4PUIA

Bola domain of sufe1 from arabidopsis thaliana
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
95
structure length
85
Chain Sequence
ALGSRGMRIREKLEKELDPVELEVEDVSYQHADDGETHFNLRIVSDAFQGKSLVKRHRLIYDLLQDELKSGLHALSIVAKTPAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords SufE-like protein, chloroplastic
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 30
structure length 85
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 4puiA01
2MM9A 2DHMA 2MCQA 3O2EA 1NY8A 2KZ0A 5LCIA 1V60A 2MMAB 3TR3A 4PUIA 1XS3A 4PUHA 2KDNA 4PUGA 2NCLA
chains in the Genus database with same CATH superfamily
3G7SA 5AE1A 1N32C 3C5EA 4LF7C 3NYRA 4OX9C 1PA4A 3AF6A 1FJGC 2Y4NA 4DUYC 4DG9A 4JV5C 3R9XA 1MXBA 3NI2A 2VQFC 2AYAA 4X66C 4DR1C 4DR6C 4X64C 1K0RA 4XX2A 4D4GA 4DCTA 2Z51A 4JI8C 4RM2A 4GXQA 4LF9C 1XRBA 3GR0A 4YY3C 4DR4C 4DV0C 4PROC 1QWIA 1MD9A 4LF5C 1ZB8A 3CW8X 4PUIA 2OO4A 4D57A 2QVYX 2DPLA 1UWDA 4G1IA 3UX2A 2YX1A 1T5HX 2P2FA 3RV2A 2NCLA 2E8CA 2P2JA 4I9GA 4DCVA 2WD9A 1FUGA 4GS5A 2UU9C 2MCQA 3FCCA 3FCEA 1HR0C 3PBKA 4DV6C 5IT9D 3TUFA 1V60A 2YWBA 3J80D 3LUSA 3EERA 2PN2A 5BSVA 3UZ0A 1ML8A 1XMQC 3VNQA 4ZLPA 4ZJZA 4DR5C 5FLXD 2D1RA 4BBYA 5AE2A 4OXIA 4R1MA 3I08A 3J81D 3A25A 3PESA 2P2QA 1NY8A 1T5DX 4FUTA 4DUZC 1MDBA 2JNVA 2PROA 2KZFA 5AE3A 1MDFA 4BC9A 2PT7G 5BSMA 3S82A 3N54B 4RLQA 4ODJA 2VQEC 5T8SA 4DV4C 4OYCA 4DV7C 4MTNA 4PZPA 1PG3A 5GTDA 3R44A 4B3SC 3DAYA 3UOWA 3CQ2A 1O9TA 4JI4C 3T1YC 1V25A 4GXRA 3E7XA 4U5YD 4RVNA 2P2MA 4MH4A 4BC7A 4LE5A 4K0BA 3TDEA 3B7WA 3UX3A 5BSTA 4ISBA 1O93A 3IEVA 4BSZA 1QM4A 1YJ7A 3TQIA 5LMNC 5BUSA 1N2FA 3ETOA 3NPDA 4DV1C 4LF4C 1XMOC 4X62C 1XRAA 2CU6A 1HH2P 4DR7C 2E0GA 3LNOA 3O2EA 2E5LC 2VZEA 5CZVA 4NXNC 4K0KC 2D27A 2V7BA 2JMPA 1J5EC 4LF8C 2QVXX 1JOSA 2P02A 2MM9A 5BSWA 1MKYA 2HJGA 2E7GA 4G37A 2KDNA 1M6XC 4JI6C 2UXDC 5A2QD 4L7IA 4L2ZA 5ADZA 4LFBC 2D1TA 2OPLB 1MXAA 4JI5C 4R1LA 4IZ6A 4BCAA 1KKGA 3L95X 2UXCC 2Y4OA 2ONFA 1I94C 4KTVA 1IB8A 1L2FA 4G36A 4JM1A 1WCJA 2UXBC 3TR3A 2D1SA 5BSRA 3I07A 4GKJC 2F4VC 2D1QA 1O92A 1LCIA 3IPLA 1USPB 2BJOA 4R0MA 1NYEA 4L4QA 5K85A 4FUQA 2DHMA 5A1GA 1WF3A 4KHPC 5A19A 3GPCA 4DG8A 5LCIA 2ATWA 1LQLA 4D4IA 3A26A 2WP0C 3RG2A 1IBKC 5BURA 2YCBA 1XNQC 3AY0A 2ZZMA 4RLFA 4DCSA 4WS9A 1V26A 2ASBA 4AQYC 3OTOC 3EQ6A 2QL8A 4WV3A 4JI3C 4IR7A 4PHTA 1RG9A 4LF6C 1VLAA 4NOZA 4I9FA 1IBLC 1N36C 5IFIA 5KEIA 3SO4A 3NYQA 3VNRA 2M5OA 1MXCA 1HNWC 4JI7C 4HPVA 2QVZX 2VSQA 5JRHA 5CZXA 4NDNA 4X65C 3A9VA 1ZB9A 5H9UA 4FTFA 2MMAB 4EATA 4D56A 1HNXC 3LNVA 5DV9A 2XR1A 2KZ0A 3CQ3A 3AF5A 3ETCA 2P20A 4RMNA 2UUAC 4DV2C 3GKUA 3A4IA 1P4EA 1N33C 1TH5A 1O90A 3N2QA 4DCUA 2OPLA 3R9WA 1PU1A 4YHHC 2ZM6C 5E7QA 3VNSA 3K6RA 1N34C 1HNZC 5BR8C 3PROC 2EGTA 3JAMD 4DR3C 3L8CA 5KYVA 1AMUA 2E8EA 4B3MC 3DHVA 4PUHA 3CJEA 1USPA 3A9UA 3IEUA 4B3TC 1RY2A 1P7LA 2YWCA 4JYAC 2ZZNA 4DV5C 3LAXA 1PG4A 2UUCC 2QW0X 2DYJA 3LGXA 4DR2C 5BUQA 4JI2C 4B3RC 4NXMC 4KTTA 3T1HC 3DLPX 1VEHA 2D28C 2UUBC 1WH9A 4DV3C 2P2BA 1P4EC 3KXWA 1XHJA 2D7VA 2HHHC 3GR1A 4RVOA 5K8FA 4RM3A 4JI1C 5LMUC 1XS3A 4PUGA 3IMLA 1FLOA 2BH1X 5A1IA 3CQ1A 2CXCA 4LFCC 4GKKC 3H2TA 4LFAC 3CW9A 5IWAC 5T8TA 2M5HA 4TPSB 1IBMC 1M6XA 2E8FA 1UKKA 1EGAA 2Y27A 1GPMA 1XNRC 1BA3A 1ULTA 1XRCA 2OBVA 5KYTA 4JI0C 3UEBA 3E7WA 5BSUA 2CY1A
chains in the Genus database with same CATH topology
2MM9A 2DHMA 2MCQA 3O2EA 1NY8A 2KZ0A 5LCIA 1V60A 2MMAB 3TR3A 4PUIA 1XS3A 4PUHA 2KDNA 4PUGA 2NCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM9 A;  2DHM A;  2MCQ A;  3O2E A;  1NY8 A;  2KZ0 A;  5LCI A;  1V60 A;  2MMA B;  3TR3 A;  4PUI A;  1XS3 A;  4PUH A;  2KDN A;  4PUG A;  2NCL A; 
#chains in the Genus database with same CATH topology
 3G7S A;  5AE1 A;  1N32 C;  3C5E A;  4LF7 C;  3NYR A;  4OX9 C;  1PA4 A;  3AF6 A;  1FJG C;  2Y4N A;  4DUY C;  4DG9 A;  4JV5 C;  3R9X A;  1MXB A;  3NI2 A;  2VQF C;  2AYA A;  4X66 C;  4DR1 C;  4DR6 C;  4X64 C;  1K0R A;  4XX2 A;  4D4G A;  4DCT A;  2Z51 A;  4JI8 C;  4RM2 A;  4GXQ A;  4LF9 C;  1XRB A;  3GR0 A;  4YY3 C;  4DR4 C;  4DV0 C;  4PRO C;  1QWI A;  1MD9 A;  4LF5 C;  1ZB8 A;  3CW8 X;  4PUI A;  2OO4 A;  4D57 A;  2QVY X;  2DPL A;  1UWD A;  4G1I A;  3UX2 A;  2YX1 A;  1T5H X;  2P2F A;  3RV2 A;  2NCL A;  2E8C A;  2P2J A;  4I9G A;  4DCV A;  2WD9 A;  1FUG A;  4GS5 A;  2UU9 C;  2MCQ A;  3FCC A;  3FCE A;  1HR0 C;  3PBK A;  4DV6 C;  5IT9 D;  3TUF A;  1V60 A;  2YWB A;  3J80 D;  3LUS A;  3EER A;  2PN2 A;  5BSV A;  3UZ0 A;  1ML8 A;  1XMQ C;  3VNQ A;  4ZLP A;  4ZJZ A;  4DR5 C;  5FLX D;  2D1R A;  4BBY A;  5AE2 A;  4OXI A;  4R1M A;  3I08 A;  3J81 D;  3A25 A;  3PES A;  2P2Q A;  1NY8 A;  1T5D X;  4FUT A;  4DUZ C;  1MDB A;  2JNV A;  2PRO A;  2KZF A;  5AE3 A;  1MDF A;  4BC9 A;  2PT7 G;  5BSM A;  3S82 A;  3N54 B;  4RLQ A;  4ODJ A;  2VQE C;  5T8S A;  4DV4 C;  4OYC A;  4DV7 C;  4MTN A;  4PZP A;  1PG3 A;  5GTD A;  3R44 A;  4B3S C;  3DAY A;  3UOW A;  3CQ2 A;  1O9T A;  4JI4 C;  3T1Y C;  1V25 A;  4GXR A;  3E7X A;  4U5Y D;  4RVN A;  2P2M A;  4MH4 A;  4BC7 A;  4LE5 A;  4K0B A;  3TDE A;  3B7W A;  3UX3 A;  5BST A;  4ISB A;  1O93 A;  3IEV A;  4BSZ A;  1QM4 A;  1YJ7 A;  3TQI A;  5LMN C;  5BUS A;  1N2F A;  3ETO A;  3NPD A;  4DV1 C;  4LF4 C;  1XMO C;  4X62 C;  1XRA A;  2CU6 A;  1HH2 P;  4DR7 C;  2E0G A;  3LNO A;  3O2E A;  2E5L C;  2VZE A;  5CZV A;  4NXN C;  4K0K C;  2D27 A;  2V7B A;  2JMP A;  1J5E C;  4LF8 C;  2QVX X;  1JOS A;  2P02 A;  2MM9 A;  5BSW A;  1MKY A;  2HJG A;  2E7G A;  4G37 A;  2KDN A;  1M6X C;  4JI6 C;  2UXD C;  5A2Q D;  4L7I A;  4L2Z A;  5ADZ A;  4LFB C;  2D1T A;  2OPL B;  1MXA A;  4JI5 C;  4R1L A;  4IZ6 A;  4BCA A;  1KKG A;  3L95 X;  2UXC C;  2Y4O A;  2ONF A;  1I94 C;  4KTV A;  1IB8 A;  1L2F A;  4G36 A;  4JM1 A;  1WCJ A;  2UXB C;  3TR3 A;  2D1S A;  5BSR A;  3I07 A;  4GKJ C;  2F4V C;  2D1Q A;  1O92 A;  1LCI A;  3IPL A;  1USP B;  2BJO A;  4R0M A;  1NYE A;  4L4Q A;  5K85 A;  4FUQ A;  2DHM A;  5A1G A;  1WF3 A;  4KHP C;  5A19 A;  3GPC A;  4DG8 A;  5LCI A;  2ATW A;  1LQL A;  4D4I A;  3A26 A;  2WP0 C;  3RG2 A;  1IBK C;  5BUR A;  2YCB A;  1XNQ C;  3AY0 A;  2ZZM A;  4RLF A;  4DCS A;  4WS9 A;  1V26 A;  2ASB A;  4AQY C;  3OTO C;  3EQ6 A;  2QL8 A;  4WV3 A;  4JI3 C;  4IR7 A;  4PHT A;  1RG9 A;  4LF6 C;  1VLA A;  4NOZ A;  4I9F A;  1IBL C;  1N36 C;  5IFI A;  5KEI A;  3SO4 A;  3NYQ A;  3VNR A;  2M5O A;  1MXC A;  1HNW C;  4JI7 C;  4HPV A;  2QVZ X;  2VSQ A;  5JRH A;  5CZX A;  4NDN A;  4X65 C;  3A9V A;  1ZB9 A;  5H9U A;  4FTF A;  2MMA B;  4EAT A;  4D56 A;  1HNX C;  3LNV A;  5DV9 A;  2XR1 A;  2KZ0 A;  3CQ3 A;  3AF5 A;  3ETC A;  2P20 A;  4RMN A;  2UUA C;  4DV2 C;  3GKU A;  3A4I A;  1P4E A;  1N33 C;  1TH5 A;  1O90 A;  3N2Q A;  4DCU A;  2OPL A;  3R9W A;  1PU1 A;  4YHH C;  2ZM6 C;  5E7Q A;  3VNS A;  3K6R A;  1N34 C;  1HNZ C;  5BR8 C;  3PRO C;  2EGT A;  3JAM D;  4DR3 C;  3L8C A;  5KYV A;  1AMU A;  2E8E A;  4B3M C;  3DHV A;  4PUH A;  3CJE A;  1USP A;  3A9U A;  3IEU A;  4B3T C;  1RY2 A;  1P7L A;  2YWC A;  4JYA C;  2ZZN A;  4DV5 C;  3LAX A;  1PG4 A;  2UUC C;  2QW0 X;  2DYJ A;  3LGX A;  4DR2 C;  5BUQ A;  4JI2 C;  4B3R C;  4NXM C;  4KTT A;  3T1H C;  3DLP X;  1VEH A;  2D28 C;  2UUB C;  1WH9 A;  4DV3 C;  2P2B A;  1P4E C;  3KXW A;  1XHJ A;  2D7V A;  2HHH C;  3GR1 A;  4RVO A;  5K8F A;  4RM3 A;  4JI1 C;  5LMU C;  1XS3 A;  4PUG A;  3IML A;  1FLO A;  2BH1 X;  5A1I A;  3CQ1 A;  2CXC A;  4LFC C;  4GKK C;  3H2T A;  4LFA C;  3CW9 A;  5IWA C;  5T8T A;  2M5H A;  4TPS B;  1IBM C;  1M6X A;  2E8F A;  1UKK A;  1EGA A;  2Y27 A;  1GPM A;  1XNR C;  1BA3 A;  1ULT A;  1XRC A;  2OBV A;  5KYT A;  4JI0 C;  3UEB A;  3E7W A;  5BSU A;  2CY1 A; 
#chains in the Genus database with same CATH homology
 2MM9 A;  2DHM A;  2MCQ A;  3O2E A;  1NY8 A;  2KZ0 A;  5LCI A;  1V60 A;  2MMA B;  3TR3 A;  4PUI A;  1XS3 A;  4PUH A;  2KDN A;  4PUG A;  2NCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...