X1WA 4TQAA 4DKXA 1XD2B 2RGDA 5AUOB 3BOSA 3KJIA 4ZO4A 2D27A 1V5WA 4DZZA 1ZU4A 1G4UR 4WW0A 1G5RA 5DN6D 1SKYE 2CLDX 2P6UA 4GMDA 2PT7A 4AG6A 1FQJA 4LJ4A 4BFTA 3ICEA 4Q9IA 1PUIA 1CP2A 3QKSA 4TT3A 3ZLJA 1E9EA 3GLGA 4RZ2A 1HURA 3WYFA 4PHGA 4A0GA 3IEUA 2ZJ8A 2XJ4A 4XJXA 1WCV1 3RWOA 1OB2A 3HPRA 3AVVA 1SVOA 2HXYA 4K46A 4XVUA 4HAVA 4R2HA 3WRYC 4IVRA 2A5JA 3CZQA 2QN6A 3RDPA 1XCGB 2F1HA 2O8DB 4G0NA 3G82C 2ZITA 4TMZA 3FMFA 4X8OA 1F5NA 1G20E 2ZJAA 3CLVA 5CYOA 3WHKA 3EPJA 3NBZC 2CHQA 5EZ5A 1OXXK 3TK1A 4Q1EA 5DLQC 2BIFA 5J4LA 3P32A 3B82A 2GKSA 4B2LA 2IYTA 6Q21A 3DHWC 2YWGA 5FH9A 2QORA 1SVSA 4XVRA 5FBLB 1FUKA 1TUEA 4Q1DA 4HAWA 4A8JC 3B2EA 3BB3A 4QJ4A 3PXGA 1XRJA 3R8FA 1E79D 4PFSA 1NF3A 4OQXA 1C1YA 1J8YF 2DWQA 2W6JD 3DEFA 2Q6TA 4RD0A 3KQLA 5AJWA 2HV8A 2L0XA 2IHYA 4LJAA 2W6IA 3PUXA 2ATXA 1VHTA 2RH5A 1RYFA 2FFBA 2JJ1D 3QF4A 1E2QA 1ZM3A 2HF9A 1ZINA 3THWB 1GSIA 2XXAB 4GOJA 5SZIA 1G64A 1ANKA 1Z83A 1NNEA 3WY9A 2OCBA 2VHUA 3BFXA 3A4NA 4TYYA 5F9FA 4CEHA 2VHQA 1CULC 2OUKA 1A82A 3HU3A 4CT5A 4TTQA 4C0QC 3U3JA 2ZRCA 3B8HA 3FKSD 4P4SB 4UJ3A 3SEAA 4URZR 2XNDD 4M1TA 4NYIQ 2JEOA 2R8RA 1G3RA 4JJZA 1W4AA 2OLKA 3D8BA 1L4UA 1IQPA 1KK1A 3QG1A 2WJVA 1Q12A 2DHRA 2Z6VA 4US2R 2CHVA 5HE9A 1ZP6A 2QA5A 3I92A 3ONWA 4BFZA 4Z1MA 3W9YA 4KSBA 5EE1A 4ASUD 4HLUC 1BH2A 4IJMA 1TMKA 3LRPA 2QMEA 3A37A 3TLXA 4AK9A 2W58A 1XD2A 2ZVQX 3SQXA 1PLLA 5F2EA 2G88A 1Z08A 1JEEA 5LDDC 3GEEA 1D2NA 4NYMQ 1R0WA 2DFLA 4IDNA 4OQLA 3CNOA 2C96A 2EWVA 4UQOA 3ZIAA 1PJRA 1Z6AA 3LXXA 4A2PA 1QHYA 2QE7A 1G19A 3CKLA 1K6MA 4LYHA 4TMXA 2ZREA 1E1RD 2G77B 3TUIC 2UVQA 4G3XA 2ZE5A 2NO1A 4Q7LA 4TLCA 2GDJA 4FD2A 2WIAA 3SJZA 5FPKA 1N5IA 3AVTA 5J47A 3WHLA 2XJ9A 4ESVA 3A1WA 2ZU0C 4JLNA 5JEDA 2BMFA 4Q47A 2QU8A 3UMFA 4JBWA 4GT1A 4YMUA 4UXHA 2QY9A 1KJWA 3PUVA 3RS2A 2YV5A 3K0FB 4A6XA 5TVKA 4D26A 1GVNB 5GJBA 1FZQA 1OIVA 1G18A 3OEED 1FMJA 3UWOA 2C9OA 2ZRKA 2BCGY 4QNRA 2VHTA 1ZD9A 2QZ4A 3QUSA 1FNMA 3KDSE 1GOTA 3GLIB 1E94E 1TUIA 3SN6A 3CPEA 1AKYA 4NP6A 5E4FA 3I32A 4D0NA 2BBTA 1XCMA 3Q8XB 3T34A 1OFIA 2XITA 2QGNA 2GBLA 3EIQA 3UIEA 5H70A 2JJ8A 2NMVA 3NHBA 2IYUA 4AYXA 1KDPA 3MJHA 4G01B 4AKEA 3A1VA 4M1OA 4PSAA 3A1TA 5P21A 1FQKA 4YMVA 2GHIA 5EP2A 3SQWA 4FIDA 5JHGB 4JLAA 4LHWA 1TTTA 1D6JA 3RS3A 3K9GA 1NVWQ 4NONA 4LJ6A 3Q5DA 1T4GA 4MYTA 2WOJA 1U0LA 2Z5FA 4E22A 4ZCIA 5C2JB 4ZDWA 1EG7A 1OXSC 1RJ9B 3NEYA 4UXIA 3FHCB 1E9DA 1Q57A 5K8LA 4KO8A 2JLUA 2ZRHA 1KK2A 2BDTA 4JBXA 4RVCA 4URWR 4D0LB 2QAGC 2CNWA 4PQYA 2Y8EA 4PSVA 1SVIA 4GNKA 4QC2A 1G7RA 3UG7A 2SHKA 3V9PA 2OCAA 4DLRA 5CB6A 5EE9A 1ZUNB 5KSYA 1LVGA 4PHFA 4AIIA 1Z0JA 4OQNA 2KBFA 2OEPA 1R5BA 2WV9A 1ONBA 5G3ZA 1LFDB 3QQ5A 1KDTA 1NJGA 5JRJA 4PX9A 1FMLA 2JCSA 3UK6A 3H4MA 2B21A 3CONA 2GILA 2IYRA 4GPTA 4OK3A 2G6BA 1NG1A 3QY0A 1NKTA 2ONJA 1A4RA 1ZIPA 4KFSA 4V03A 1IXZA 2NO7A 2WAYA 2MMCA 2ZAOA 1UKZA 3OIVA 4MKFA 2A2ZA 4LBWA 5BN4A 1IONA 1GKUB 4XTRA 4UKDA 1Z8FA 3TW8B 3WMFA 5KDDA 2IF0A 1E9FA 4NMMA 3WP0A 5CK5A 3OF5A 3GLFB 3BH0A 2IX3A 1ZC4A 3SU8A 5IK2D 4BRWA 4PO8A 1E2LA 2BKUA 1OF1A 2G1KA 3KQKA 1IOZA 4B6FA 4NYJQ 1W48A 5CJPA 1UEJA 4RFSB 4WZBE 2X77A 4P33A 3W3ZB 2H18A 3KQNA 5FL7D 3A36A 5F98A 3C4JA 1KI4A 1W36B 1XU4A 1GFIA 2OZEA 2QM7A 3DMDA 4BFXA 1G8YA 4M1WA 1OHHD 2J46A 3K0FA 1F3OA 4HZIA 3TE6A 3BBPA 3RC3A 4ILEA 2OSBA 4KSCA 3TQFA 3I5XA 4L15A 3DKVA 4JLOA 4LDJA 4BZPA 3GLIA 3S1AA 3WBJA 4KFRA 2WBLC 4DSOA 1E2KA 4I4LA 2AFHE 1JR6A 5KNCA 4RD6A 5FI1B 3VU9B 2VF8A 4Q9KA 2B7CA 3WNCA 1U8ZA 4BPBA 3M0EA 3QBTA 5FOSA 1EX6A 4LSGA 3K09A 4P0TA 3WP1B 2ATVA 3QPVA 4EPVA 1N0UA 3CF0A 4OHVA 3CW2A 2JIZD 5FOTA 4HDQB 1OT3A 3PUYA 1NVVR 3DM5A 4DLUA 4MYCA 3X1XA 2RGGA 4KBFA 5EUMA 3SBEA 1JB1A 4KI0A 2G9NA 4YLGA 1PLJA 2ZRPA 1T3LA 2W2TA 4IFBA 2IT1A 3IO5A 3PVSA 1U0JA 4ZDJA 2RGAA 3ZVMA 4FW9A 1J99A 4EFLA 1GG2A 3QEJA 2AKAB 2GJ9A 4CEJB 1SKQA 1MO4A 5FBQB 2BC9A 2D06A 2ORVA 1GP2A 3LLUA 4LUCA 1VKJA 1W4RA 3BC1A 1D2EA 4D25A 3EIEA 5TMPA 3IHLA 3B9PA 2OLJA 3CB4A 4LYFA 1U98A 1WBBA 1JR3D 5J4KA 2BMDA 1TADA 4KJZA 1XCPA 3OAAD 4FMBB 1EESA 4BGDA 3IIJA 4D4LA 1II8B 3EX7C 4LBYA 2ANBA 1Z29A 2ZIAA 3AF1A 4MRVA 2Z83A 4G5QA 1FUUA 5DI3B 1RYHA 2MSDB 1JNYA 3T1VA 1HV8A 4JLMA 1NY6A 2Q3FA 1P5ZB 2QRZA 3GCGA 4HUQB 4JZKA 4RZ3A 5K8IA 5E7JA 3SFVA 2WKPA 3KX2A 4I1SA 3U7FB 3THYB 4F4JA 5AJVB 3HDTA 2CMKA 4OQFA 4HI0E 2D62A 2VP5A 1R8SA 1Z0DA 3JZAA 4RKFA 2ZJYA 3TSOA 1H8HD 2OESA 3T1OA 1RIFA 5AJXA 1H8EA 4B3CA 4QOSA 4NCKA 2CE2X 2CK3D 8OHMA 1ZVQA 4RFSA 2OILA 1D5CA 3BWDD 3WMGA 1M7HA 1UDWA 4X8LA 4ON9A 1O87A 1MABB 4LC0A 4DCNA 3LWNA 1CTQA 4DB2A 2OO7A 1F60A 2CL0X 2H1LA 1FNNA 2NO9A 2C98A 2J0VA 4M9ZA 5CK4A 2PX0A 1X8LA 5LBIA 1VG8A 4AKIA 4CIDA 3CNNA 2WJIA 2C99A 1UFQA 2XZLA 4ARZB 2O8FB 3L8ZA 1ZCAA 4M9XA 1KK3A 4CYMA 4F7WA 3LVRE 2YC2C 5HR5A 3OE7A 1SHKA 4NU0A 4Q01A 1UBFA 4NYIR 2FWRA 2OFWA 1E2EA 2GBLC 3QXJA 3EZ6A 4YXWA 4LY6A 3I5YA 3REFA 1DAEA 3IO3A 2GXAA 4JKIA 1E99A 4O3MA 1XD9A 4P4UA 2ZJOA 2W0MA 3GJ7A 2Q9CA 4CVNA 3B78A 1S9DA 1W1WA 2ZXUA 2VSOA 3HPQA 3L0IB 4E5UA 3O8DA 2F1IA 2ZANA 3PCRB 1VDZA 4NH0A 2J0UB 4XVQA 1DVRA 5FUXA 5AWFC 3I62A 1E69A 4TLAA 5EP3A 5FBVB 3IGFA 1XTQA 3T15A 1EFTA 1AS2A 2EFCB 4NYMR 3NG1A 1YU9A 3NC1C 5HE8A 4IW3B 1NN1A 5A0FA 3VMFA 2W00A 3SZRA 2IL1A 1UBGA 3MWJA 4NE2A 1EWRA 1XEXB 2NTYC 3QJYA 5LD2B 4G5OA 4C4PA 2RGNA 1P2VA 4EJSA 5DIFA 2JLVA 4KYIB 2WSMA 3NH9A 4LHVA 2PX3A 3QI2A 1II8A 4FI3C 3L8YA 3PIRA 1KO4A 1KO1A 4TMTA 1N6PA 3DZDA 2BWJA 1AZSC 3QKUA 5TY0A 4YDHB 4A8JA 4A92A 5FR1A 1LS6A 2QG6A 1E0AA 2WKQA 1KSFX 3U2QA 3RS0A 1UDXA 5FTLA 3VAAA 5KPDA 2BKEA 1QDEA 3W3AA 1E32A 1E4VA 1E2PA 4PC6A 1GNQA 3NIBA 3RS7A 4OI1A 1O3YA 3K9NA 1NN3A 4RD3A 3FFAA 3CIOA 2ZS7A 4PZLA 4ZIRB 2IYWA 1Q1ZA 2KWIA 3OIWA 3IDQA 3BK7A 4AC9A 1N0VC 4PZYA 1I4LD 2BM1A 1LF5A 3FVQA 1RRCA 1IBRA 2XTMA 2ZI3A 2VSFA 2D74A 3K8YA 2PT5A 1N6RA 4DHEA 4IOLA 3AV0B 5EJEA 2JLZA 2EFGA 1CS4C 1Z5ZA 2OXCA 1ZC3A 2VYFA 1BMFA 1KDOA 2F55A 3MMPA 4A1FA 5LPNA 4OHWA 4MKGA 1AQUA 1XWIA 5HZKA 3Q85A 1WF3A 3D7MA 3M6AA 1XB2A 2PH1A 3C16C 3K53A 1XEFA 4GOXA 4C3ZA 5JWHA 1YZGA 5EP4A 1CKEA 4IHQA 3NBFA 4TMVA 4DBLC 2WTUA 1Z2AA 3TVDA 1PLKA 1OFTA 1MR3F 3WMEA 1GITA 4I1UA 1Z0KA 5HCNA 2IF2A 4NHOA 2CEAA 4DT1B 5HPYB 3K0CA 4C30A 5CB8A 1FTNA 1ZRHA 2VHJA 4B71A 1ELOA 3UWKA 3AKEA 4FCTA 5DYGA 4F92B 2ZUBA 3OEHA 4TMWA 1NBMA 2EFEB 3K09C 4WXRA 3U3OA 4B76A 4ZCLA 1NL3A 2IK8A 3CF2A 4KVAA 3WNBA 1YJ5A 3IIKA 4IEIA 2J0UA 5DI9A 2GF0A 1ZNXA 4EFNA 2ORWA 3K70B 1BS1A 1QHNA 2OFXA 3E70C 1SGWA 4WZ6A 2JDID 1EFRD 4FCWA 4MH0R 2GJ8A 4QBFA 3GLIE 1F2TB 4PC1A 4N3NA 3ZVRA 1P2UA 4HLCA 2X19A 3AM1A 1IAQA 1SHZA 4FCVA 1AN0A 1EFUA 4Q4AB 4UNSA 3EZ7A 3H84A 2P3SA 2TMKA 3AKYA 2V6IA 3ADKA 4HZUA 1CR0A 4C0AC 4WOPA 4HATA 1BOFA 5G3YA 4NYJR 4DB4A 1YZQA 2AHOA 1E9BA 4QXAA 3W5IA 2HCJB 3BERA 1G9XA 1SXJD 1VCOA 3CM0A 3FPAA 3RRZA 3PEUA 5G40A 3FWYA 3U61B 4N0DA 3U4QB 2Q9AA 1WE2A 4MRNA 3BB4A 4OBEA 4HLDA 4KV9A 1IXRC 4QFMA 4ZIRA 4CW7A 3DM9B 2CCJA 1XD8A 4KODA 4YMWA 2HLDD 5LB2A 3B13B 4JLPA 4D4MA 2BM0A 1Z3IX 2G3YA 1KIMA 4D2IA 1K5GA 3QKRA 221PA 2R9VA 3AVXA 3PUZA 4DVGA 1T5IA 3IPXA 1TF5A 4BFVA 1NN5A 1W36C 3SBDA 1UBCA 2G83A 1ETUA 1QRAA 2AK3A 4EIWA 4L5BA 4PSKA 1EFHA 1TU4A 1ZM7A 2WIBA 2ZRJA 1T91A 3DOEA 4K81B 1TL7C 1YR9A 3W90A 4XSGA 2IXGA 1AS0A 3DMNA 1M1YE 2NG1A 1XTSA 3E1SA 3RWMB 1S0UA 4AD8A 5ELXA 1G291 5B58C 3OFND 4KVGA 3KJHA 5TV2A 4AG5A 1U2RA 3ZJYA 1Z07A 3GJ4A 3EARA 2V3CC 3SHFA 2PMDA 3CR7A 2GA8A 4TL6A 1G21E 1OPXA 2WAXA 3HWSA 1GL7A 2V1UA 1T8TA 2A5DA 5BYKA 1SVLA 4POAA 3BAFA 5CM8B 4YONB 2RB4A 1XMIA 4PQFA 4XD7D 1OH5A 2EYUA 1E2JA 3BRWD 2WPDA 5JFGA 1DAGA 4DUGA 4Q1AA 2PEYA 3Q7PA 3THXB 3WBKA 4C9BA 1JALA 4MKHA 4PO9A 1KMQA 2F7SA 1AM4D 4A15A 3AF3A 1HT1E 1P7CA 1UKVY 1M7BA 5FUVA 2AL7A 4OI2A 4B6EA 4HDCA 3GJ5A 4LX0A 2B8WA 2DWOA 4EPWA 5FUWA 1GZSA 2PJRA 2Z4SA 5E7MA 1DTSA 2IYQA 1KI2A 1S1MA 2RGNC 2XOKA 4M21A 4MGIR 4Q4AA 2FH5B 1KI8A 3KFVA 3MCAA 4EJSC 4V0NA 3AVYA 2ZJ5A 2EQBA 2ZS9A 1MT0A 1P2SA 2D7CA 2QTHA 4V02A 3QKTA 4LGMA 3NHAA 5HZHA 3DOFA 1HH4A 3IQWA 1UADA 4D81A 4L4UA 1A2BA 4JLJA 4ZDKA 2XGJA 2WVJA 2RGCA 3SYLA 2VO1A 1DBSA 1COWD 1MOZA 2ZRAA 2P5SA 4JS0A 2QMHA 2B7BA 4LI0A 3SC3A 3BIFA 2J0QA 1ESNA 1SVWA 2QBYB 5IF9A 121PA 3L0SA 4JSTA 3GJ6A 3ZVLA 1XPRA 1HQYE 3GMTA 1KI7A 1KI3A 2I3BA 1AK2A 1JJ7A 2JJ2D 2W2XA 2G0NA 5DNYB 2RCNA 4PO1A 1DADA 4G1UC 2JLQA 4LYJA 3K0SA 2QNRA 3GJ8A 4BEJA 4M9SA 3I61A 4OK5A 3CZPA 4CGZA 1YHNA 1LW7A 1DEKA 4RCZA 3HYTA 1OXVA 3QENA 3VR6A 1P61B 3C15C 2BJWA 1GRQA 4M1KA 2WWXA 2VA8A 3EIHA 2BMEA 1W5SA 3CX6A 4S35A 3RSOA 4AYTA 1KO8A 4DLWA 3WYAA 1GIAA 4C7OA 1G41A 3TGPA 3AF0A 1KJZA 2B92A 1E6CA 3IIMA 3MUFA 1W46A 2OAP1 4A0FA 3LVQE 5HKKD 5EUQB 1XF9A 4EAQA 1AKEA 1OH6A 4W9MC 3BS4A 1TPZA 3K0CC 3TUJC 3UATA 1KSGA 1JAHA 1YKSA 3M1IA 3RLFA 4XSHA 5KOYA 2FN4A 3LXRA 3K0AB 2J0SA 2XEXA 2QQEA 4Q03A 2X2EA 4MUAA 3K0EA 1OFHA 4JT2A 3RRYA 5JSZB 1I4DD 3ZVNA 5F9HA 3AB3A 2X8AA 4D0GA 1Z0AA 1KZ7B 4DIEA 2R6DA 2IWHA 1SXJB 5FTKA 1L2TA 1U8AA 1KTVA 4GFDA 1G5TA 3PJRA 4OI4A 3THXA 3B9QA 2VIIA 3GLHB 2CXXA 2OBMA 4HAZA 2DFTA 3D31A 1IY1A 4US0R 3RRMA 5F3WB 2JA1A 3VKHA 3X1YA 3DDCA 1W49A 3DVLA 1T3HA 2ZPTX 5HCIA 1II9A 2RHDA 4PC3A 5BWMA 1BYUA 2V55B 1FP7A 5FOUA 4B3BA 4GZLA 1N5LA 2DY1A 2FMXA 2O8DA 4MITA 3LA6A 2V7QA 4MGZR 1RRGA 2GEDA 3EZ2A 2GJAA 4IVQA 2D3WA 3B6EA 1I2MA 3CRMA 4URYR 5DGXA 5E3HA 4D80A 5LD2C 2LCFA 2R62A 1S1CA 2WSSA 1NRJB 3MSXA 3P1JA 4NCJA 2FEMA 5JMTA 1RPZA 4OKSA 4QGFA 3C5HA 4OK6A 4DSNA 3ZD6A 3AF2A 4TL8A 3AF4A 4DLTA 3UKDA 5B64A 1NBME 4DSTA 2WWFA 2D2EA 4R2IA 1XMVA 4GMXA 1N6NA 3Q72A 1GNRA 1M2OB 5BQ5A 2P0EA 4TYPA 3B1WA 5L3QB 4QGGA 1OXTA 1W0KD 1US8B 2QBYA 4LJYA 4IOJA 2KI5A 3THWA 5DH9A 4EPRA 1FPMA 1OSNA 2IYVA 1KGDA 1KYIA 1NLYA 3NXSA 2XXAA 2EVWX 4MRPA 4LK2A 3FHTA 4D4JA 1OKKA 3MWLA 2ZI4A 4C2UA 4ZV4A 4NTZA 5KHOC 2QT1A 4NCNA 4LC1A 4TQ9A 4P4SA 3MAAC 4BZQA 2I1VB 2F43B 1G3MA 1ZBDA 2CCGA 1P6XA 3I1FA 1JAIA 1UM8A 1YZLA 3P4XA 1W4BA 3PUWA 3MFYA 4Y0VA 5C18A 5DO9A 1OYWA 3C41J 3CBQA 2P67A 2FSIA 1YZKA 2Z0MA 1OFUX 3F8TA 4KYUA 1GKIA 1W0JA 1L7VC 3CF6R 3EPLA 2GAAA 5H1YA 5KSZA 3AQ4A 2YOHA 3VQTA 1DAHA 2YWFA 4LHXA 2IXFA 2FSHA 2BEKA 2ZE6A 4AY2A 4RKEA 3MLEA 4B3XA 4DCUA 3EAQA 3FMIA 3K0AA 2JGNA 2OT3B 1XDBA 4IDQA 1OH7A 5EP1A 4MYUA 1E1QD 1X6VA 1KZGB 4JT4A 5JSZA 1XTKA 1X1SA 2XSZA 5TB5A 2VSXA 2ZRDA 1GRNA 3A58B 1VCMA 1BO6A 4QBHA 3SE0A 2IW3A 5JS8A 2QTFA 1DG1G 1GL6A 3GLHA 1MRNA 1VMAA 2GVDC 3IHWA 1S3SA 4MDFA 5JHHB 3K70C 4Q21A 1WDTA 3AVQA 1BIFA 1MO3A 2WWIA 2ZYWX 2VTKA 4FWIB 3SHWA 2ZI7A 3WXMA 3RRNA 2XZPA 3NKVA 1DAIA 4Q4JB 3R9IA 4A36A 1D2MA 2YINC 2CHGA 2FPKA 3CRQA 2NIPA 1U9IA 3KXKA 1IN7A 1E2IA 2P6NA 3KUDA 2J59A 2OM2A 4O0MA 3VR5A 4BLOA 4HAUA 1T0JB 2WJYA 1XJQA 1Q3HA 2RAPA 2QRNA 3ND8A 4BFYA 2I1QA 1DO2A 5J4HA 2ONKA 2IHBA 3BFVA 2BVNA 2ECKA 3CX7A 4KFTA 4MRSA 3W6PA 4IOKA 2FX3A 3VX3A 2AD5A 4NZYA 1P9RA 1DE0A 2HEIA 3NEJA 5B2ZA 4BUJA 1HQCA 4N1AA 2DB3A 2O0HA 2GVZC 2Q3MA 621PA
chains in the Genus database with same CATH superfamily
4PM5A 4MVJF 1IZYA 3AQIA 2O8NA 1J42A 1MO2A 1A97A 5FJIA 1MW9X 3CVUA 5FBKA 3GV9A 1STOA 2Z2JA 3N74A 1UP4A 4TRJA 2C9ZA 4DRXB 1L4BA 2V9PA 1YMQA 4M8SA 4RKRA 5ALJA 5A92A 3EH2A 2Y1LA 3TGLA 3G2PA 2AI1A 4GQIA 1F2UB 4PUGA 1R18A 2TSYB 5IZCC 3J7TA 4R98A 2J41A 4QDZA 1U0EA 4O2LA 2OG2A 4RK1A 4YRLA 1UMBB 4Y18A 4B4UA 2CFSA 3MMHA 3USCS 2FZ0A 3I04A 3ORFA 1SUPA 3QU7A 3A1DA 4JL8A 3TNFA 3RODA 5K51A 5LZ8A 4LFUA 4HYQA 4WCFC 4CM8A 2Q6IA 3PP8A 3NULA 4JEUA 2MSKA 4MYDA 1MXOA 3VH1A 1W5FA 1AA9A 2XA2A 3QX3A 1KAOA 4RPKA 1G16A 1WO8A 1R0XA 2XVAA 3BD9A 3C6MA 4LJ9A 1ISMA 1XWFA 2JLRA 2O2HA 2CGEA 3ILVA 3E48A 3I53A 2DETA 2AMVA 2X7JA 1MP0A 2BCJQ 2XQFA 2HHHC 4RK7A 5F4BA 4HB4A 5SZJA 3AWIA 2I91A 3VX4A 2W6QA 1PGPA 2YFHA 4QDOA 3JYIA 5K0NA 4PQEA 2QYBA 3Q2IA 4IYRA 3UGTA 3LFTA 1VIVA 4AWAA 1P2FA 4QATA 2MJLA 1HM5A 5ADUS 4BNIA 1GPMA 3R24A 1T8PA 1J7KA 3KB8A 1IWBB 5FLXD 2R48A 4GQBA 1V2GA 3TCKA 2H1VA 4ARZA 3A3OA 3JR3A 1QMGA 4MN5A 3W34A 3GBPA 3G5TA 4FUWA 2VJAA 3QYPA 3LUAA 1YHYA 5JLJA 3EEYA 4EYOA 4V1CI 2FAXA 3SJCA 5KU1A 2W2LA 4LG1A 3A11A 2W6CX 3ZE0B 4BYMA 4N0QA 1RG9A 2AJTA 1B1AA 1OZAA 4HI4A 3KG2A 4LDQA 5FNVA 3SDZA 3GLGB 4ND5A 1R5OA 4C2BA 3UHAA 4OIFA 2C7QA 4DIOA 5A4DA 1FUYB 2WJJA 1EWTA 3C1TA 5FIUA 3DKKA 1GZ7A 5F1FA 3U81A 3ZGVA 3AESB 1P60A 4Y98A 3RVNA 3QVXA 1EH5A 1JRLA 4G0YA 4JNKA 4X7BA 2EWMA 3ZI0A 4C14A 3CTMA 2XUFA 3TRJA 1TZMA 1N4OA 4FOFA 1E3QA 5KCMA 3LAWA 1V8DA 5K8JB 1ENPA 3K31A 3RNLA 2D2IA 1Z45A 4IQ0A 5FFFA 3BW6A 3I9V6 1YSPA 4C08A 3ZHVA 1ZSVA 2FK7A 1XZAA 1D8AA 4IBRA 4WZAA 4FZVA 3U3RA 1L8OA 4BKQA 1NKSA 1FE8A 4J49A 1YJCA 3STYA 1V71A 4I7EA 1SU4A 4IFEA 1TGYA 1RP5A 5EKUA 2WHXA 3F73A 4KG6A 3QVOA 1DTWB 3MD9A 1IUPA 5HS6A 3DMYA 4TLLB 2XOXA 3WWZA 1QV7A 3HLTA 4MUMA 1L0GA 2BH2A 4L9SA 4W6ZA 4DIDA 1UMDB 4AIRA 4JHLA 1JSCA 3DL0A 3OWXA 1Z26A 4Q4HB 5IHPA 3H5WA 1M2KA 4KWIA 1IL0A 1DQRA 5J2TA 5IT4A 5EQDA 1S8OA 4DDYA 4EQIA 4XIGS 5IUJC 2VNSA 1YJXA 4X95A 3TL3A 3VSCA 1R2QA 2AXPA 1JEQB 3L7OA 4HEJA 2RIRA 2KLBA 4S1NA 2B8JA 4M1EA 1G17A 3DE5X 4U5YD 1GFZA 4KZ6A 3NM5A 4LQCA 1MFZA 2QRVA 1Z6FA 3VR2A 4P3PA 1FW6A 2FQ1A 3A9RA 2GJ3A 3F6SA 2QL5A 4W4TA 1YASA 4Y0NA 1OJ7A 1FTYA 1XAGA 4DA7A 2WIDA 4DXAA 5EXPA 1PT9A 1Z7GA 4UPEA 2ZYHA 1PTJA 3T4PA 2FW0A 3I4CA 4PMAA 1IEQA 3ZGNA 3TXAA 1KI9A 2DUUA 3F7TA 4GH5A 2WR8A 2QY6A 2JI6A 2GCOA 4HQNA 2ZL1B 1LRLA 4HOIA 3B6KA 4FE3A 4N3AA 3IBYA 3QFRA 3ABOB 1IQUA 1XZLA 3O84A 3PDUA 1BJRE 1W19A 4E51A 2X42A 4Y2HA 1V8BA 3NGXA 1P62B 4AAYA 1NP7A 3QHAA 5AI8A 3K15A 1PR0A 2H1CA 2IS2A 3P27A 4C4TA 4L0LA 3JAKB 2O3QA 2HLDA 3RVRA 3ASYA 1TLTA 5G1NA 5CLFA 1DFGA 3IX4A 4PN7A 4CIWA 1XCBA 2YYAA 1C3EA 3TXYA 2W4IA 3TRHA 3Q9LA 5KYXB 1TQ2A 3CE9A 2REOA 4QHSA 2Q5OA 4ZQFA 3EEOA 3TW4A 3FWHA 1IN8A 2ZRBA 3ZZUA 2LDXA 3D0OA 2RI6A 3QOWA 4ND3A 1SRQA 4ZQIA 1US8A 1X1RA 1MW8X 2BHNA 5G02A 3OJEA 5ALFA 2X3FA 4PYNA 2IBTA 3GGGA 5EXEA 4E03A 3LX5A 3F4BA 1G8KA 1ACJA 3EZLA 3VDRA 3I0MA 5HTKA 3TSCA 2ZSBA 2PSEA 4WK6A 1G5PA 2IYSA 3NBLA 4D98A 1GUBA 5K4AA 4U39A 4YX9A 2J7PD 3UYKA 3SF8B 1JU4A 4G23A 3GJTA 3CGWA 2VSFA 5TJHA 5EOEA 5KSPA 1PAUA 1TIKA 2FSGA 3TL2A 5AKLA 3K20A 2FZKA 4EPTA 4H7JA 4EO4A 1L6RA 1ZJ6A 3HA2A 1YCDA 4ROSA 1IHUA 3IIEA 1N32C 2OUIA 4KGXA 1NI3A 3ZJ4A 4AMZA 2E9SA 3MFXA 4PR3A 5J4VA 1FOEB 3FCOA 3H2TA 2ZSEA 1SIOA 1NJ5A 1IYSA 4RWZA 1V35A 2QTVA 3EIWA 4IRMA 1NOJA 4GSKA 4N01A 5AT1A 1K4KA 1PTJC 4D9NA 2SBTA 1TQDA 3U17A 2CSXA 1WV0A 4TZKA 3CPHA 1E9SA 5AKIA 4Y2RA 3JD3A 2WFAA 5E6RB 1QIGA 2YHIA 1KAGA 5NLLA 3U60B 1HGXA 1LL8A 7ADHA 1MIHA 2J8YA 3A6PC 1O77A 1CNEA 3HR8A 3OBFA 4KLRA 3UNWA 1OE0A 4BMOB 4BE7B 2CLEB 2VK1A 4WWHA 3LXUX 2XTAA 2GN1A 2WFMA 4IDHA 3UB3A 4KQ2A 2BM9A 2Y55A 4U9HS 2YKFA 3B5IA 2B18A 4S1TA 4AULA 3K9FC 1I3CA 2I4IA 1U0HC 3IBSA 1SXJE 4JP3A 4ZCRA 5JCZA 2HYDA 3RFVA 1XRAA 3HS3A 4O2BF 1QGAA 2BGWA 2NVUB 2FJUA 4X54A 4EQ6A 1VG9B 4YJHA 2IYXA 2PZAA 2AEJA 5BXQC 3HXQA 4B6SA 2RGXA 2J6BA 4XQCA 1V6SA 2BFWA 3T8YA 4NDZA 1ZUWA 1ULSA 2JC7A 4YRDA 4HNRA 3ORQA 1JBKA 4EJFA 6REQA 3BDAA 4OP5A 4WN3A 1VQQA 4WOKA 1T34A 1KMCA 3TXXA 2QTAA 5JZSA 1RPAA 5A4FS 5ALGA 4Y9RA 4GMHA 3W8RA 4LJ8A 1P2DA 2G07A 1B0PA 3TBKA 4XGQA 1HNZC 4ZO7A 3BM6A 3VAYA 1C8VB 3U3ZA 2HJVA 2AX3A 4DLLA 1L7EA 3KR1A 2FN9A 1O6GA 1JTGA 4AUEA 3R5JA 1U2SA 4NV3A 3IBCA 3NJ4A 3WFJA 5M1AA 3H2IA 2ASEA 4U7PB 2G8LA 3EXG2 1ILWA 5DOVA 2QE6A 4YAKA 3IQXA 2XNHA 2AC7A 1XAJA 1UL1X 1E8DA 5C1PA 5T64A 1Q7EA 2ZBQA 1BA3A 4HH2A 4Z9QA 4M9QA 2I54A 1QYIA 1LV7A 1UKYA 4I5IA 1JHMA 2D27A 1V5WA 2FWIA 1NVFA 4MWEA 4AG6A 3SEFA 4BFTA 5AK6A 5KYVA 2ZJ8A 3OLQA 3LK6A 4J0GA 3LCJA 4E12A 3ROXA 3LHKA 3EVBA 1XCGB 1PI4A 1ZD3A 2F67A 4R9NA 1FP4A 1TKAA 2AQIA 2CWDA 4WKBA 4ZOQI 2IYTA 4QU3A 1R4NA 1VL0A 1TUEA 1FSWA 3RH8B 4X1MA 3KKKA 4I8XA 2SKCA 2W6IA 2FFBA 1BVUA 1P7PA 2ZC3B 4RGQA 4LS3A 1P5RA 2MYPA 2R8RA 3OPVA 3IUMA 4QFBA 4OBXA 4CJNA 2ILTA 3GP3A 1QGED 2H59A 2WK0A 4OHBA 1HFEL 2QA5A 2HHAA 2PGDA 3D5EA 2IDMA 3MS7A 4HEQA 2C1EA 1WXHA 5LDDC 3GEEA 3RVJA 1WKVA 2C96A 4O4IA 1OWNA 4J0DA 3KJFA 5JAPA 1S7GA 3N86A 2NO1A 4P6ZS 3F1PA 1LSUA 2X0IA 2SECE 1ZOLA 1E3UA 3FPJA 3VFFA 1OA1A 1YQQA 3JYOA 1M33A 4EFDA 1BFDA 3UX2A 1RKUA 4JQCA 3LRTA 1U7XA 4N18A 1W8DA 3UE6A 2ZT7A 3ZWQA 2GBLA 4MCHA 3UIEA 3T50A 4PYIA 4TYMA 3NHBA 1UFRA 5FEFA 2JFXA 3UE1A 3K9GA 3ESAA 1G5FA 1ZXBA 5JNUA 3WLLA 1D1JA 4NONA 3QPAA 1M2FA 5ADWA 1Q57A 1W25A 2XTJA 5LNK1 4KO8A 1JTFA 5CGZA 5TMDA 4LLOB 1EFVB 3UXYA 4QC2A 3V9PA 3MZFA 2JCHA 3WSVA 2V5AA 3TRCA 3I3OA 1C3LA 1LFDB 4G5HA 1NJGA 3UK6A 4BY9E 1K56D 2G4VA 3ZW8A 2WJZB 2XE4A 3FTEA 1FBTA 2YJ6A 3WGHA 1C9EA 4KFSA 3CNEA 2VATA 2QVZX 1XEAA 2A2ZA 5FT9A 1ODVA 1VIDA 1XQXA 1NNLA 3WOVA 4KO3S 3KQKA 4XDHA 3AW9A 2WRZA 3F6RA 2QR5A 2A0XA 1TEZA 5MN4A 4HZIA 1PWZA 4D4IA 4XLLA 2M7VA 4G0VA 4H4EA 4BZPA 2WF7A 3BILA 3WKCA 5KNCA 3SNKA 5CHJA 5J43A 1BS9A 3COPA 2NPOA 2BHSA 2FEKA 3RU7A 4WY5A 1VSBA 3H16A 3CT4A 1JUDA 1SIWA 4GDMA 1V0JA 2AKAB 2L19A 3EIEA 1VZ2A 2KZ0A 2BMDA 2R9XA 1V96A 3RAJA 2UUAB 3KLPX 4RZHA 5DI3B 4UCXA 2RFLA 2QRZA 3KJNA 2QRGA 3U7FB 3KHUA 4NCKA 5AOVA 4MV8A 4I36A 2DC1A 1VPEA 4DCNA 3SIWA 1Z8NA 1T0PA 2X1MA 3H5VA 3PL5A 4N7RA 3DDUA 3SHVA 1TQ8A 1J7JA 3IOEA 3NO4A 2HEGA 4YJDA 5AESA 1K55A 1SHKA 1UBFA 3NP7A 2R1ZA 3AGDA 2GBLC 5H0IA 1U1CA 1GA1A 1L4MA 3W78A 1F1JA 3JXEA 2ZJOA 2A1TR 1S9DA 1V3TA 4I3IA 3HJBA 4PRKA 1EAYA 4XGKA 1HEYA 4M9RA 2QF7A 5I5GA 2OORA 5EP3A 1BCRB 5A0FA 3JQEA 4F11A 4CKYA 4FXOA 1B3RA 4UTPA 1B41A 4K0KC 4LHVA 2EHJA 3QI2A 4L5CA 1CC1S 1AZSC 1YR1A 3TIIA 4A92A 2PAFA 1HQKA 3SZTA 2MWMA 3RS0A 3V42A 4G8DA 2GT1A 2WU3A 2QLLA 2Z8YA 2B4TO 4X90A 5EZQA 3RS7A 4RD3A 1HF3A 2FZVA 4FEGA 5HAIA 4YHHB 1AVTA 3FVQA 3MJVA 4A73A 2GK4A 1ONNA 4QY5A 5IT9A 2D74A 1U0FA 1GTSA 1JOSA 4ZK2A 1OLUA 3O26A 9MHTA 1WF3A 4X0EA 1XB2A 3C16C 2MSNA 4GOXA 1Z17A 1J2RA 1OFTA 4DT1B 5CB8A 4PROC 2D8MA 1HDOA 5T8TA 1Q0ZA 2H11A 5EESA 1XDDA 1OAKA 4BMSA 2NUPB 5KU7A 3E70C 1SGWA 2GN2A 2QZ9A 4DHWA 4YIKA 3OZ7A 1IAQA 2H0QA 4S12A 3TE7A 2V6IA 3RSSA 2O9AA 3RREA 1GPNA 4DB4A 3HNPA 1VM6A 2QX9A 3WTCA 4GXTA 3DBRA 3BB4A 4QAJA 1VGQA 1GGFA 1SXIA 4OU5A 1ZG6A 4S24A 2BLLA 2X1HA 3QVMA 2BM0A 2GZRA 3QKRA 4DPMA 4DVGA 1T5IA 3WMXA 1Z4OA 1KZYC 3A7DA 2JEZA 1T91A 3OOWA 3DMNA 1SU8A 4AG5A 2JVKA 1K55C 3LF2A 1OPXA 1FRFS 1CZNA 1UMCB 1ULTA 2G9RA 5CM8B 3EUAA 2P6MA 2C4VA 3AJRA 1K0FA 4XB2A 4EVRA 3WBKA 4C9BA 5AE2A 1A1SA 4QYSA 2IEBA 1TUBA 2OORC 3E23A 3ECAA 2YIDA 5U4XA 1ESIA 2DQ4A 3C3JA 1CJBA 2XOKA 1A7KA 3AVYA 4V0NA 2D7CA 2PBDP 2EX8A 3FLBA 1A2BA 1OX6A 3VH2A 2CU6A 3LRXA 3R5HA 4UQIM 5CDGA 3SC3A 3V3KA 3WJ7A 3YASA 3IUNA 1X7XB 3QJGA 3QVJA 8ATCA 3LR3A 3M83A 2JLQA 3PJEA 4MBFA 4JBGA 2WUVA 3QENA 3TPCA 1X0VA 1E64A 2OV4A 1PSZA 2HMYB 5D3KA 1NMQA 5ED4A 1N34C 1D6MA 3MUFA 5HFOA 3LVQE 1Z9BA 2AV6A 1KJ9A 4IIBA 3RVOA 5JISA 2G5PA 4E15A 3L4KA 2QQEA 3A3NA 2Z2YA 3O75A 2WF9A 1SXJB 3G9QA 2CXXA 3T9BA 5J58A 2A9OA 2RHDA 7REQB 2FMXA 3LA6A 1A8QA 3S3TA 4IVQA 4X91A 3AIKA 3QW4B 3V4SA 3KV1A 2Q1YA 2WSSA 2P3OA 3P1JA 2JBHA 1N9ZA 2FEMA 4NCJA 3H5OA 4C87A 1FVFA 1H3FA 3IQHX 2UZ4A 2LTAA 4R2IA 1UWVA 5CURA 3E7XA 4DR2B 1TTQB 1C9YA 5DH9A 2QB5A 3BM5A 4WPGA 4BNXA 2ZIEA 1LTKA 5C8XA 4ENTA 2QX4A 2O0LA 4NCAA 2VHZA 4HY3A 4HPWA 4EKGA 2Y1XA 2FSIA 4M1ZA 3UAGA 5KNDH 2X5JO 4MCJA 3L8EA 4DXHA 2XKJE 3C3XA 1SQ0A 5BR8C 4LTDA 1G8JA 1DC7A 1CIVA 2XSZA 1VCMA 2VP3A 1IBLB 4L9GA 4LF4B 1Z5OA 1VMAA 2R00A 4MDZA 3AFNA 1BIFA 1XZCA 3H1BA 4ZJYA 1RCTE 3GR0A 2OM2A 4IWYA 4EG1A 2VF4X 2YBDA 3TNYA 3DGFC 2FX3A 3HJCA 4N1AA 4GSLA 2Q3MA 2XQIA 1F20A 3PPIA 5TDHA 1HDIA 4II7A 4HRAA 5EYPB 4EMBA 5D8DA 3T1QA 5EWLA 4HH3A 1OT5A 5EN4A 3LCCA 4I3GA 3BMCA 2ZEJA 1KBQA 2PGOA 3DMPA 1BVHA 1BZAA 3OEYA 1H2EA 4H1HA 2WINI 4FMCF 1R12A 2CUZA 4XSVA 4HSGA 5FRDA 3RC8A 4GBMA 3IQAA 4LDAA 4LRWA 1FK8A 3E22B 1WDMA 2IP4A 2JC3A 3OQPA 4K87A 2GASA 2BKLA 2BF7A 1N2CE 5DLDA 2H2IA 4QHTA 1GL9B 3P2KA 3KKMA 4KQIA 4D56A 1YR2A 4BC1A 3N6RA 4O25A 1NJSA 2QN2A 5K8TA 2PXHA 2Y2LA 5D2CA 1FFGA 3QEBZ 5BY2A 1R50A 2VQFC 3U56A 1TU3A 4Q7MB 3DO5A 3N2IA 3AKCA 4TPSB 1WW2A 1QFZA 5CIQA 5BT8A 5DXJA 1I33A 3KKZA 1HWYA 2P75A 2PUWA 2O8CB 4PYQA 3LKDA 4I38A 2Y2IA 3S8EA 1AO3A 2O8BA 2FPLA 2X4IA 2FA9A 2ZSDA 5I8WA 2KMLA 2BDUA 2FSFA 3NI9A 4Z99A 5BOSA 1E0KA 3IBRA 2O52A 4LFCC 4UNPA 3KZOA 2LE0A 4JXGA 3R7WB 2JGFA 2G1UA 3GUUA 4I19A 1E96A 4I81A 3JAMD 4WECA 2R00C 3JYQA 5B30A 3T1SA 1AN9A 2GX5A 4ACBA 1P17A 5AFSA 3UDFA 2ODTX 4M7RA 2HQ1A 3AEUA 2B94A 2ZWPA 4P6VF 1CUJA 1JZSA 4FEAA 1UEIA 3FTQA 1A2OA 5IVHA 5KKCA 4Y0UA 2PS1A 1QCYA 4AN4A 4NOJA 1KQGA 4HH3C 1HO3A 3UJAA 2WVGA 5F33A 3FNBA 1K8RA 3MPOA 3HEAA 2JH8A 2UUCC 4A0RA 4JT9A 4R8KA 4RKWA 3IR5A 2FY8A 4CF7A 4DCSA 2WZQA 2WQ6A 1YJBA 1PS8A 5FDHA 2OCLA 2GPSA 4BWYA 4GOMD 2VUTA 3P2EA 2RH8A 4TKUA 5J4YA 1ML3A 1Z6TA 5H4HA 4KCGA 3ONDA 1ZNYA 3H6HA 1AQIA 2C5SA 4OPYA 4TLEA 2GM9A 3GCZA 1YRAA 2AVNA 2P5TB 2DUWA 3RT1A 5CM9C 1J8FA 5C1OA 4JVSB 2QPLA 1D1QA 3ZKWA 3NCHA 1T36B 4E33A 2RHGB 4KMSA 4DANA 4FGSA 1BTOA 3F7OA 3E7FA 1ODKA 3TN7A 1VQ1A 4EFMA 4X63A 4Q18A 4BBUA 3HLYA 1Z15A 3QNMA 5E3JA 5JI2E 2ZSHA 3PFHA 4TLBA 1N7JA 2PGIA 2DVMA 4IKOA 1GSXA 3JZFA 3AGQA 3ZZTA 2HRBA 5CVDA 1H8MA 3SKYA 1U3CA 2Z5LA 3OD1A 1J2JA 1SD1A 4LHSA 2KZFA 2FQXA 1KEPA 1JNUA 2RAVA 4URVR 2OXEA 2PSHA 4MR9A 4JXXA 3B1VA 2ZI5A 1N1DA 1YZVA 3Q15C 3BDIA 3TQHA 5CA0A 4OOYA 3OBIA 2C8VA 5CAEA 1QX3A 2G5GX 4BS9A 2A9PA 5IJ9A 1PZHA 3G0GA 5AM5A 4E2FA 2PWPA 1FDIA 1J2YA 3EGDB 2A33A 1K7XB 2Q4BA 3MMZA 3A3YA 3TTXA 3FOAA 4W5WA 3UCXA 1RXCA 1B26A 1THTA 4C7VA 2XDWA 1I13A 4GZMA 5CPBA 1QK3A 4NBRA 2IX9A 4MVYA 3TZKA 3U0BA 3SR3A 3P9NA 4NBUA 2IY8A 3DOHA 2ZLYA 1F6WA 2QT0A 4FUTA 4I9FA 1INLA 3W9UA 1U5CA 3CUEA 4CV1A 1TM7E 2IV7A 1X8XA 2AA3A 1FQGA 1PV4A 4OHCA 4BQEA 1TVMA 4RM2A 2ANCA 3BG5A 1NDHA 2YHSA 3PTAA 3IMCA 1X7DA 3WL4A 1S1YA 4QTTB 1FP6A 2QRQA 3U7EB 3GVPA 3DCJA 4JLKA 1K2WA 1U99A 4YRTA 3HLCA 2XNKA 4N47A 2GZ3A 4TMFA 1KR5A 5KUTA 3Q7VA 1F4VA 3H99A 4JMPA 3RKRA 1WEHA 3BY8A 5JS1A 3AHDA 4OHOA 3PESA 4DMKA 4AI6A 2ACEA 1TJNA 2AYAA 2ZQ9A 1Y1RA 3B7WA 5DJUA 1TRHA 4QRHA 2ZSFA 3LNCA 3FYTA 4D43A 2I66A 2EQAA 3ZWOA 1QVVA 3SMVA 4KGDA 1DU4A 2XBMA 1P4GA 1D2RA 1CK4A 1WA5A 2TS1A 1CUFA 3IV6A 1HI9A 1MHPA 4NJEA 2R1UA 1Z33A 4BP1A 2CE7A 3IXDA 4XPZA 1EJ6A 3TDEA 5ALUA 3V32A 3W9BA 5FFMA 4M1MA 3GLGE 4WN5A 2ZQCA 1V1MB 5KVSA 2Z5VA 3JYPA 5DX0A 4JI1C 3E5NA 3WHPA 2QZPA 5LZ5A 3S7PA 5HW0A 2NQ2C 3SJAA 3SS7X 2E8EA 1PVOA 5FQIA 4OXRA 4G1VA 3OZGA 2X13A 2I62A 5HGXA 1XMXA 5THQA 4BTEA 3OZAA 2FFRA 5F21A 3IP8A 5KVAA 2ZOHA 2AEFA 4WBNA 3JY6A 1ERMA 1XG5A 2VHYA 4EJMA 5JH7B 4LISA 3LW7A 3GPLA 3DZCA 2JGRA 1RI3A 1XWWA 5EPOA 1RHUA 4P32A 1D2GA 4OBWA 3Q40A 4DAOA 1MCZA 5KWVA 1WMBA 1J33A 3GY0A 2I2FA 1S8FA 5DNEA 2NAFA 4TYNA 4F85A 5CIWA 4C0HA 3CUEC 5JG7A 1X1QA 2VBCA 3LO8A 3ULFA 2BFBA 3OQVA 3SOPA 2W2VA 2XGNA 2RGWA 1OU4A 1T9BA 2H2HA 2XVMA 3PQCA 1B43A 2JPDA 3PAEA 2G06A 3ZU2A 1OFVA 3LW8A 4XVHA 1YKFA 5B4UA 1R37A 2Y0CA 4EHIA 4ITRC 4MO9A 5CFQA 4RF3A 4KMRA 3ZHXA 3QFCA 1JQJC 4TV9B 4LBZA 5A5EA 2D1RA 5GMOA 4FWBA 4P4GA 3O8BA 5DOZA 4TS4A 2JCGA 4BQIA 5ESRA 1AXEA 4EEUA 3ZYCA 5GL9A 4CQJA 2VDMB 5JAUA 1KL7A 1WMSA 1Q20A 1JVBA 3VOZA 3HBFA 4J9VA 3HMKA 2LBPA 4GBJA 1XXHA 4JJFA 1NOKA 2APJA 3ROMA 4R4SA 2R3SA 3K1JA 4RDCA 3TCXB 3USZA 3T1NA 3UT5A 1BW9A 5A6SA 2ZR7A 2P35A 2NSLA 3GP8A 5BO5A 1Q0HA 3IF5A 1POWA 5E1BA 3G02A 2UV8A 1M5TA 1XDZA 4L4YA 2V5VA 4CLDA 2FSVA 1NLZA 3FHJA 1XRBA 3V00A 3PC4A 1UBUS 2JK1A 2ZC4B 4NE9A 4Q0MA 4FGJA 5BNWA 3M6HA 1T5LA 2PT6A 4EGAA 1ZNQO 2JCVA 4P92A 5E9WA 4QJGA 3BWXA 1PQ4A 2PFGA 2CFTA 4QUIA 3QBVA 1U7HA 2JZNA 2IHTA 4JI8B 3OZTA 3UBTA 3VR6H 1KMNA 5HRAA 3H5RA 1UBMS 5IAJA 1RGZA 4LOIA 3KPWA 2HF2A 4WW0A 3S44A 3TWOA 2OOSA 5DM70 4OLGA 4RZ2A 5K0FA 4QDKA 1W29A 1KEVA 3LPCA 4IF6A 4IHAA 5JVDF 5TR7A 1GAEO 1EA5A 5EJ5A 1F7VA 2FUEA 1Y5NA 1OXXK 1V3QE 4EHHA 1U7UA 3L6EA 4DZRA 1NJ8A 4Y1EA 2TECE 2Q2WA 3IERA 1NMEA 1KXJA 2M5OA 1YCGA 3WWYA 2RH5A 2JKGA 2ZM8A 1OYOA 3GW8A 3WRTA 2FWBA 4Z2AA 4CL3A 4BHTA 1X80A 4ZT4A 3FTDA 2PGAA 4F5WA 2YICA 1JR4A 1HDRA 3SVZA 4B4KA 1YVUA 4OQIA 4B3IA 1KK1A 4YT8A 3CY6A 3O4RA 3VGPA 1NRFA 1B6SA 4OVKA 1ZP6A 3TLKA 2A0YA 1H2AS 1YZFA 4XX0A 3LRPA 5LYYA 4FC7A 1XD2A 4RLHA 4NXFA 3D0RA 4A2PA 3IP5A 1L5RA 3TBFA 4Q3NA 1NP3A 3M3HA 4HWGA 2BT4A 4UAJA 4FTXA 3WA7A 2W6ZA 2WIAA 1Z4QA 2QV7A 1OTEA 1UZAA 1B00A 1EXWA 2PAVP 1SZDA 2EJVA 1RNLA 4PLHA 1JHZA 1G18A 4PY2A 1QNFA 2PUCA 3GXOA 2FSVC 5IH3A 1KKUA 1W85B 1QOPB 3EIQA 2YW9A 2NMVA 2QM3A 3ANSA 4WUTA 3A1VA 4LNHA 4ZGBA 3FSGD 3EXIB 3GBSA 4FIDA 4MULA 4XB6B 1UM9A 4MVJI 4UPVA 4NECA 3CLTD 3T7SA 1D1PA 4RS4A 3WAKA 2G17A 4MPDA 5EE9A 3VNBA 3FTPA 3RYCB 4G56A 1ONOA 3O3VA 4E21A 1R9GA 2NQ8A 2BJHA 3HM9A 5KJCA 5BXYA 1T8YA 1Z8FA 3EXFA 4UKDA 4NMMA 2O1WA 4PO8A 3KBBA 5LKAA 2OCIA 3WLTA 3C4OA 2QX6A 3HJAA 3NHYA 1OHHD 2OQIA 4YV1A 4LZPA 2UZ0A 1CQWA 1XVLA 2CMHA 2Q6OA 2ZQ7A 3LOUA 2J07A 2OBFA 2AOWA 4L0QA 1EKXA 4ECAA 1QH0A 2HIMA 1EX6A 3HY6A 3TMYA 3K09A 5I3ZA 4AQ7A 3KE8A 5FOTA 2N1MA 1OT3A 3X1XA 3DYBA 4KBFA 1EROA 4UAAA 3JQPA 2HPAA 1HR0B 2R9WA 2I7XA 1J5EC 2KLIA 1U3TA 2G1AA 4F60A 1U1EA 3ROZA 3H7AA 3WQHA 2N75A 1PV2A 2VDLB 3C3KA 3UAZA 4YJKA 1Z29A 1YK1A 2ZXFA 3J80A 1VI6A 4QTZA 4BNYA 4FFDA 4B3CA 3RXWA 4U8GA 5JC1A 1YRLA 3OPQA 5A02A 3L6DA 4G5FA 4Y1GA 2NX2A 1YLWA 4U2GA 1NUTA 1F60A 4HQFA 3RU3A 2RHCA 2IXTA 4GICA 1ZHOA 4FOTA 3J7AC 2VA0A 5ERGB 2OFWA 1DAEA 4GD8A 1T43A 4O3MA 1XD9A 3B78A 4AKSA 5FHRA 2VSOA 2BHTA 3TOSA 4NH0A 1AQLA 2G36A 3Q87B 4RQAA 2AZMA 2Y1EA 1WXWA 4AW9A 2WU4A 4GKVA 2VSQA 1XNHA 1LI7A 1JDBC 1KSFX 5KPDA 1E32A 4FKZA 4OA5A 4P7KA 3LK7A 3KZNA 2WU0A 1NN3A 3OIWA 2RBGA 1GZ6A 1NZDA 1UJ4A 3UJHA 4ZYUA 3HZOA 4YMIA 2BM1A 1E4EB 2RBEA 2IH2A 3F97A 1H3EA 1XJ5A 2HNAA 1BMFA 4KQ1A 4LE2A 5IKXA 2QVCA 3GUHA 2GHQA 1A9OA 4H3VA 1UC4B 1JDZA 4YB8A 4HPJB 2WTMA 1ZRHA 3HSSA 4F92B 5IARA 1NE2A 2WHPA 2EZTA 3C7TA 3K09C 3QYAA 1VGVA 3CF2A 1ZISA 1H2HA 2ZB8A 3IIKA 5A7FA 1NKVA 4NH4A 3UWMA 4ZO6A 3S2IA 5HMLA 3PJFA 1XZ8A 3HWRA 2DE0X 3K5IA 2H1WA 4F3LB 2HIGA 4R8LA 1Z75A 2PT9A 1E5DA 3C3DA 3H8VA 1SHZA 4HEFA 3VP2A 4C0AC 1CR0A 5GHYA 3H75A 4QXAA 1AB5A 2A1UB 2VC2B 1H66A 3WLJA 5B7PA 4U9IS 4W9NA 2WJ3A 4J03A 1V8PA 3KHSA 3GNLA 2QLMA 1CF9A 2XCTB 2Y2QA 2JFZA 3BRMA 2W2KA 3V7NA 3MZ0A 2NTNA 5HHTA 2C82A 3ODPA 4RO0A 5K7SA 1EFPA 5DM0A 1NYEA 3MUNA 1HE4A 4JITA 5B1HA 1X19A 1A71A 1OTHA 3RTDA 4CDNA 5A71A 3SHOA 2WAXA 4AZSA 1C8KA 1T4DA 3AETA 3RD5A 1U1DA 4NS4A 2A5LA 2PEYA 4XXRA 2F7SA 2G9QA 2OLVA 5TS3A 3NI2A 2RE8A 5EIXA 4D8XA 2VPZA 4RJJA 3PNKA 2WD7A 5HDBB 4BX8A 1QM4A 2UZ1A 4X85A 2KYRA 3QXGA 1JEYB 4NQRA 2AW5A 3EPPA 2IOYA 1G55A 2J0QA 1N3YA 5IF9A 2EXAA 3UJNA 2VDQB 2BCEA 3H9EO 4DM4A 4G9GA 1ZK2A 1UWLA 1ZLXA 4M1QA 4PZDA 3CVVA 4XT2A 2PSFA 4WMCA 1R0RE 1GT6A 5DWVA 4ARAA 3HJFA 4NZPA 2OK7A 2J9YB 5TRTA 1OVGA 2D5CA 3EIHA 4XJTA 4DLWA 1D4AA 3KO8A 4BB6A 1USPA 2Q3DA 1K2VN 3TGPA 3UDIA 1XF9A 3WJ2A 2HHHB 1IEWA 3KYDA 3FG9A 2GEBA 3KSBC 4RS3A 4WLVA 4QEDA 4IMJB 3K0EA 3JRWA 2H5SA 2QTNA 2GYWA 3FVWA 2JA1A 3NJ8A 1TD5A 5IT0A 3VKHA 1FCOA 2Z09A 5J3WA 1FP7A 4B3BA 1N5LA 3B51X 1PR9A 5BR7A 4MITA 3T5AA 3IQGX 4Q05A 1RRGA 1GY8A 1EX9A 2WZCA 4K2HA 3PSAA 3BLSA 4CXMA 5A04A 1GYQA 4OKSA 4KUOA 3IP6A 2Z1NA 4D3DA 2EATA 3GR1A 1XV5A 4UUPA 2JJQA 1N9GB 2V6MA 4W9NC 2P0EA 4KZ8A 2CFIA 3HCEA 1OXTA 5K0BA 1KQFA 4MRPA 2W42A 1PKEA 1I10A 4S1PA 1RHJA 3OD5A 4MHOA 3TZHA 1G3MA 1X7ZA 1F12A 1W35A 2CHUA 1WVGA 2Z0MA 5LMNC 2DGDA 5E8JA 2FPIB 2BGRA 1U0GA 2N9UA 2IXFA 3OJWA 4MTNA 1XELA 1YV9A 2IKQA 3K0AA 4IDQA 4MYUA 2AI2A 1NAHA 2F9FA 3A58B 3QMWA 1EBUA 4M7OA 3AJAA 5JS8A 2WG1A 4Z0HO 3OSUA 1JWPA 1DWOA 2WWIA 1RLMA 3RRNA 4LF7C 1HZZA 2D13A 2YINC 3KXKA 3HL9A 3IPLA 2J59A 3FBTA 1PR2A 1K7EB 5C8YA 3BFVA 2ECKA 3KT3A 3R0IA 1HRDA 5K6TA 3E0YA 3PL1A 4CM8B 3DDZX 3JASA 2HXGA 1L4EA 2TMDA 1L5FA 4BL2A 3QUQA 1BXGB 1JXMA 4DCCA 1HTWA 4Z8XA 5DN6A 5B58T 1YC2A 2ZT5A 1FSFA 4O5OA 1HG0A 1PNEA 1FDWA 1JQ3A 4PIVA 4UEOA 3VA7A 3A3JA 2FP4A 2J6CA 2FW9A 2QAJA 3KEGA 1H4SA 1TVEA 2IA5A 4S2MA 5EVIA 2FSSA 3WVNA 5ETJA 3UICA 1JPUA 1E79A 4FZ5A 1PR6A 3ZCVA 1ZMXA 3L7IA 3IT1A 4Y1RB 2OV1A 3MWEB 1F6BA 2JJ1A 1XKLA 2XMZA 2LD4A 5BYAA 2QAIA 1L5QA 1I0IA 4PLGA 2Y1CA 4AP9A 5GONF 1NVTA 1Q44A 5JZ9A 5CXWA 5EIBD 5BMVA 1MVOA 3IQZA 5KINB 5B55A 1JXQA 4TWAA 3GN1A 3RYIA 2RKWA 3QFFA 1BRTA 3LY5A 2IZ6A 1Z4PX 3D6UA 1CY6A 5FNVB 3CX3A 3B53X 1U8FO 2XUOA 3L92A 2XNSA 1EDBA 3DCIA 3E8XA 3L1KA 3IJRA 3BCHA 3U7GA 4ENQA 2ZUEA 1Y9DA 4MSUA 3H5AA 1JHRA 2FRDA 2QSYA 5JJKA 4EESA 1OASA 4F4CA 2VJMA 1A5ZA 2P9GA 1IUOA 2RHJA 3Q07A 1VCNA 1C4WA 3ZIAD 2ZJ2A 3MXRA 2QE7D 4G81A 4TTJA 1YIOA 5KKNB 1SZJG 1DIHA 4K6HA 4LPSA 5FYQA 1HZZC 5DP2A 5JQGB 3A0UA 3KR2A 4OQ4A 5J1TB 1YZNA 2AFIB 1GRCA 1G1AA 1CU1A 2FFAA 4J1TA 5JZVA 1VMKA 4UTRA 4BV9A 5AVXA 1MHTA 5TQ2A 3R6WA 3LBNA 2XR0A 2UWXA 3GEIA 5HJ2A 3SZOA 4PHCA 5TJ9A 3JAWB 2QOEA 2OAEA 4FE7A 4PX3A 4I5SA 3R40A 4GXNA 4ZVTA 2H1OA 2O7NA 3IAEA 4JBYA 2PZBA 2IOQA 2P4EA 4LTMA 4S05A 2VF7A 2IVFA 2E85A 1PD1A 4MV6A 3UMVA 3CH4B 3CPSA 2IBSA 1C4OA 3HHPA 3PBNA 1DFHA 1WCJA 1AA6A 5EVIC 1RXVA 2J1LA 4UHDA 4K9MA 5K1ZA 5F1PA 4OQMA 2MU1A 3HNOA 4P7BA 4PXYA 3CJRA 4UFNA 2VQEC 3HYRA 1AK9A 4I4TA 2CZCA 5EJAA 3B52X 3ISTA 1O94D 4B83A 2X2PA 2I33A 3JZMA 4LMPA 5KTSA 4C0KA 4D60A