4PUIA

Bola domain of sufe1 from arabidopsis thaliana
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
85
Chain Sequence
ALGSRGMRIREKLEKELDPVELEVEDVSYQHADDGETHFNLRIVSDAFQGKSLVKRHRLIYDLLQDELKSGLHALSIVAKTPAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords SufE-like protein, chloroplastic
total genus 30
structure length 85
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 4puiA01
2NCLA 2KZ0A 3O2EA 4PUGA 3TR3A 4PUHA 2KDNA 4PUIA 5LCIA 1XS3A 2DHMA 2MM9A 2MMAB 1NY8A 1V60A 2MCQA
chains in the Genus database with same CATH superfamily
4B3MC 1V25A 1IBMC 2OO4A 3RV2A 2D1RA 1GPMA 1XMOC 2QVYX 4K0KC 1TH5A 1UWDA 3UEBA 4DR7C 2WP0C 2XR1A 2Y4NA 4B3TC 4R1LA 3LAXA 2VZEA 2UUAC 4ISBA 2P2FA 3A25A 1MXBA 5A1GA 1V26A 5K8FA 5A1IA 1ZB8A 1HNWC 2YCBA 3IPLA 3UOWA 1FUGA 2MM9A 4TPSB 1XNRC 3TDEA 2V7BA 4EATA 4JI6C 5BUSA 4NXMC 2D7VA 3FCEA 1WH9A 4GXQA 4DCSA 1K0RA 1L2FA 3LUSA 1P4EC 3L95X 2P2JA 4LFCC 5DV9A 3E7XA 1M6XA 1J5EC 3TR3A 3GPCA 2QW0X 3J81D 4IZ6A 3E7WA 3T1YC 3I08A 4LF6C 4DV1C 5K85A 3CQ3A 3NPDA 1XMQC 4DCVA 1IB8A 4G37A 4JYAC 3CQ2A 1N36C 3A9UA 3UZ0A 4MH4A 4L7IA 3VNQA 4RLFA 5CZXA 5H9UA 2OPLB 4JI8C 2DPLA 2EGTA 4YY3C 3IMLA 3CQ1A 4D56A 3UX2A 3DHVA 4LF5C 4BCAA 4JM1A 2ZM6C 1XHJA 3PBKA 3AY0A 1V60A 1M6XC 4KHPC 1IBKC 4PUHA 4NDNA 4LF7C 3NI2A 3RG2A 4HPVA 4AQYC 1IBLC 1O9TA 4B3SC 3AF6A 2D1QA 2UXBC 4R1MA 1EGAA 3N54B 2E8FA 3G7SA 1N2FA 5BR8C 1O92A 4JI3C 1MDBA 4FUQA 3UX3A 1N33C 4D57A 4JI1C 2PN2A 5IFIA 4OX9C 2HHHC 2Y4OA 5E7QA 2CU6A 2Y27A 1XNQC 4JI7C 1P7LA 4D4GA 3GR0A 4DR2C 4LF4C 2ONFA 5KEIA 1VLAA 2D1TA 2UU9C 3S82A 3ETOA 3A4IA 4GXRA 5BSWA 2AYAA 3J80D 2KZ0A 2HJGA 4DUZC 2UXCC 1NYEA 3LNOA 3EERA 4BBYA 4DG9A 1MKYA 4RVOA 4GS5A 4I9GA 4PROC 1NY8A 2D27A 5BSRA 1HNZC 4DR6C 3L8CA 5KYTA 4X64C 4R0MA 4ZJZA 2E5LC 3IEVA 5T8TA 1RY2A 1O93A 4NOZA 5LMNC 5BURA 2MMAB 3IEUA 2F4VC 1FJGC 4RVNA 4B3RC 1XS3A 4DR4C 2OPLA 4JV5C 3N2QA 4DCUA 5KYVA 1I94C 4IR7A 2PT7G 3R9XA 3AF5A 2YWBA 1N34C 4DCTA 5CZVA 1T5HX 3VNRA 2OBVA 4XX2A 4GKKC 5IWAC 1O90A 3ETCA 4DV6C 4U5YD 1LCIA 3LGXA 4PHTA 4X66C 1LQLA 4DV5C 3GR1A 3LNVA 4JI0C 3PESA 4YHHC 5BSTA 3A26A 1ZB9A 1QWIA 4GKJC 4ZLPA 2VSQA 4PUGA 4G36A 5AE2A 4DUYC 4BC7A 2JNVA 1ULTA 4KTVA 1PA4A 5BSMA 5AE3A 4L2ZA 4DR5C 4JI5C 1HR0C 4LFBC 1XRAA 3DAYA 4I9FA 5JRHA 4DV3C 2D28C 2E8CA 3R9WA 1UKKA 1MXAA 4X65C 4LFAC 2CY1A 3C5EA 1XRCA 1PG4A 1MD9A 3OTOC 1XRBA 4DV0C 1P4EA 4OXIA 2ASBA 4LE5A 4DR3C 1RG9A 4DV2C 2YX1A 5BUQA 3CJEA 4LF8C 1AMUA 2UXDC 3CW9A 3FCCA 3KXWA 5LMUC 2P2QA 1FLOA 3R44A 2VQEC 5A2QD 2UUCC 2E0GA 3VNSA 2QVZX 4WS9A 2DYJA 3CW8X 2ATWA 4D4IA 2P02A 4DV4C 1USPA 4JI4C 4MTNA 1KKGA 5AE1A 1QM4A 3K6RA 2NCLA 4NXNC 2D1SA 4FTFA 2E7GA 2P20A 3B7WA 1N32C 4DV7C 3H2TA 1WCJA 3TQIA 4ODJA 4PZPA 2M5OA 2VQFC 3I07A 4BC9A 1USPB 1VEHA 2KZFA 1WF3A 5T8SA 1HNXC 4RLQA 1T5DX 2BJOA 1JOSA 2M5HA 4BSZA 1MDFA 3SO4A 4K0BA 4PUIA 4DR1C 4LF9C 5IT9D 5LCIA 2KDNA 2ZZNA 2CXCA 1PU1A 2QVXX 4OYCA 4WV3A 2P2MA 2Z51A 4DG8A 5BSUA 4L4QA 2YWCA 5BSVA 4KTTA 5A19A 4JI2C 5ADZA 4RMNA 4X62C 4RM2A 3JAMD 5GTDA 1ML8A 3DLPX 2DHMA 3NYQA 4FUTA 4G1IA 3O2EA 2ZZMA 2PROA 2QL8A 2E8EA 2P2BA 2WD9A 1MXCA 2JMPA 2BH1X 4RM3A 1YJ7A 3NYRA 3GKUA 3T1HC 1BA3A 3PROC 2MCQA 1HH2P 3A9VA 3TUFA 1PG3A 2UUBC 3EQ6A 5FLXD
chains in the Genus database with same CATH topology
2NCLA 2KZ0A 3O2EA 4PUGA 3TR3A 4PUHA 2KDNA 4PUIA 5LCIA 1XS3A 2DHMA 2MM9A 2MMAB 1NY8A 1V60A 2MCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCL A;  2KZ0 A;  3O2E A;  4PUG A;  3TR3 A;  4PUH A;  2KDN A;  4PUI A;  5LCI A;  1XS3 A;  2DHM A;  2MM9 A;  2MMA B;  1NY8 A;  1V60 A;  2MCQ A; 
#chains in the Genus database with same CATH topology
 4B3M C;  1V25 A;  1IBM C;  2OO4 A;  3RV2 A;  2D1R A;  1GPM A;  1XMO C;  2QVY X;  4K0K C;  1TH5 A;  1UWD A;  3UEB A;  4DR7 C;  2WP0 C;  2XR1 A;  2Y4N A;  4B3T C;  4R1L A;  3LAX A;  2VZE A;  2UUA C;  4ISB A;  2P2F A;  3A25 A;  1MXB A;  5A1G A;  1V26 A;  5K8F A;  5A1I A;  1ZB8 A;  1HNW C;  2YCB A;  3IPL A;  3UOW A;  1FUG A;  2MM9 A;  4TPS B;  1XNR C;  3TDE A;  2V7B A;  4EAT A;  4JI6 C;  5BUS A;  4NXM C;  2D7V A;  3FCE A;  1WH9 A;  4GXQ A;  4DCS A;  1K0R A;  1L2F A;  3LUS A;  1P4E C;  3L95 X;  2P2J A;  4LFC C;  5DV9 A;  3E7X A;  1M6X A;  1J5E C;  3TR3 A;  3GPC A;  2QW0 X;  3J81 D;  4IZ6 A;  3E7W A;  3T1Y C;  3I08 A;  4LF6 C;  4DV1 C;  5K85 A;  3CQ3 A;  3NPD A;  1XMQ C;  4DCV A;  1IB8 A;  4G37 A;  4JYA C;  3CQ2 A;  1N36 C;  3A9U A;  3UZ0 A;  4MH4 A;  4L7I A;  3VNQ A;  4RLF A;  5CZX A;  5H9U A;  2OPL B;  4JI8 C;  2DPL A;  2EGT A;  4YY3 C;  3IML A;  3CQ1 A;  4D56 A;  3UX2 A;  3DHV A;  4LF5 C;  4BCA A;  4JM1 A;  2ZM6 C;  1XHJ A;  3PBK A;  3AY0 A;  1V60 A;  1M6X C;  4KHP C;  1IBK C;  4PUH A;  4NDN A;  4LF7 C;  3NI2 A;  3RG2 A;  4HPV A;  4AQY C;  1IBL C;  1O9T A;  4B3S C;  3AF6 A;  2D1Q A;  2UXB C;  4R1M A;  1EGA A;  3N54 B;  2E8F A;  3G7S A;  1N2F A;  5BR8 C;  1O92 A;  4JI3 C;  1MDB A;  4FUQ A;  3UX3 A;  1N33 C;  4D57 A;  4JI1 C;  2PN2 A;  5IFI A;  4OX9 C;  2HHH C;  2Y4O A;  5E7Q A;  2CU6 A;  2Y27 A;  1XNQ C;  4JI7 C;  1P7L A;  4D4G A;  3GR0 A;  4DR2 C;  4LF4 C;  2ONF A;  5KEI A;  1VLA A;  2D1T A;  2UU9 C;  3S82 A;  3ETO A;  3A4I A;  4GXR A;  5BSW A;  2AYA A;  3J80 D;  2KZ0 A;  2HJG A;  4DUZ C;  2UXC C;  1NYE A;  3LNO A;  3EER A;  4BBY A;  4DG9 A;  1MKY A;  4RVO A;  4GS5 A;  4I9G A;  4PRO C;  1NY8 A;  2D27 A;  5BSR A;  1HNZ C;  4DR6 C;  3L8C A;  5KYT A;  4X64 C;  4R0M A;  4ZJZ A;  2E5L C;  3IEV A;  5T8T A;  1RY2 A;  1O93 A;  4NOZ A;  5LMN C;  5BUR A;  2MMA B;  3IEU A;  2F4V C;  1FJG C;  4RVN A;  4B3R C;  1XS3 A;  4DR4 C;  2OPL A;  4JV5 C;  3N2Q A;  4DCU A;  5KYV A;  1I94 C;  4IR7 A;  2PT7 G;  3R9X A;  3AF5 A;  2YWB A;  1N34 C;  4DCT A;  5CZV A;  1T5H X;  3VNR A;  2OBV A;  4XX2 A;  4GKK C;  5IWA C;  1O90 A;  3ETC A;  4DV6 C;  4U5Y D;  1LCI A;  3LGX A;  4PHT A;  4X66 C;  1LQL A;  4DV5 C;  3GR1 A;  3LNV A;  4JI0 C;  3PES A;  4YHH C;  5BST A;  3A26 A;  1ZB9 A;  1QWI A;  4GKJ C;  4ZLP A;  2VSQ A;  4PUG A;  4G36 A;  5AE2 A;  4DUY C;  4BC7 A;  2JNV A;  1ULT A;  4KTV A;  1PA4 A;  5BSM A;  5AE3 A;  4L2Z A;  4DR5 C;  4JI5 C;  1HR0 C;  4LFB C;  1XRA A;  3DAY A;  4I9F A;  5JRH A;  4DV3 C;  2D28 C;  2E8C A;  3R9W A;  1UKK A;  1MXA A;  4X65 C;  4LFA C;  2CY1 A;  3C5E A;  1XRC A;  1PG4 A;  1MD9 A;  3OTO C;  1XRB A;  4DV0 C;  1P4E A;  4OXI A;  2ASB A;  4LE5 A;  4DR3 C;  1RG9 A;  4DV2 C;  2YX1 A;  5BUQ A;  3CJE A;  4LF8 C;  1AMU A;  2UXD C;  3CW9 A;  3FCC A;  3KXW A;  5LMU C;  2P2Q A;  1FLO A;  3R44 A;  2VQE C;  5A2Q D;  2UUC C;  2E0G A;  3VNS A;  2QVZ X;  4WS9 A;  2DYJ A;  3CW8 X;  2ATW A;  4D4I A;  2P02 A;  4DV4 C;  1USP A;  4JI4 C;  4MTN A;  1KKG A;  5AE1 A;  1QM4 A;  3K6R A;  2NCL A;  4NXN C;  2D1S A;  4FTF A;  2E7G A;  2P20 A;  3B7W A;  1N32 C;  4DV7 C;  3H2T A;  1WCJ A;  3TQI A;  4ODJ A;  4PZP A;  2M5O A;  2VQF C;  3I07 A;  4BC9 A;  1USP B;  1VEH A;  2KZF A;  1WF3 A;  5T8S A;  1HNX C;  4RLQ A;  1T5D X;  2BJO A;  1JOS A;  2M5H A;  4BSZ A;  1MDF A;  3SO4 A;  4K0B A;  4PUI A;  4DR1 C;  4LF9 C;  5IT9 D;  5LCI A;  2KDN A;  2ZZN A;  2CXC A;  1PU1 A;  2QVX X;  4OYC A;  4WV3 A;  2P2M A;  2Z51 A;  4DG8 A;  5BSU A;  4L4Q A;  2YWC A;  5BSV A;  4KTT A;  5A19 A;  4JI2 C;  5ADZ A;  4RMN A;  4X62 C;  4RM2 A;  3JAM D;  5GTD A;  1ML8 A;  3DLP X;  2DHM A;  3NYQ A;  4FUT A;  4G1I A;  3O2E A;  2ZZM A;  2PRO A;  2QL8 A;  2E8E A;  2P2B A;  2WD9 A;  1MXC A;  2JMP A;  2BH1 X;  4RM3 A;  1YJ7 A;  3NYR A;  3GKU A;  3T1H C;  1BA3 A;  3PRO C;  2MCQ A;  1HH2 P;  3A9V A;  3TUF A;  1PG3 A;  2UUB C;  3EQ6 A;  5FLX D; 
#chains in the Genus database with same CATH homology
 2NCL A;  2KZ0 A;  3O2E A;  4PUG A;  3TR3 A;  4PUH A;  2KDN A;  4PUI A;  5LCI A;  1XS3 A;  2DHM A;  2MM9 A;  2MMA B;  1NY8 A;  1V60 A;  2MCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...