4PUIA

Bola domain of sufe1 from arabidopsis thaliana
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
85
Chain Sequence
ALGSRGMRIREKLEKELDPVELEVEDVSYQHADDGETHFNLRIVSDAFQGKSLVKRHRLIYDLLQDELKSGLHALSIVAKTPAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SufE-like protein, chloroplastic
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 30
structure length 85
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 4puiA01
2NCLA 2KDNA 4PUHA 2MMAB 4PUGA 2MCQA 2KZ0A 4PUIA 1NY8A 2DHMA 5LCIA 3TR3A 1XS3A 2MM9A 3O2EA 1V60A
chains in the Genus database with same CATH superfamily
2VSQA 1MXCA 2D7VA 3LNOA 2D1RA 2ASBA 4X66C 3I07A 4RMNA 2Y4NA 4YY3C 3NYQA 3A26A 5BUSA 3FCCA 4X64C 1L2FA 3AF6A 4ISBA 3DAYA 4DUZC 2P2JA 1N33C 3UOWA 1J5EC 3A25A 4NOZA 5BSTA 1KKGA 1N34C 3AF5A 4U5YD 5IFIA 4JI5C 2E8CA 4LF7C 4LFCC 2P2BA 4G37A 4R0MA 3T1HC 4LF9C 4LE5A 4JI6C 4DR6C 3CQ2A 4JYAC 5BSWA 3GR1A 4DCVA 1N32C 2MMAB 1P7LA 1V26A 3NPDA 4D4IA 1P4EC 2QVZX 2OO4A 1MXBA 1QWIA 2KDNA 1BA3A 3IMLA 5LMUC 4DCTA 4AQYC 2QL8A 4JI0C 4DCUA 4GKJC 1FJGC 2D1TA 1IBMC 1O90A 4KTTA 1MXAA 3C5EA 1P4EA 1XRBA 4NXNC 4G1IA 1M6XC 2EGTA 1T5DX 4DV4C 5DV9A 2UU9C 2CU6A 3CW8X 5BSRA 4DV7C 4D56A 4GXRA 3I08A 4RM2A 4DCSA 5BR8C 5BUQA 5A2QD 4PZPA 2OPLA 3J80D 4WS9A 3IPLA 3PROC 2AYAA 4L7IA 4EATA 4OYCA 4RVNA 4XX2A 3UX3A 4HPVA 2QW0X 2WD9A 1MDFA 3VNRA 3UEBA 5GTDA 1JOSA 4RLQA 4NDNA 2F4VC 5BSMA 3N54B 1O9TA 3TR3A 3DHVA 1USPB 3A4IA 4FUTA 4I9FA 5IWAC 2M5OA 2DHMA 3PESA 2BJOA 3JAMD 4LF8C 3S82A 1WF3A 2OBVA 4K0BA 5A19A 4ZLPA 3NI2A 2V7BA 1RG9A 1O92A 2HJGA 2E0GA 4DV5C 3IEVA 2Z51A 3UZ0A 4YHHC 2D28C 2DPLA 2NCLA 3A9VA 2MCQA 2UXBC 2E5LC 3UX2A 1IBKC 2YX1A 1MD9A 2KZ0A 1I94C 2QVYX 2D1QA 2E8EA 4TPSB 3LUSA 1FUGA 4ODJA 4X65C 3TQIA 1WCJA 4IR7A 5AE3A 5FLXD 3CQ3A 1XMQC 4PROC 2VQFC 1HNWC 4JI4C 1XS3A 2D27A 2CY1A 1IBLC 4LF6C 4DR5C 1XRCA 1PG4A 2ZZMA 4DR4C 1NYEA 2VQEC 3N2QA 3RG2A 2KZFA 1XRAA 3LNVA 4PHTA 5JRHA 4JI7C 4BCAA 3CW9A 1N2FA 2E7GA 4BSZA 2BH1X 3NYRA 4LFAC 3GKUA 5CZXA 4KTVA 1XNQC 3E7WA 3LGXA 4OX9C 4PUIA 1AMUA 2P2QA 5E7QA 1N36C 1PA4A 1ML8A 1V25A 4B3TC 3CJEA 1T5HX 1ZB9A 2JMPA 1HR0C 4MTNA 5KYTA 1RY2A 2YWCA 3OTOC 1LQLA 3R9XA 4LF5C 1HNZC 2M5HA 4PUHA 4DR2C 1PU1A 5KYVA 4DV2C 2UXDC 3SO4A 2UXCC 3TUFA 2PT7G 3VNSA 2UUBC 4DUYC 4DR7C 4LFBC 1XMOC 3L95X 5IT9D 1UWDA 2WP0C 1WH9A 2ZM6C 3E7XA 4DV0C 2E8FA 3O2EA 1MKYA 4BC9A 1PG3A 1TH5A 1ULTA 2P2MA 4IZ6A 3IEUA 2UUCC 3R9WA 4KHPC 4B3SC 3LAXA 5LCIA 1K0RA 2D1SA 4FTFA 5T8TA 3G7SA 3KXWA 5ADZA 2PN2A 3T1YC 4G36A 4GS5A 4ZJZA 2QVXX 4R1LA 5H9UA 4B3MC 3A9UA 1ZB8A 3PBKA 1MDBA 4JI8C 4X62C 2XR1A 5BSVA 2HHHC 4BBYA 2ZZNA 3K6RA 3B7WA 4JI3C 4OXIA 2P02A 4JM1A 4WV3A 5K8FA 1HNXC 4DR1C 1HH2P 4RM3A 4NXMC 2PROA 1USPA 4DV3C 1VEHA 1XNRC 1NY8A 1QM4A 4L4QA 4RVOA 3H2TA 5K85A 4D4GA 2OPLB 3RV2A 5AE1A 2Y4OA 1UKKA 2VZEA 1FLOA 3ETOA 1EGAA 3VNQA 1O93A 2YCBA 2P2FA 5KEIA 2YWBA 3ETCA 5CZVA 4DV1C 1LCIA 4R1MA 5AE2A 1XHJA 4DV6C 3EERA 1YJ7A 4DG9A 2CXCA 3EQ6A 4BC7A 4GKKC 4LF4C 1VLAA 4FUQA 3DLPX 5BSUA 4K0KC 2JNVA 1IB8A 3TDEA 3GR0A 4I9GA 4RLFA 4L2ZA 3L8CA 3AY0A 1GPMA 3GPCA 4GXQA 5A1GA 4JI2C 2UUAC 5BURA 4B3RC 2ONFA 1V60A 2ATWA 3J81D 4PUGA 1M6XA 4JI1C 4JV5C 5LMNC 2Y27A 3FCEA 4D57A 3CQ1A 5A1IA 4DR3C 5T8SA 3R44A 4MH4A 2P20A 2DYJA 2MM9A 4DG8A
chains in the Genus database with same CATH topology
2NCLA 2KDNA 4PUHA 2MMAB 4PUGA 2MCQA 2KZ0A 4PUIA 1NY8A 2DHMA 5LCIA 3TR3A 1XS3A 2MM9A 3O2EA 1V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCL A;  2KDN A;  4PUH A;  2MMA B;  4PUG A;  2MCQ A;  2KZ0 A;  4PUI A;  1NY8 A;  2DHM A;  5LCI A;  3TR3 A;  1XS3 A;  2MM9 A;  3O2E A;  1V60 A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  1MXC A;  2D7V A;  3LNO A;  2D1R A;  2ASB A;  4X66 C;  3I07 A;  4RMN A;  2Y4N A;  4YY3 C;  3NYQ A;  3A26 A;  5BUS A;  3FCC A;  4X64 C;  1L2F A;  3AF6 A;  4ISB A;  3DAY A;  4DUZ C;  2P2J A;  1N33 C;  3UOW A;  1J5E C;  3A25 A;  4NOZ A;  5BST A;  1KKG A;  1N34 C;  3AF5 A;  4U5Y D;  5IFI A;  4JI5 C;  2E8C A;  4LF7 C;  4LFC C;  2P2B A;  4G37 A;  4R0M A;  3T1H C;  4LF9 C;  4LE5 A;  4JI6 C;  4DR6 C;  3CQ2 A;  4JYA C;  5BSW A;  3GR1 A;  4DCV A;  1N32 C;  2MMA B;  1P7L A;  1V26 A;  3NPD A;  4D4I A;  1P4E C;  2QVZ X;  2OO4 A;  1MXB A;  1QWI A;  2KDN A;  1BA3 A;  3IML A;  5LMU C;  4DCT A;  4AQY C;  2QL8 A;  4JI0 C;  4DCU A;  4GKJ C;  1FJG C;  2D1T A;  1IBM C;  1O90 A;  4KTT A;  1MXA A;  3C5E A;  1P4E A;  1XRB A;  4NXN C;  4G1I A;  1M6X C;  2EGT A;  1T5D X;  4DV4 C;  5DV9 A;  2UU9 C;  2CU6 A;  3CW8 X;  5BSR A;  4DV7 C;  4D56 A;  4GXR A;  3I08 A;  4RM2 A;  4DCS A;  5BR8 C;  5BUQ A;  5A2Q D;  4PZP A;  2OPL A;  3J80 D;  4WS9 A;  3IPL A;  3PRO C;  2AYA A;  4L7I A;  4EAT A;  4OYC A;  4RVN A;  4XX2 A;  3UX3 A;  4HPV A;  2QW0 X;  2WD9 A;  1MDF A;  3VNR A;  3UEB A;  5GTD A;  1JOS A;  4RLQ A;  4NDN A;  2F4V C;  5BSM A;  3N54 B;  1O9T A;  3TR3 A;  3DHV A;  1USP B;  3A4I A;  4FUT A;  4I9F A;  5IWA C;  2M5O A;  2DHM A;  3PES A;  2BJO A;  3JAM D;  4LF8 C;  3S82 A;  1WF3 A;  2OBV A;  4K0B A;  5A19 A;  4ZLP A;  3NI2 A;  2V7B A;  1RG9 A;  1O92 A;  2HJG A;  2E0G A;  4DV5 C;  3IEV A;  2Z51 A;  3UZ0 A;  4YHH C;  2D28 C;  2DPL A;  2NCL A;  3A9V A;  2MCQ A;  2UXB C;  2E5L C;  3UX2 A;  1IBK C;  2YX1 A;  1MD9 A;  2KZ0 A;  1I94 C;  2QVY X;  2D1Q A;  2E8E A;  4TPS B;  3LUS A;  1FUG A;  4ODJ A;  4X65 C;  3TQI A;  1WCJ A;  4IR7 A;  5AE3 A;  5FLX D;  3CQ3 A;  1XMQ C;  4PRO C;  2VQF C;  1HNW C;  4JI4 C;  1XS3 A;  2D27 A;  2CY1 A;  1IBL C;  4LF6 C;  4DR5 C;  1XRC A;  1PG4 A;  2ZZM A;  4DR4 C;  1NYE A;  2VQE C;  3N2Q A;  3RG2 A;  2KZF A;  1XRA A;  3LNV A;  4PHT A;  5JRH A;  4JI7 C;  4BCA A;  3CW9 A;  1N2F A;  2E7G A;  4BSZ A;  2BH1 X;  3NYR A;  4LFA C;  3GKU A;  5CZX A;  4KTV A;  1XNQ C;  3E7W A;  3LGX A;  4OX9 C;  4PUI A;  1AMU A;  2P2Q A;  5E7Q A;  1N36 C;  1PA4 A;  1ML8 A;  1V25 A;  4B3T C;  3CJE A;  1T5H X;  1ZB9 A;  2JMP A;  1HR0 C;  4MTN A;  5KYT A;  1RY2 A;  2YWC A;  3OTO C;  1LQL A;  3R9X A;  4LF5 C;  1HNZ C;  2M5H A;  4PUH A;  4DR2 C;  1PU1 A;  5KYV A;  4DV2 C;  2UXD C;  3SO4 A;  2UXC C;  3TUF A;  2PT7 G;  3VNS A;  2UUB C;  4DUY C;  4DR7 C;  4LFB C;  1XMO C;  3L95 X;  5IT9 D;  1UWD A;  2WP0 C;  1WH9 A;  2ZM6 C;  3E7X A;  4DV0 C;  2E8F A;  3O2E A;  1MKY A;  4BC9 A;  1PG3 A;  1TH5 A;  1ULT A;  2P2M A;  4IZ6 A;  3IEU A;  2UUC C;  3R9W A;  4KHP C;  4B3S C;  3LAX A;  5LCI A;  1K0R A;  2D1S A;  4FTF A;  5T8T A;  3G7S A;  3KXW A;  5ADZ A;  2PN2 A;  3T1Y C;  4G36 A;  4GS5 A;  4ZJZ A;  2QVX X;  4R1L A;  5H9U A;  4B3M C;  3A9U A;  1ZB8 A;  3PBK A;  1MDB A;  4JI8 C;  4X62 C;  2XR1 A;  5BSV A;  2HHH C;  4BBY A;  2ZZN A;  3K6R A;  3B7W A;  4JI3 C;  4OXI A;  2P02 A;  4JM1 A;  4WV3 A;  5K8F A;  1HNX C;  4DR1 C;  1HH2 P;  4RM3 A;  4NXM C;  2PRO A;  1USP A;  4DV3 C;  1VEH A;  1XNR C;  1NY8 A;  1QM4 A;  4L4Q A;  4RVO A;  3H2T A;  5K85 A;  4D4G A;  2OPL B;  3RV2 A;  5AE1 A;  2Y4O A;  1UKK A;  2VZE A;  1FLO A;  3ETO A;  1EGA A;  3VNQ A;  1O93 A;  2YCB A;  2P2F A;  5KEI A;  2YWB A;  3ETC A;  5CZV A;  4DV1 C;  1LCI A;  4R1M A;  5AE2 A;  1XHJ A;  4DV6 C;  3EER A;  1YJ7 A;  4DG9 A;  2CXC A;  3EQ6 A;  4BC7 A;  4GKK C;  4LF4 C;  1VLA A;  4FUQ A;  3DLP X;  5BSU A;  4K0K C;  2JNV A;  1IB8 A;  3TDE A;  3GR0 A;  4I9G A;  4RLF A;  4L2Z A;  3L8C A;  3AY0 A;  1GPM A;  3GPC A;  4GXQ A;  5A1G A;  4JI2 C;  2UUA C;  5BUR A;  4B3R C;  2ONF A;  1V60 A;  2ATW A;  3J81 D;  4PUG A;  1M6X A;  4JI1 C;  4JV5 C;  5LMN C;  2Y27 A;  3FCE A;  4D57 A;  3CQ1 A;  5A1I A;  4DR3 C;  5T8S A;  3R44 A;  4MH4 A;  2P20 A;  2DYJ A;  2MM9 A;  4DG8 A; 
#chains in the Genus database with same CATH homology
 2NCL A;  2KDN A;  4PUH A;  2MMA B;  4PUG A;  2MCQ A;  2KZ0 A;  4PUI A;  1NY8 A;  2DHM A;  5LCI A;  3TR3 A;  1XS3 A;  2MM9 A;  3O2E A;  1V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...