2Y4NA

Paak1 in complex with phenylacetyl adenylate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
428
structure length
426
Chain Sequence
PLPLEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHENYLACETATE-COENZYME A LIGASE
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
total genus 147
structure length 426
sequence length 428
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y4nA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y4nA01
3O84A 4EATA 5BSRA 1YJ7A 3DLPX 1V26A 4ISBA 4DG8A 4IZ6A 2P2MA 3A9VA 4RM2A 5DV9A 5KEIA 3E7WA 3GPCA 4GS5A 3DAYA 1PG3A 3G7SA 5BSMA 4OYCA 4G36A 3CW9A 3ITEA 3IEPA 4RLFA 5BSVA 4GXQA 2VSQA 3B7WA 3T5CA 3LGXA 5IFIA 5KYTA 4RLQA 2QVXX 3TSYA 4GR5A 4OXIA 3WV5A 3CW8X 5KYVA 3RIXA 3A9UA 3T5AA 4IR7A 4WV3A 3VNRA 2Y4NA 3NYQA 5DWVA 1BA3A 4RM3A 3RG2A 3T5BA 4D4HA 3L8CA 3O82A 4R1MA 4GXRA 5E7QA 2D1RA 2WD9A 2P2BA 4D4IA 4FUQA 3FCEA 3FCCA 3U17A 2Y4OA 3LAXA 4D56A 4R1LA 3LNVA 5D6NA 2D1SA 5BURA 3DHVA 2D1TA 4RVNA 2V7BA 1MDFA 3QYAA 4RMNA 3WV4A 3IVRA 2QVZX 4W8OA 3R44A 5GTDA 5BUQA 3VNSA 5K8FA 5BSTA 3KXWA 1ULTA 3WVNA 2D1QA 1T5HX 3O83A 1MD9A 2Y27A 3VNQA 4ZJZA 3NYRA 3IERA 4FUTA 1RY2A 4D57A 4D4GA 1MDBA 1T5DX 5BSWA 1LCIA 2P2FA 2P20A 1PG4A 4E5DA 3IESA 4U5YD 5JRHA 3C5EA 2QW0X 3E53A 3E7XA 3IPLA 4DG9A 2P2JA 2QVYX 4GR4A 4PZPA 2P2QA 2VZEA 1AMUA 3ETCA 3NI2A 4M46A 4G37A 3EQ6A 5K85A 5BUSA 3PBKA 1V25A 3U16A 4RVOA 4LGCA 5BSUA 4R0MA
chains in the Genus database with same CATH superfamily
2RGUA 2FMTA 3C3KA 3OE7A 3O2QB 4KN5A 5JOQA 2JLWA 4MMZB 5BXQC 4TMVA 4D9BA 3AOEA 3B78A 3G82C 1T13A 3OTWA 1WP4A 4I9FA 4E6EA 5FPYA 3T1TA 3AVVA 2AJDA 4QUBA 1OX5A 1WD5A 3PUJA 1PQUA 4IG4A 5IANA 1VSUA 4I5IA 4JVSB 4LGYA 3NHBA 4RMHA 5IMSA 4KO3S 2XADA 2W42A 4Z7OB 3R7SA 1UBHS 2ZDHA 3P9YA 3IIKA 5JMWA 2JD2A 4B2IA 2ZRIA 4MR7A 4GEGA 4MUKA 1GVHA 2GASA 4I55A 1KERA 2P9EA 5ESRA 5FUMA 3MM4A 1Z5NA 3EQ7A 1G21B 4MPDA 2WTXA 4JAVC 2BE9A 1Y5IA 3HXTA 1JMYA 5JDCC 4EUSA 3A1TA 4MX8A 1RLMA 4J94A 2ZANA 3GVPA 5FNVA 3U7RA 4MK4A 4EG3A 4CHGA 4MROA 1P60A 5EWLA 4NV1A 2FUKA 3R7FA 4BKUA 3G9QA 3SBOA 1NTRA 3IDAA 3JRWA 3OG9A 2JEOA 3PVCA 2FHPA 4DKXA 1NXWA 3EBLA 1GUDA 2WJGA 4TMYA 5H4GA 4CKCA 2LKCA 4UDNA 5FOVA 4DXAA 4HNTA 3ZDBA 5DLEA 4B74A 2QLJA 3NFYA 2DLCX 2G77B 1RPNA 4V0LA 5B58C 1EVEA 2Y93A 3IVAA 1ZGGA 3BBPA 1CR6A 1GO2A 1PD0A 3ME5A 4GBMA 4JP1A 5T4HA 2WFZA 4BTEA 2FP4B 5AK6A 3NHAA 3G23A 1ZW1A 3MUFA 4ARZA 1Z6AA 2O8EA 2XBLA 1KJ8A 3RVJA 3FFBA 3Q8KA 5CCDA 4LYFA 4N3CA 2QTNA 4RVSA 1KNQA 4K7JA 2OBBA 1MV8A 4PFKA 4PBTA 5FUBA 3TKLA 4X8LA 1TKAA 1NE2A 3OHPA 1AJEA 2BFWA 4DIMA 2CFSA 1NGSA 4JQSA 2FZCA 2P9JA 2HDNB 4X7BA 1DKQA 4LXHA 2R25B 4ZQGA 2QZ4A 1BCSA 1KBZA 2QG4A 3U3ZA 4B4UA 4BCAA 3NB0A 5E6RA 2Y1XA 4R83A 1MDFA 1JEDA 1RLUA 7MDHA 5JVDA 4DV0C 1IMJA 3QYFA 3SOPA 4AJJA 2ALJA 4WESB 3ZGVA 1MQSA 1Z29A 1U90A 1Z5VA 4H08A 4NCHA 5C3UA 5TQJA 2IP4A 3BTVA 4EPRA 2NMVA 4XTRA 1KOFA 1GZ4A 1HSZA 3H9EO 3HBFA 2Z3WA 3NHWA 1JVBA 1NXVA 3EPLA 2QRPA 3IR6A 1H2ZA 1J09A 1MD9A 1JMKC 1O54A 1WCIB 2I6FA 1OXUA 1QR6A 1Y5NA 1UINA 2JCVA 3L7LA 4NQZA 4TLMB 4W6ZA 3S29A 1I10A 1L4BA 2CEAA 3E9ZA 4KOEC 2BI8A 3JYLA 2P1RA 4YT5A 4EUEA 5KNDD 3CLRD 3BKWA 3EFOA 3V8NA 3HEAA 3L6EA 4RHYA 3U4QA 3GJYA 4TMTA 1EBBA 2FPXA 1C8BA 1PJSA 3F6YA 1W5FA 3HCNA 1XDSA 4LF5C 4HG2A 2MYUA 1U0NA 2WT9A 4X60A 4R2JA 2FEOA 4YP9A 3ZE2B 4WSOA 2RGWA 3QGMA 5I7HA 1P75A 2FZWA 1JN0A 4JJFA 2JIQA 5K0TA 1KO8A 1Z9BA 4ND3A 4W7HA 3IDZA 4XYEA 3J81D 4BQFA 1MVLA 2D3WA 2V55B 2VWQA 4QHSA 4U7PB 4AMGA 1VCIA 3HACA 4R1UA 5ED4A 3E05A 2WWXA 1OJ7A 4C6RA 3J80D 4CV0A 3SQOA 5T67A 3H99A 1GITA 1ZSNA 2BGKA 1PK7A 4DYHA 5A3RA 1V26A 3A3YA 3G79A 3HYTA 3MTAA 4P3KA 1FJGB 3I37X 1CQPA 1JJ7A 5AVVA 1UJBA 1EE9A 5A9TA 3VZDA 3N2GA 1LTHR 1L5GB 3EY4A 2PKRA 2AD1A 2XUFA 3AFHA 1X8LA 2DHQA 3ZZNA 4O8CA 4B17A 5GVSA 4G5QA 4I7EA 1QGED 3C7CB 4DG5A 1OAAA 5BN1A 1E1CA 4QDJA 1AH2A 3A6HA 2NZYA 3AW8A 1NM5A 1D6JA 3ODPA 4RYLA 1O6BA 2Q3DA 2V7WA 5AVOA 1U8YA 1E1QD 4IVRA 4MJLA 4LJRA 3R9KA 3FNHA 2BH2A 3AR3A 1YFJA 3MQFA 5TB5A 1L8LA 3IOCA 3CR8A 5KJ6A 5B1SA 3SX0A 3VU1A 3IEVA 5LPNA 2BH9A 4LYYA 4N5DA 4UXHA 3RLIA 2VWPA 3VU3A 4KR2A 2R7KA 3K32A 3LTNC 4AL4A 3ZV6A 4JI0B 3WQSB 1GPAA 2AYAA 4ZP1A 3WLOA 2RJOA 4C4OA 4EY7A 5A2GA 5B7GA 5A62A 1RC8A 3KSZO 3WICA 1VHWA 2QL6A 2J4CA 1I01A 4GOOD 1LFDB 4JLBA 4MR7B 1QLWA 2B4TO 4MUYA 2HTFA 1U0SY 4I55B 1UXJA 5I7AA 2EARA 4GKJC 1TCBA 3H19A 2PEZA 1GGJA 1G5FA 3FR8A 1MNAA 3GLHE 4LZPA 2HSEA 3P19A 4PC7A 2R8RA 5CJJA 4HVTA 3FJ1A 3I04A 3GEDA 5FNVB 5F9FA 3SJ7A 5I8WA 4H6PA 1U31A 3OUUA 4ML3A 5EWLB 4RXTA 2YRWA 3IP3A 1Z0IA 4UUPA 4B75A 1WXFA 2PNJA 2FCRA 1DAGA 1XALA 1H2YA 3QQ5A 2XA1A 3LA8A 3LCVB 2FFHA 1ZX1A 3R4CA 5HZMA 5KINB 1GQSA 1CUSA 2EKZA 2P5YA 3DHEA 4C4SA 2PGNA 4CKCB 1AQYA 5IUNC 5DWDA 2A0XA 3HGQA 3COVA 2CVOA 1Y37A 2A5DA 5AT1A 2GLTA 4HD8A 3ZG6A 1JEQA 4IDGA 4BX0A 5DZSA 4JH0A 2F3SA 4HDOB 2HWXA 4J3FA 3TXAA 4ARZB 2O8EB 3UQYS 3G1WA 3ZE8A 4GPZA 1QTIA 4DUZC 4ZRDA 4JGGA 3VZPA 3IQHX 3NAQA 4K88A 4PR3A 1EBUA 3EXHC 4S1NA 1A76A 3PPIA 3W7AA 3IMGA 3RS5A 5BR7A 2EW2A 2FWMX 3JWPA 4M9SA 4NX2A 4TKZA 3DYBA 5IZCA 4JI8B 4HLUC 5SICE 4FYJA 2Q8PA 3MT7A 1BCSB 4M87A 1JE0A 3HCFA 3VA7A 2Z1DA 2I2FA 5E6RB 1WTCA 3VOBA 1C3OB 3M6MD 3FH0A 4XZ3A 1E99A 4A6XA 1RBZA 5T4BA 1E1RA 1E0JA 2CVQA 4O59O 5D7NA 1R15A 4HK4A 5JVDB 5JRDS 4YCDA 4H6XA 3TECE 3C6MA 3NFRA 5A71A 2LPMA 2QYOA 2YV4A 4BRWA 3LLMA 4WFQA 4EHBA 3WRXA 4K28A 3W5VA 1N34B 4TS9A 1DUVG 5COAA 1EDBA 2PX6A 1Z4MA 4NCBA 3EOAI 5IS2A 1LEHA 2R6AA 4YUAA 3PL5A 3OKAA 3JZFA 2AI2A 4JX8A 3BFKA 4RK5A 2V7EA 3EFOB 1K75A 5KYNA 4XB6B 3LGAA 1HZJA 3U4QB 2P3OA 5KU1A 1W47A 5CDSA 2ZJ8A 3ROFA 1WP9A 2YUTA 3R76A 3RO7A 3V3KA 2EGUA 4P33A 1WOMA 5DTMA 4RX1A 1H6AA 4LEIA 2C04A 1MC5A 3UH0A 2AQKA 5FBHA 2V0CA 4A2CA 1AUVA 3QXCA 2P4HX 4OF4A 1OA1A 5DNVA 4TSRA 4CDGA 2XCRB 2HU5A 3SHFA 2IYQA 1SKMA 2GYYA 4G36A 3FNBA 4N18A 5DIFA 5H70A 1LV7A 3NC1C 4B7ZA 3OE5A 1O94A 2DX7A 3ETJA 1IHUA 4ZQFA 2QSZA 3Q9LA 1NC3A 3ECCA 3B8HA 1V96A 2RHGB 1NT4A 1UK8A 1U2TA 3QX7A 3QXHA 1YRYE 4Q1CA 1N33B 1DIAA 3CJTA 1UFOA 3EPPA 4O4HF 1ISHA 4U0KA 1OXKB 2BZ0A 3CEAA 1KR5A 2WU8A 3TNYA 1GUFA 2WB2A 2VDJA 3KB1A 5FPSA 3RIXA 4MQ5A 2ZUVA 4AZVA 1V8ZA 2O3UA 3N2GB 1NBMD 4JP8A 3EF1A 3OX2A 5EHNA 2DR2A 1DJPA 5ALEA 4PYKA 2JANA 4B2LA 4DW8A 1Z6YA 2MDTA 3IGFA 1E1CB 4W5JA 3I83A 4HB0A 6REQA 1R6XA 4K9QA 1E3WA 1RZ3A 4K0BA 3OOJA 1DJMA 1JBKA 1KARA 3KYIB 4KQJA 1KY4A 4LYHA 3TJRA 4XCQA 1A9YA 1PBNA 2VHZA 5JCZA 1E1YA 1U7WA 3A4LA 4DV3C 3NWPA 4BP1A 4PAQA 3L7YA 5D8DA 1WY7A 2F48A 2ZWVA 1ZL0A 2EF0A 2ZYWX 3IQXA 3NLLA 3ZWCA 1IVSA 4LJ5A 3IP9A 4NEGA 2Q6LA 4JP2A 3FYTA 2VPZA 4MTCA 3V8PA 5B3JC 3T06B 3D02A 4JBGA 4OY3A 2GEVA 4DM4A 2OD9A 1AO0A 3A1NA 5LMZA 1VB5A 4CIVA 4P4SA 1NVFA 4TPKA 5AI8A 1IL0A 2CJYA 3ELBA 3PNVA 4O4HA 3E9NA 3SZGA 2YWFA 1E3DA 4ZOEA 2Y71A 4EGQA 2PUAA 1DQRA 1N2JA 4P81A 4ZU3A 3W3AH 4BB0A 5KNCA 5KVQA 3K0FA 3PD7A 4X8MA 3F1KA 2ONYA 2AOXA 3CHYA 1XZJA 4URWR 5K3CA 3KQVA 2FQXA 4JT2A 4AKTA 1Q1AA 1W581 2QX4A 1PT7A 1AK9A 3FIUA 2PGDA 1Z6GA 2OMKA 3ISVA 2IBMA 2ZB8A 1OT3A 4GR9A 4TSKA 4PPGA 1PGJA 1U7HA 5AVYA 4R8RA 5I47A 4MW6A 5K51A 1P18A 4RTRA 1OU0A 4L15A 2QDKA 4OPMA 3N3BC 4QREA 2M1XA 1GRRA 1QZZA 4I3FA 4X6YA 3RS8A 2MHCA 2Y0BA 1QYVA 2Y8EA 3H9GA 1O6ZA 3MJFA 2AWNA 3ZS9A 2E49A 1TQ4A 3DJFA 2CT8A 1ND5A 4C3OB 2VZEA 2PL3A 3OIUA 1JEQB 5BW6B 3V7YA 3VC2A 2GYVA 4Z1OA 1ZAKA 1E3SA 3V32A 2MTBA 3P2JA 5EVCA 3DDUA 2CK3D 3A1VA 1AG9A 5G0WA 2C8LA 1SXGA 5K0JA 3GXOA 2FX5A 1P4EC 2QIPA 3H7AA 3IP8A 4IV8A 3GFQA 2BMJA 4L5JA 4MKGA 2X0FA 3W9UA 2VCHA 3U7EB 4YPOA 2I65A 1KDPA 3B5JA 3TOVA 7MHTA 4C4ZA 4DWOA 1R6TA 2WTBA 2XUIA 4TROA 1TZ2A 3HCAA 5LDGA 4BO6A 5HM8A 4C2TA 1WF6A 1X3SA 3L18A 1Z22A 2V8OA 4UBLA 1CY4A 3FOZA 3RC8A 1NMSA 2XE6A 2YZ7A 1NDUA 1MJNA 4JI3C 1KMCA 3BRWD 4E0BA 4UDXX 3I2KA 4FN5A 5D3MA 3G59A 5J43A 2XKBA 4Q7MB 5LCXA 1PJAA 1DQZA 1E7WA 1X94A 2HJGA 3MUNA 4HLDA 1WXIA 2I76A 5TR9A 3K72B 5HA5A 3M3DA 2Q0XA 3WGJA 4GI1A 4JLVA 5CFZA 1RLOA 1H3EA 5BSVA 3P4XA 4KV7A 3DFKA 4K6MA 2HHHB 2BTOA 2O5CA 4LYGA 2H5LA 2G7ZA 5BYJA 4X65B 4EAAA 1OIVA 4JZKA 5I4KA 1XCPA 3ZHOA 3WBJA 2AG8A 5JJBA 3KD2A 4BGEA 2FZLA 1HOTA 1VJ5A 5AI9A 4G0UA 1GCOA 3DLBA 4FWIB 4YY3C 3HY4A 3QQPA 2PKCA 4N7RA 4YAKA 5LMUC 2JEZA 1IRIA 3QU2A 4NDAA 1JHQA 3HJCA 1OYVA 3WIOA 2BFNA 1XRPA 3GVIA 4AQDA 4BKRA 3N59A 1F3LA 2NO7A 2FW0A 5E6UA 1UJCA 1NQAO 2JH3A 1YJXA 1I32A 4RK7A 1B8VA 5LUBA 1N2EA 5EJEA 3TO5A 3WKCA 2IYTA 1ZN7A 1W52X 2BFBA 2GS9A 4ITUA 2Q2VA 4FBLA 2ZSUA 2QUAA 5JANA 3H4MA 4RTLA 1T26A 1W4BA 4NZNA 5CYGA 4OV6B 4LRYA 4P93A 1HEIA 1V60A 4DDWA 1WNTA 3AGPA 4OKIA 2NPFA 2QJOA 3O1LA 1AQ6A 4IVPA 3T9BA 3VVMA 4DNPA 3CUUA 3V1LA 1VPDA 2M6SA 5TXGA 1W5EA 3FPSA 3TMAA 3EZYA 3PJGA 1S7CA 2EYUA 1BJRE 3REFA 3REOA 1ID1A 2ACWA 3FPAA 3L40A 2CFCA 3UJPA 2QLMA 1DFHA 1V2GA 1UBRS 2JI6A 2AFRA 4GDMA 2BI4A 2D27A 5JJCA 3CYFA 4JBYA 2GJSA 3NIDB 1PWHA 2FW6A 2ZT6A 1SBHA 4Z9FA 5GGXA 5JATA 3VNQA 6REQB 1L7QA 1E3WB 2AG5A 4QULA 5CHEA 3I07A 3L6RA 4PGMA 4RMJA 5ECWA 5B3LA 2R85A 3MOSA 4PSDA 3F3KA 1U0EA 2E4VA 3MB5A 1KMNA 2VSNA 5EXSA 2HMTA 1Y1RA 4ZEWA 1DUIA 4F4HA 4OM7A 3OSZA 4UREA 1V41E 3CJQA 4GKAA 2CMHA 1BJTA 3AY6A 4KN8A 5K0EA 4EKIA 1ECJA 5KJEA 1ZUD1 3F4LA 2V7VA 1MKYA 1DARA 1PJ2A 4R69A 1F6WA 4ZIRA 1WUTA 4DHWA 2YMMA 4QFCA 2Z6VA 2XA9A 4P4SB 2Z2KA 4B84A 2OAGA 4YAFA 5ALRA 4O4HB 3H1PA 4WECA 3T35A 1N5LA 1U3TA 4URHA 3EA5A 3EC1A 4WCDA 4Q3BA 1IQUA 1NBHA 4MYHA 3I52A 3K0FB 2YWJA 2ID8A 2O4CA 4DLKA 3BDAA 3PS9A 2HT1A 3DAFA 1IM5A 3RTGA 4YX9A 4F12A 1ZINA 2DBZA 3P97A 4M1EA 1A9PA 3O95A 2A5GA 1M0TA 1EDDA 4Y2XA 1Z7BA 5CK4A 3U56A 2G1JA 2F1JA 2FSVA 3AJRA 5G1OA 4HEHA 3DKIA 1WW2A 2FQYA 1CFZA 1QVVA 3COYA 3MPUA 3HE3A 3MT0A 1KZGB 4OFZA 4UCFA 1K7FB 1W1WA 2J4DA 2A35A 4GPD1 3TGWA 4ABYA 4RYDA 2B34A 4CL3A 4Q02A 3W2GA 4NBVA 5B3AA 5K3OA 4DY6A 5G40A 2B1IA 1ZQ1A 2V5AA 1DL5A 1Z7GA 2HMUA 5CM2Z 5KWJA 2PIAA 4TMWA 1PR4A 4ENVA 3WSTA 3RJTA 1SZCA 3S1SA 1V1JA 1WW3A 3TIXB 4BOYA 5FL7D 1C7JA 2W2VA 4PXAA 5EIWA 1Q0LA 5EEHA 1KP9A 1Y4UA 2AL7A 2B9VA 2W6JA 3LUJA 3ZEIA 5K0SA 2UVQA 3EH1A 1M0WA 3KU4A 4D2IA 2NCLA 1W44A 3R20A 5DNAA 1L7EA 3NONA 3O26A 2IL1A 1N2ZA 2SKCA 1A8UA 4H3VA 2VJAA 4BB5A 3FPKA 4U9UA 5D3MB 2WG0A 2NWQA 1DXHA 1TCCA 2H4FA 3ZDYB 3GRUA 5ALVA 2TMGA 5FWXA 1H1DA 3O8OB 4XSHA 1VPVA 2H52A 3BQ9A 2B7CA 2FEKA 1FS5A 4UNQA 1TB4A 5KHOC 2B3DA 1KK2A 1T5BA 4GQAA 4WPGA 5TRTA 2HF7A 2VHJA 4MEAA 4D56A 2I22A 3EXIA 1Y8RA 1SU7A 3KQQA 1USWA 3KR2A 4RWEA 4YI3A 1PBTA 2PVSA 3R3HA 1P5FA 3DHVA 3MTEA 3NH9A 4S2EA 3EG5A 4NOJA 2J3DA 1RTKA 4XUEA 1WEHA 3OPYA 3F5SA 3SD7A 3OJXA 3SI7A 4BNWA 3VJKA 1JYSA 2CL7X 2WFAA 4GAEA 4JJKA 1UKKA 3S2ZA 4W8OA 2QRKA 2BSXA 5ESDA 4S04A 2GCNA 2IDJA 3ZWNA 3BZWA 1DBPA 3AVXA 3AINA 2VP3A 4ZTUB 3KT6A 4KXYA 5E6UB 4NG5A 2O5RA 4F5ZA 2HAEA 4GVXA 2MCQA 3RFTA 3PNLA 4FFMA 3PGJA 4TLEA 1WB5A 3EVTA 3G5UA 3BE6A 3AFNA 3RVPA 1O1YA 2CXPA 1WQ4A 2BFBB 4US0R 3MTJA 3SM9A 1Q95A 5JLJA 3HU1A 2VK2A 2R44A 3HB0A 4B3JA 1FNCA 2BGWA 1EX7A 3QF4A 1UPBA 2QUIA 1LC3A 1X9IA 2MT9A 5AKIA 1IPFA 2VPWA 5HJ2A 3LCRA 4M9QA 2BHNA 2E55A 4L3WA 4C4XA 3HCRA 4XFKA 1LI7A 1OXBB 2XBUA 4B1FA 4BGDA 3SG0A 3I4FA 4U5YD 2OLJA 1EDOA 3AR9A 1C81A 3F8WA 4BMZA 3ZH2A 4EEZA 4KHPC 5BT8A 1CY1A 1Z37A 2V6GA 3BGOS 4IJ6A 4UFPA 3H9UA 3VYUB 2MMGA 4PYIA 1WXHA 1R9JA 3BIOA 3MMPA 3S2FA 1V4VA 4B7XA 5K4GA 4IGKA 1PVVA 2NSJA 3CNLA 4WXHA 1SB8A 2DVMA 1QG0A 2VEOA 5GJWC 4DCSA 1FQOA 3PDHA 5I51A 1KQFA 2NVWA 5F23A 2I6GA 1YBFA 4L76A 4MKXA 3LDHA 3WO0A 1YK0A 1JIVA 3CGWA 3B89A 3UCEA 1FP2A 5LWQA 1YBMA 3GCZA 3JW8A 3LDAA 3OEHD 2WTEA 5DTEA 2H9IA 3ENKA 1ZHOA 4I2NA 3PXDA 2QN7A 6GPBA 4FD3A 3KHSA 3I2YX 3WNCA 2PN2A 5I9LA 5GP1A 4R9RA 5DX0A 3F6EX 2JHFA 1YTLA 2J7KA 2Z04A 4BBZA 2OHOA 2Z57A 4ZIRB 4ZCTA 3RVMA 1EX6A 1TK3A 2I3BA 1U99A 4GS5A 3FOFC 821PA 1Y7HA 4KQGA 2XRMA 1ECBA 1FZTA 4RTQA 4JKIA 3AKEA 3C1AA 3PROC 2FB9A 1W76A 1IK4A 4WZZA 5JYCA 1CJKC 4WKNA 2BONA 3AG6A 3KK0A 1AGXA 2HIMA 4OHKA 2C7BA 3O6VA 4QNMA 4KGXA 4TMZA 5CGQB 5H5JA 1BFUA 1W8DA 3LT4A 1DADA 4IF6A 2F90A 1XEXA 3DR5A 3VTZA 5H3LA 3QVLA 3U3XA 1PTKA 3D6JA 4U8GA 1GQQA 1RFGE 3ENVA 3V4OA 2YJ6A 1M1XB 2EIHA 1QZXA 1I94C 1RBMA 1T6XA 1D3AA 1TGVA 4AI6A 3L8GA 1XA4A 3AIOA 4C7BA 1M5RA 4TRJA 5KDOA 2XNDA 4JJEA 2AQ8A 2OO5C 3NIFB 3AJ9A 3BMNA 3D3KA 3GCGA 3M1AA 4REMA 5DYWA 2B94A 1LUAA 2CCKA 4JS0A 3ZZ0A 1XELA 4TWRA 3ZHSA 3FKQA 1PWEA 3CV3A 4J6FA 3VPSA 4DJFC 4OXRA 3TG8A 1LDBA 4AS3A 4RF5A 3NHUA 2ZRKA 2W6NA 3N2KA 5C81A 1ZKDA 4WOJA 1PGNA 4Q9JA 1I0ZA 2QMEA 1GXSA 1M8GA 1UOOA 4HAVA 1Z4IA 2XMCA 3OE7D 2Y1KA 2PROA 1EU1A 4P2BA 3PC3A 3CLSD 2GD1O 1GZHB 2X4GA 1SIUA 1HH2P 4GUAA 3AFIA 3L8EA 3AV3A 5E95A 1XROA 2C9CA 1EWYA 1LA2A 2ZUBA 1Q1GA 3K94A 1DDIA 3B1FA 1F7UA 2O07A 3G0DA 4OXNA 5LQNA 1KFBB 4NH0A 2GWRA 4XQGA 3AF4A 2PX3A 5TEWA 1VYTA 4QKQA 5FWXB 4JM1A 1JTEA 2H48A 2Q2QA 3UJ7A 1DX6A 3R41A 3NORA 2B3TA 2J3JA 3AM5A 1TDJA 3FSJX 4JJZA 4UHCA 5HIJA 4PYJA 5JBNA 3SYTA 2R00A 1XKTA 2R1TA 4CF4A 3BHMA 5B1EA 3EXIB 1Y8RB 3FFTA 1KO7A 2KLBA 3LF1A 3GUZA 4DR7C 4IZHA 4FHEA 4JC4A 4KLAA 5LOVB 4YI5A 3NEAA 1DJQA 3IB3A 2PEYA 2ONCA 2QYHA 3OPYB 2ZYUX 5FEUA 1GA6A 2H5JA 3LAWA 2BW0A 5B30A 3L9XA 1BH2A 4AF8A 3U60B 1TQ8A 2I62A 1QHSA 4GR4A 1HL7A 1D4OA 1FUUA 1I51A 3F67A 3BIXA 3NI2A 4BVJA 3GWZA 2DHDA 2L19A 2VYVA 1JU4A 2R5WA 3CEPB 3TFQA 3TQSA 2H85A 5NLLA 1AUQA 1G9SA 2JFXA 1PS9A 2E18A 3IRVA 4Y9RA 2HK9A 3T0FA 4HH4A 2QX8A 3D2LA 4MQUA 5MN5A 2BOVA 4YXFA 4DCUA 1P3JA 2BBTA 2IEBA 3QF4B 5IC4A 2AE1A 1ICEA 1W36B 1V8BA 2C9BA 2Q27A 4L5CA 1X3LA 4CFSA 3GELA 4IMPA 3FPEA 3ND6A 3D0RA 1AU9A 2CCGA 1PN3A 1O93A 1Z18A 5T8KC 2BPOA 2YOHA 2AR0A 3UC9A 1EXMA 1NJFA 4YGXB 1A4RA 1Y63A 2LVBA 3PFFA 4JWKA 3GLSA 1GNPA 4MVXA 3DHWC 4HX5A 5IN5A 4U02A 2WF9A 2ZQYA 3K1AA 3OSUA 3BGDA 2FZ4A 2GT1A 1SUPA 4F2HA 5AW5A 3MQ4A 3MTGA 2QQ5A 5AKYA 1CQZA 2ODPA 1RRVA 4TWIA 1NVUQ 2CVHA 3ZVRA 4BE7B 1Y3CE 1QAMA 2A9PA 3GEHA 1CRWG 4WXMA 3IMEA 1M76A 3MIIA 3ZHZA 3PICA 2ZYTX 1RWOA 3FMPB 4RQTA 4GMDA 3K8QA 4D5EA 5JAUA 2HLNA 3CQ9A 3DE4X 3RLFA 1EJBA 3PEVA 4YRAA 2EFJA 2H5EA 3CKLA 4BRUA 2P2YA 1SXJE 2RHOA 2VJBA 3SQLA 3HRHA 4L2ZA 4OGWA 4GOJA 2XTZA 4Q3DA 5TSDA 2H1HA 4EA7A 2ZBFA 4LTMA 4XYMA 4AJ4A 1U2SA 4PX3A 1F7VA 4E70A 1WO8A 4EW6A 2ZWIA 1EM8A 3UATA 1KK1A 4BLRA 3HA7A 1VPEA 3U7GA 4R2HA 1Z0JA 4OB8A 2ZUEA 2QN6A 4Q4DA 1LBSA 2Q2OA 1EFVA 3N2YA 3OQBA 4CKEA 3A4YA 3OA0A 5IAEA 1D2CA 3MCTA 1U2QA 4FI3C 3WGUA 3VOSA 1OAOA 2JGRA 3P2KA 2R96A 2R6ZA 2O3QA 3Q8XB 5LL6P 5CG2A 5DHQA 1NA5A 2W0MA 4CL2A 5GONF 5ETJA 1XEXB 3WGKA 3KVYA 3TLKA 5K7SA 3FY4A 3OZDA 2JARA 4D8UA 1P91A 4KQEA 1U0HC 3IIIA 2CKMA 3LP6A 1NJ5A 4PW0A 4XDZA 3DDWA 2IVFA 5KNLA 1M6YA 4MGYR 3BJRA 4JBXA 2IXDA 4EHAA 4HNUA 4DBLE 3BMNB 4EY8A 2XEXA 1RI5A 4KJXA 3E8SA 2E1RA 2V6BA 2WM9B 3QI7A 4YALA 1DCMA 3HBJA 1K5GA 4XIYA 4ZN6A 3JWJA 1L5RA 4HDSA 4LY3A 4AO8A 1UIMA 1L7MA 2Y0PA 5AJWA 1OI7A 5MFZA 5TLSA 1IZYA 1ISRA 3QBJA 1M8PA 2WAYA 4JQCA 1DQSA 3VHQA 4JI2B 4KQCA 3KQMA 1CDOA 2JCGA 3N2KB 5D84A 3WL8A 1GTSA 4HWSA 5THQA 4A92A 5BNFA 2BP7A 5LQCA 3AWDA 1GXSB 3HUDA 3ZBUA 3FCAA 5LU9A 3GNLA 2HGSA 2OPHA 2FFAA 4M4SA 4MIEA 4UEJA 4J29A 2DUWA 2R6GA 4W8HA 1VIDA 4GGPA 5E4FA 2R6CA 2W70A 3GFFA 1XHJA 3DOOA 1II8A 4PAWA 2HNAA 3W3AA 3CVOA 4GOKA 2I8CA 3H1FA 5GONA 1AHNA 2C2ZA 1KZYC 1VKJA 3AGQA 3OQJA 4BN5A 4ZTBA 4F92B 1XZPA 1QO0A 4JT9A 1GFWA 3C3CA 3OM8A 2J3EA 3KOWA 5H16A 5KQSA 1OT5A 2NTEA 1CIPA 1CRZA 2QD5A 1VMEA 4ZREA 3VZCA 3S2YA 1X13A 4LKRA 1B23P 2B69A 2R1TB 2ZRQA 3PHCA 4RDIA 4QGFA 4X97A 4FDLA 2I1QA 3M8KA 4J3JA 4MMXB 1HDXA 1L5YA 3FR7A 3KKMA 1K7SN 4HDMA 5CPFA 4YUYA 1KVRA 4WE3A 5JYDA 5I8ZA 4REOA 2E0GA 3HVRA 4ZPXA 3H2IA 5FUXA 2QRQA 1DVRA 3ZCXA 4LF6C 2W22A 4E4YA 4D4JA 1RYBA 1YO6A 1GQRA 1H2EA 1P2UA 2NPIA 2OCIA 3Q3IA 5J40A 4A73A 2ZDGA 4OI1A 1LW7A 5I45A 3PYXA 2EGTA 4Q1EA 5KCMA 2ZBQA 3L8FA 2C5SA 1TYEB 3UMCA 5BR1A 2PZAA 1AE1A 1L0BA 2C0QA 2XR1A 4XWYA 3IEPA 4EG1A 1FJGC 1KZ6A 2CXCA 1QLJA 1LRLA 2G08A 3KTFA 4FHDA 3GG9A 1C9DB 1JAIA 1KGSA 4RJLA 3G2JA 4RH3A 5CCXA 4R2XA 4UTRA 2YR0A 1S2OA 2H0QA 1Q20A 1BAPA 1YDEA 3HDHA 1CVLA 4HPWA 4NJOA 3ANYB 4P31A 2QVXX 2X4DA 1P5ZB 1OC2A 4Q7LA 4KN9S 1U1IA 4G1CA 2DPYA 3NOXA 4I3HA 3ZXSA 2IZ6A 4OJYA 5A3JA 3WKDA 2C57A 3LX8A 2CVFA 2G0AA 3OX4A 3DBRA 2DECA 3P2EA 4L5AA 3U49A 3RNOA 1E1RD 3EIEA 4FYYA 4KXNA 3PRYA 3BREA 2AE2A 4Q9IA 2I4IA 1X1TA 2GYUA 3PF8A 1QIIA 4FW8A 4QM7A 3K1AB 4ZVPA 3UPUA 4UVEA 2EP7A 2XB4A 5JXGA 1OFHA 1N2SA 1HDEA 2GBIA 3PVZA 1RYDA 3FJOA 3QM1A 3VAZA 3CC8A 5TMEA 4BQPA 2FI1A 1RC1A 4PLZA 4M1ZA 1SVNA 4U4AA 1M3SA 5EMMA 1KWGA 3TQOA 4ZHSA 3SGLA 3H1BA 1IN6A 4P5PA 2O20A 1GPYA 3D6VA 5F77A 2UXDB 4AK9A 2A30A 2ZTSA 4ME6A 3C3XA 1VEHA 2VXOA 3AUSA 4I4NA 2P9BA 1WKBA 4KPFC 1L4FA 4IICA 4U7HA 1YMQA 4KL8S 4QTYA 3OP4A 2M1ZA 2IYVA 4S3MA 3ZQUA 5I7OA 1R5NA 1EM8B 1XEWY 4Z3DA 1RABA 4KDEA 1KQPA 3T7DA 7AT1A 4F93B 1J5EB 3KZ1E 4WMLA 1MF7A 4ENRA 1EFVB 2OM2A 4IIFA 1JWBB 2WOOA 2NG1A 2DU8A 3QK7A 3V6LA 4B6SA 1ZQ9A 1O94D 1CQJA 5KNBH 3B1JA 5CG1A 5DHTA 3QKIA 4HWTA 4NHOA 1VL2A 4E11A 3VJMA 4O0LA 5DHRA 1KDVA 3N2ZB 3NTXA 4OQDA 5AVTA 5CP8A 2ERCA 2FDXA 3RU3A 4QTZA 3L0ZA 5E8JA 2QAJA 3T95A 3CUWA 3CSDA 1RXYA 1XRJA 2IW1A 4NYIQ 4IFBA 3F74A 5CVUA 4C04A 3Q5DA 4CR6A 4BZZA 4XIIA 2J3IA 5AVUA 5KQLA 1UQUA 1USGA 4HDSB 4D9HA 2I6QA 4NFSA 4RVDA 1R0ZA 1NUSA 2WF5A 3QOWA 2FE1A 2YWCA 1GV0A 3CGGA 4GC5A 3DEKA 4ZDKA 2W2QA 4GNRA 5EXXA 4HWOA 1AGRA 1AQNA 4AN0A 1OYWA 1XVTA 3P0FA 4D9NA 2BP7B 3H86A 4JGBA 4KG7A 4C2UA 3OJ0A 1NN3A 2WHYA 1SA0A 3KS9A 5C4GB 3BFJA 1FC0A 2VHXA 3BC1A 5K3BA 2XH8A 3C5WP 3MTIA 2ZAYA 4RABA 3G1UA 2QE7A 4A7PA 1QIKA 4ZPJA 1E3TA 1RXCA 1AUOA 1H4TA 1JGTA 2JDIA 1II8B 1Y7IA 2X23A 2IEIA 3P52A 2V0GA 1XNRB 3DTVA 5GONB 1U2PA 4DC9A 3AP2A 1W34A 3H75A 1MAAA 1ULZA 2FJ0A 2H3EA 2I6XA 3H5IA 4OBXA 1JU3A 3JD1A 4NYJR 5L3SA 2C7QA 4RLFA 2QL9A 4Y2JA 2R4QA 1NQTA 3ANXA 2ZRMA 4RSMA 4DA6A 2Q9CA 1HFEL 3SN6A 5KNCD 2FPKA 3T12A 1EEXB 1SHTX 1JG4A 1AK1A 4PFJA 3F6SA 3P9NA 4HDMB 2YHAA 1NMXA 5KQPA 1JG7A 4FKMA 1N2CE 2H18A 3KLMX 4JV5C 4BN0A 4YRGA 1RAAA 3A1WA 1M2NA 5KYVA 1Z15A 1EVJA 1T1RA 4YH1A 1EXWA 4KWEA 1U8EA 4MPTA 5GINE 1SXJA 2ZJ0A 4H1VA 5CLLA 3O8RA 1ZGJA 3QVVA 4RY2A 1COZA 3LKDA 1NW4A 2VF5X 2M5HA 4WERA 4B34A 4K6HA 2GJ8A 4MUMA 3HKBA 1QP4A 5CVJA 3VZSA 3K9BA 5EPEA 4IUDS 1N33C 2Q4EA 2YMPA 1NMQA 1D8AA 1NHWA 1HUQA 3ET5A 1O8BA 1K8RA 2J31A 4EW3A 2H4YA 2M6KA 2P6NA 4BQQA 2YWBA 3FVVA 5BORA 1U81A 2R47A 1C0KA 4I19A 4YP1A 3VR5H 3EAQA 3GDFA 1NWCA 4W1QA 1LDMA 5FOTA 5KQGA 4QUEA 3C1OA 4YFYA 5TGDA 4OLJA 2FN3A 3PGLA 4K5QA 1X38A 1Q0RA 1T0HB 1S96A 3O93A 3R44A 2C2OA 3DBRB 4H1UA 1G19A 1B6GA 2IS1A 5F1YA 4B40A 5BV7A 2VJLA 3NT2A 1DINA 2QVLA 1RYMA 2Q41A 1G3MA 1XYGA 2BKAA 4FGLA 1KQ3A 2RGAA 3UK2A 2DFTA 4RA6A 1P2FA 3QFCA 3ANNA 5AJHA 2DFVA 3AZOA 5B6IA 3KAKA 7ADHA 5TMPA 1VFNA 2BLNA 1GA1A 3QXXA 4K2HA 2GZHA 1EHIA 1D0VA 3JZAA 1R0WA 2GBLA 2EZ8A 3QLJA 1C7FA 2ISSD 4FLEA 1U98A 5CB0A 3TGLA 4PNZA 3EYWA 1L9KA 3DO5A 3GA0A 4JUFA 5DM70 2ZM5A 3HK2A 2J67A 5EZQA 5F7XA 4L27A 2I03A 2J6IA 3M5PA 1XZFA 2PKEA 2HFJA 5HCIA 3CCCA 1WOYA 5EUMA 4B83A 2HCFA 3LWDA 1IN7A 1SC3A 5EGSA 1ZYUA 3K20A 3NNNA 4LMRA 2R8PA 2WILA 3F7NA 2M6LA 1L8AA 3OX3A 1IHPA 4MV8A 2N75A 2WSYB 5B2ZA 4FXOA 4BO0A 2O0JA 2V7UA 3TZ6A 1I0LA 1CVRA 1SCBA 1ZRMA 2AV6A 2GJ9A 2ILVA 2O2GA 3F5QA 3P2IA 1XWIA 1SB9A 2LCIA 2YXEA 4QG7A 4TQUS 4AP6A 1GPLA 3G0HA 1CQJB 3I42A 1E3MA 3I32A 5FFFA 3ETOA 1UQTA 2P02A 2K7ZA 5IAOA 4N0DA 5EWMA 3YASA 1R0LA 4PX9A 4WJKB 4AY4A 3PHLA 1XAHA 2QU7A 1P0CA 3KD3A 4TLLB 2Y1OA 3PENA 3WB0A 1ESDA 2IQIA 2XWJI 4Y7DA 2JGAA 3SC3A 5CT4A 3T5GA 3D4PA 2WM8A 1GZVA 1ODJA 3OUTA 4H6VA 4M6WA 3F78A 2JBWA 2GAOA 3UV3A 2ZFUA 5C35A 2HMSA 2YTZA 4KGZA 1I3CA 4R31A 4Z99A 3R3XA 2WM3A 1X8XA 2WKQA 4HGZA 3BEOA 1AXGA 3FUWA 4LRUA 4RIFA 4HYYA 1THMA 1W88A 1DCTA 5G2OA 3C70A 1D6NA 2HSZA 3D4OA 3QV2A 3FPLA 2ZREA 1BS2A 1X19A 2BMVA 1EFTA 2GZDA 4BWFB 3GGOA 4JFAA 1HE8B 2G25A 1O0CA 5JAMA 1CJTC 4MUEA 5I7WA 2OBFA 3LDFA 3GFPA 3TQFA 2J0QA 5FCDA 2GPWA 3KDSE 2GK6A 3L01A 1JXMA 3PFGA 4RGQA 1PKEA 1BA2A 1SA0B 4P8RA 2NLOA 1YBVA 4OQEA 3EGDA 4ZAZA 2ADMA 1N92A 5K8UA 5IM4F 5FWAA 4OQLA 4YIKA 1MXCA 3NHPA 4M8IA 5FXMA 3DZHA 4OI0A 2F8TA 1DRVA 3K30A 4W9NA 5K20A 2H07A 1FIUA 2AOWA 2HHHC 3ROMA 3DTVB 2QENA 5DRYA 3D6MA 3WGZA 2NZVG 4PV7A 2QPAA 4ZYYA 1DV1A 4XX2A 3FG9A 4ALNA 1IMOA 4BIMA 5L3SB 4IOKA 4JB2A 3WGOA 1F4VA 3X44A 4JLDA 4FUQA 4QOJA 5TARA 1BVUA 3VYWA 4COKA 4F8YA 4NZZA 3NEYA 4GPTA 1DTSA 1HNXB 1FL9A 4NONA 5AP9A 1ORDA 4DLSA 3K0HA 4IDBA 4YRQA 3AESA 4F3YA 2DBQA 3DYVA 1KSGA 3ZHRA 1ZLXA 1HA3A 2C4VA 3LP8A 4FCCA 5CVVA 3RC1A 3UMYA 4J7UA 1QM5A 1ZD1A 4RY0A 1ZW6A 4G5FA 5AIBA 1XLTA 1CUGA 2HXGA 3DW3X 4CM5A 4EP1A 1FNBA 1YJQA 2ONFA 1VG8A 1GPH1 1YC5A 1SXJB 1E58A 2XZDA 3BFVA 3FYUC 5E4JA 3UOAB 4F45A 1II9A 2CEKA 3UA3A 4DC1A 3KPWA 1NSTA 2IIVA 4N65A 3HKBB 2P4EA 2TSYB 1ZJ4A 1T43A 1JR3E 2AI3A 4X1YA 4A1OA 3W05A 4B4DA 2AEFA 2PU7A 3DFZA 2FPGA 3OZTA 5IM4A 2C3UA 1PJBA 3EMVA 1PAUA 2JRLA 4R3NA 3F3SA 2ZATA 4J4TA 1U28C 1GPKA 1VBKA 2WJIA 3NUGA 5DHFA 1I4EB 1UDBA 2NX2A 4L51A 5EUBA 3U7IA 1GSAA 3PE4A 1J99A 1VM6A 2Z56A 4MA4A 3ZUGA 4MHTA 3GVHA 3VDXA 1RQRA 2D8AA 2DJIA 2V9CA 4DBZA 2C2YA 2QT1A 3U62A 1SHJA 3OWHA 2YQ4A 5C18A 2J5QA 4PUGA 3ITKA 2QJWA 3A1UA 3H05A 3ZV7A 1KZ7B 2VP9A 3ZU5A 2YZ2A 3E53A 3P9RA 4B73A 4NOKA 4L5IA 4DWJA 1CEYA 2W6JD 1EFDN 2FZ5A 3TTWA 2YDXA 3NTRA 1W4AA 5IKOA 2EW8A 3ZVLA 3UMGA 5HNKA 2GPYA 3HP1A 1Q19A 1P73A 3VJRA 5F76A 3ABIA 2RHLA 4RA6B 1FXWF 3IPCA 1GLVA 3AZPA 4MAAA 4UULA 3QFSA 2HL6A 5TVKA 3E84A 3OZAA 3TQRA 2YVUA 4MWDA 4P4NA 4AZ3A 1I14A 2Q28A 2VH2A 4O4LF 1ZI8A 3TDEA 3Q5EA 4EGFA 4PIMA 2W2MA 5ICGA 4RZUA 1F8XA 3UMJA 5KNCH 1T5SA 3LPCA 2FKNA 3P5BA 5CHYA 1QV7A 2G71A 2O2YA 3FMVA 4G5OA 4IAOA 4MW2A 3OTGA 4Z8YA 2N1BA 4YACA 2R97A 4AJIA 1FY2A 4NE7A 3EGOA 1JDPA 3VHRA 2ZJ3A 4JR2A 4I5FA 4MUAA 3OZIA 1G60A 3RK1A 2MSKA 4BO9A 2KLHA 4RDCA 1QIFA 4UCWA 1SVKA 5U4XA 3DWIA 3ZJ4A 5AVXA 5SV2A 2CE2X 2H0AA 4HGQA 3GDOA 4BQEA 4DRZA 1EQUA 4F85A 4P4LA 1MO6A 2NUTA 1A9SA 5IBCA 3I0ZA 1QKIA 1V95A 4TOIA 5G0TA 4DLNA 5JQGF 1FYXA 1Y7PA 1V0JA 1JR6A 1LU9A 3IXQA 1KJWA 2FE4A 3A1CA 2G5TA 1Z74A 1FXWA 4GX0A 5DEIA 3LZ6A 2Q3MA 5C1DA 5EWMB 5EINA 4ZVUA 3OMLA 3SC2A 3WJAA 4DA7A 2G1PA 2A78A 1W36D 5JC1A 4Y0AA 3DDNA 2QBYA 1PCXA 1N2CA 3KJGA 3KHKA 4ETIA 3ZGOA 1ILEA 4BY9E 4M6WB 4BNNA 2VQ3A 1OILA 1RU3A 1IWPB 1O97D 4TXNA 2NV0A 3G17A 2GERA 1NUAA 5CXSA 1JHUA 1SVMA 1DOZA 4L08A 3TS1A 4JD5A 3FPCA 4PG7A 4QBTA 1W88B 4F3TA 4BATA 1YBHA 4Q34A 3LFHA 4OCZA 4G5YA 3SLKA 3VHLB 1GZ6A 4II7A 3TQTA 3LYLA 3UJHA 4CIWA 1RWBA 4DB4A 1N1DA 4A82A 2PE5A 3EVGA 2D62A 3F9CA 1P6XA 4CE6A 5BPFA 3O3NB 4KZKA 1FJXA 4B32A 3EXG1 3X0DA 3D4BA 4YJKA 1VDMA 1OZ0A 2V6IA 3MCZA 2IHVA 3EGDB 4WK0B 2O1WA 3TLYA 3JVEA 2IYEA 5EKSA 4WD3A 1QO9A 2ILTA 3HB1A 2AS0A 3VX4A 2OV6A 1P7CA 4QE3A 4X00A 1DQYA 3MUOA 2P78A 4LE1A 2Q4RA 3OFNA 5KHLB 3MWFA 2QIOA 4MPPA 1KAMA 1Q83A 1HOXA 4PPNA 2LKDA 2CFIA 1UFKA 3EC2A 3CZAA 3EAGA 4U5QA 4YJGA 3WTCA 2RGYA 3ZZTA 2LCFA 1FE8A 4KIWA 1ZI9A 5DO9A 4HDRA 4HNRA 3VX3A 1M1UA 2GBGA 1HT3A 1OFUA 4FMPA 2GZSA 3FVTA 1GKYA 1DKPA 2Z5VA 3AESB 3GEIA 2JLVA 2D2IA 4L95C 4DV2C 2BC9A 4BS9A 1T0BA 2B8EA 4D9KA 1F0NA 3AX6A 5LC1A 1N7GA 1Z6PA 2CJFA 2X4LA 2FOIA 2W37A 2P9FA 1UL1X 2P2SA 2QAGC 4LYAA 2GK4A 3ICOA 1JQLB 2BCEA 2Z1MA 2XNDD 4M9UA 5C8ZA 2ASBA 4X1YB 4E15A 1O87A 4AULA 3A3OA 4ZMBA 1ZMOA 2FPGB 3KOYA 4LJYA 1RRKA 3LF2A 2H54A 3M6VA 2IV7A 3LU1A 3DWGA 3TRDA 1ZCZA 1RRGA 1V71A 3HYRA 3L46A 1FOEB 4MKRA 5F9MA 5HRAA 1TCUA 4EFDA 6PFKA 3NAGA 2ZI7A 4EMUA 1K2WA 1QG6A 2F1HA 4ETNA 2H06A 4R1SA 1JFVA 1STOA 3X1KA 4Y9DA 4LJ4A 4H35A 3WWDA 3V4ZA 5EKXA 3OLXA 1CJUC 3ESCA 1SQFA 1GG2A 3KDPA 3TUZC 1PTJA 1JJVA 1PS0A 1QJCA 3BTOA 1E62A 2DR0A 4Q05A 1DAOA 3H9BA 1ORVA 4JL6A 4TUYF 5HVNA 1U7UA 3AG5A 4N5IX 2P8JA 2AWOA 3B9QA 2P0YA 2IV3A 3PUIA 4EZIA 5FUYA 4OX9B 2FWIA 5DT2A 3BA6A 1O4WA 2I0FA 2QGNA 3ZWAA 3L0PA 2P6OA 4KLNA 4KHZA 4FTWA 4AZ3B 1WVGA 4C87A 1NLUA 4P7JA 1IK6A 4D3FA 2NPOA 3UNXA 3NM4A 4R84A 3GRKA 1P29A 3SIWA 5DB4A 2O7VA 4RVHA 5JSKA 4ZYWA 5CCBA 2I34A 4Q16A 1DG1G 2W6CX 1Z4KA 3D8NA 2PUTA 3I39X 3OTIA 5JFTA 3WNDA 1B8UA 2WTMA 3M4JA 5F52A 3RFVA 2CXRA 4H16A 5K3DA 2O2JA 3TAXA 4QQKA 1NN1A 5KPJA 4IVNA 5TC4A 4JNCA 4KSCA 4AXXA 4B82A 3AR4A 3UKOA 4HX9A 1JDJA 4BP9A 1RDFA 4V39A 2CLMB 3RAJA 5JZ9A 3EUWA 2J3QA 2I80A 4XVHA 1NUUA 2VYVD 3M9WA 3ADCA 1F2TA 4L22A 1II0A 2NUTB 1NX6A 2Y4OA 3LAXA 1WPGA 2FSVC 3O2EA 1XRLA 3D7SA 4X3CA 4BNVA 4L72A 5JPDA 4JUIA 4YECA 2ZR9A 3O2SB 3VV3A 1VQ1A 4I08A 3HTXA 2H7XA 4E07A 3SC2B 5BWCA 4H0FA 1Q7BA 2BT4A 2XW6A 2QRHA 5BMOA 4O25A 2IDKA 3KTOA 2QBYB 4BKPA 1WZ2A 2AUTA 2O7NA 5EY5B 1UBJS 2ZRNA 3N5KA 4MB0A 4XJTA 1WXGA 1B73A 2AMLA 3IC5A 2Z1NA 1JIQA 1P81A 2O1XA 4HSGA 4HYEA 1NXPA 1F6BA 2PWAA 3GZJA 5L9AA 2XNCA 3CG4A 2YV5A 2XBMA 3ELWA 1DJNA 1NFRA 2GRJA 1MABA 3BVPA 4G9BA 3BD6A 4QT0A 3BOSA 1KZ4A 4N01A 3SYKA 5JZMA 4KIFA 4EB8A 1J8VA 4G0NA 3CVYA 4MV6A 5SY9A 4BTVA 1KSFX 2OBVA 4BQRA 3V33A 5LQRA 4B5LA 3CEMA 2HHJA 1UMDA 3DXZA 3CWCA 2P2DA 3L7IA 3C1UA 1XMXA 1TAGA 4KYIB 5KKCA 4HH0A 5K0FA 4C4RA 4UUQA 1KBQA 2AUMA 4P58A 4GC9A 1XZDA 2KYRA 2WA1A 1L3BA 4G37A 3A1EA 3DZCA 3ESBA 4PC1A 4FFDA 1PZXA 3PFIA 3N28A 3PQ3A 4QYSA 4YJGB 4AD8A 4NE9A 3E5RA 4TL6A 2BISA 2DT8A 3RVNA 4EKYA 1OWMA 2IUEA 1E3LA 3LUCA 2XTAA 4BFXA 4BP8A 4HDRB 4A0SA 4YAGA 2ZM6B 5AO9A 5JC8A 2BGMA 1FLAA 3B1ZA 3C15C 1NT2A 3O92A 4N9WA 5K0ZA 2BMEA 3Q9SA 4BFZA 5JTTA 2FZVA 2PRYA 2XITA 4IJ5A 5JXWA 3JD0A 2QQ0A 3HADA 3AHGA 3PZBA 4LQCA 4IH1A 2NACA 1YNSA 3SJZA 1MQ8B 2O05A 5JAZA 1SIBE 4QARA 4F91B 3O90A 3N2LA 1AS3A 3CCFA 5HKLA 4EHLA 1TM7E 3REQA 4NCNA 2OO3A 2VRCA 4YTEA 1PDWA 3AF2A 1IWOA 1W19A 2CZCA 3DVSX 3LL4A 4LXUA 3I08A 1MC1A 3K15A 4QXPA 2C83A 3LHFA 2V7GA 5EQDA 5SZIA 1W36C 4ITRC 4ND7A 1DZ3A 1XA3A 4D9MA 1XL1A 1TMKA 1XU9A 3D59A 1RWMA 5A5GA 4NJMA 3RW9A 2H2IA 2FWRA 4CUKA 2EDCA 3G2HA 1TRKA 5K45A 3UMFA 1SBIA 1VLJA 1HORA 3KTAA 2BJHA 3HFJA 5IAJA 5IF9A 1GZDA 1IN1A 2LUOA 2E87A 4HB3A 2X0RA 1NP7A 5ALYA 3UJ3X 5IASA 3SHWA 2WIGA 2O4UX 3VVBA 2Z4RA 1MRZA 4RAQA 2IWRA 1SG6A 2FAXA 2BBSA 3F47A 2ZITA 4YA6A 2OCLA 3QVSA 3T5TA 1UC9A 4EYGA 4AP5A 3SYMA 1EESA 5KSWB 5A05A 1KPHA 2O7SA 3W3AD 3T7EA 4M9ZA 4O3MA 4Q4CA 2BLLA 4IJQA 3RJMA 5CH8A 4OHYA 4FEGA 2G1KA 4MUBA 4LDPA 2VPYA 1QO0D 4V38A 5E2IA 2W6MA 3WGYA 4DYVA 1VSBA 5EE3A 2C5AA 1QX4A 2O2IA 3QVJA 1EIZA 1I7LA 1E5TA 4GQIA 2EZ4A 1XPJA 4J9UE 3D5QA 4MINA 1PL6A 4IIDA 4F96A 1C7IA 3UOWA 5JFGA 4YAEA 3ZY6A 1QF9A 5ELMA 4UHFA 2OG1A 4KYVA 2V9ZA 5K1ZA 4RKWA 3H17A 4X7RA 3KEFA 1V4NA 4DDKA 1MRSA 2X1LA 1J0DA 3INGA 3LC0A 1D2NA 4INPA 4L3OA 4U6SA 5DT9A 1KS9A 4ER0A 5GWXA 5BQFA 2BZ1A 4R9VA 3TOCA 3ZNQA 1F2TB 3VNUA 2PBLA 2XECA 4AJEA 4EO7A 4TZ6A 2PVCA 3WLPA 4CM9A 1M66A 2VWGA 4KNWA 1PUIA 1CNEA 1F2UA 2IODA 2XYRA 3HJFA 5TGZA 1CR1A 4KMMA 5KKAA 4PNPA 1NR5A 5CFMA 5ADWA 2X9LA 4BVLA 2ZSIA 4EX7A 1ZU4A 4QOIA 1F38A 5EJIA 1F8YA 3VUFA 2P6RA 1KZ1A 3IMCA 3CMMA 5DGIA 4B3DA 3V2IA 4C0SA 3PNQA 4BAZA 3CZRA 1BROA 1NUHA 1SWWA 2WUVA 3FSRA 3RGWS 3OKCA 4N7BA 3RPEA 3OQMA 5M7EA 1XMQB 3WJ1A 4KXVA 1SUFA 2YVLA 3FZYA 1MABB 1UAAA 3LG2A 3R23A 5KPDA 2JCXA 1TK9A 3HXQA 2JK1A 4HR7A 4Q6WA 3RRFA 3TDMA 3EE6A 2QN3A 5J23A 1N3YA 1NX9A 1UADA 4WACA 3RDPA 5JH7A 2NSLA 4JP3A 5BR8C 1VA5A 1T3LA 2FU5C 3HXKA 4UEOA 1UMDB 4RCVA 1W93A 3O4IA 4WLUA 3TM4A 1EKXA 4EQZA 3WL3A 4H17A 1JT2A 5AHXA 1H0SA 5MGBA 4JBLA 2ETVA 1DWPA 2HQBA 2ZSBA 1UZLA 2P5SA 1KPIA 4E3ZA 1RQ2A 3ZBQA 1SBYA 3PUZA 4UBKA 1NC1A 4L4QA 2K2QB 3L0DA 3R3VA 2D5BA 3ITEA 2Z3VA 2Y1LA 2G72A 1HDRA 3FF1A 4UUOA 4BLTA 1UC5B 2OHGA 1G8MA 3TAHA 5B7PA 4RFSA 2FEXA 2Q2WA 4BFWA 2Y1GA 1MIOA 1NW8A 3KSMA 3RRNA 2HZ7A 1GFIA 3RVSA 1L5VA 3IOYA 3JQ9C 1KI3A 2DOKA 1KZHA 4LSWA 4AMYA 2YKGA 1DIHA 1QV9A 3I2JA 5DW0A 3K1YA 3EULA 3BXGA 2Q6IA 4I46A 1L4GA 1I2ZA 1PO7A 1QPGA 2I3ZA 3ZCQA 4CMKA 4YN3A 1LDEA 5AQ1A 4Q7JB 3IQFA 1DPGA 4OAQA 5LM3A 4O3FA 5JNWA 1X0VA 4OYHA 3REQB 3MCUA 1HQDA 4GLJA 3SFTA 1ZONA 3EEFA 3U7HB 1LKZA 1PV2A 3F0TA 1O5IA 4RPJA 1TEVA 5D86A 4MKFA 4EJ2A 3C6YA 1E69A 2Y1EA 1S01A 3DWEX 3P94A 4B3CA 4DIFA 4WLFA 4MI1A 1H5NA 4NJMB 4KSYA 3INNA 4UZEA 1RKXA 1F5SA 2Y0CA 1T8YA 2ZT8A 3JVIA 2D74A 3C8UA 3KTAB 2V7BA 3HR7A 2RI6A 4M0PA 4OB7A 4FGJA 2X2OA 1I5OA 2ZYAA 3FFXA 3OTQA 2G40A 3AHHA 3M33A 2Z6QA 3HJTA 4YQFA 2XJ4A 2CHEA 2H92A 2C9DA 1HI9A 1LDGA 2NZXA 3PPWA 5IT0A 4BQSA 2QE7D 1PA4A 2C82A 3DC7A 2PRKA 3JQ7A 1XRSB 2WW8A 3LX6A 5K0NA 1CY8A 5EJFA 5CA1F 3DTVD 1L3IA 2QYTA 3U31A 4LV5B 2ZAOA 2A9KA 3PG5A 3DB2A 1E1DA 1GARA 1J9GA 5EQFA 2XUHA 3TXXA 4RV5A 4NV3A 2FFBA 2X5KO 4DMHA 2JJYA 4IW3B 1VHLA 1ODFA 4UQPA 1UJ2A 4D8YA 4JN6B 3RTEA 1J5EC 4JLAA 2IYSA 1TQ6A 3KKPA 5F73A 1VCMA 4LC1A 3P8ZA 4NK5A 3PJRA 3E7PA 4DG9A 1ZCJA 1F06A 1PFQA 4DMLA 5BSEA 1BKDR 2GZRA 3LKBA 1SXJD 3CUYA 2F9LA 4CTNA 1KQGA 4Q47A 2EWMA 3PZRA 3K2BA 2VTBA 1A1VA 4DLVA 1N7JA 1E2GA 4Z6KA 4LF7B 1T4DA 1RAIA 4FYHA 5CB4F 1YA6A 3L5OA 5L51A 2QQGA 1DXYA 1G8SA 1QGYA 1ZOPA 3ANLA 3SP1A 1A0OA 1X1QA 4G25A 4HRAA 4H7JA 1F2UB 3DLPX 5CA1A 1D2HA 4U0JA 3WFJA 3T3DA 1RLIA 1Y80A 3UB4A 3CN7A 3OIGA 1Q6YA 3V1MA 1UFVA 2OSBA 1U3UA 3ZE9A 2V6FA 3DZ8A 5I5EA 4OJNA 4L9SA 3O4VA 2ZK7A 3P9ZA 1IONA 4BV2A 1PRYA 3GGGA 4B3SC 1AKWA 1J0XO 1E92A 4XEHA 2J48A 5DBIA 5G3YA 3ADBA 4LC9A 2ENWA 1XTTA 1VZ2A 1ZU5A 2ZCUA 1ZNWA 2WHXA 3CT6A 3LLVA 5B53A 3V7WA 4ZTZB 2PGXA 3QJ5A 1UWDA 1JP7A 3QRWA 4DCMA 4X85A 3DZDA 1OOEA 2FNAA 1R9NA 4Q37A 1KHTA 3LK6A 5EE1A 1USUA 4MTNA 4V0KA 3SHTA 1QRUA 4W5NA 1M2GA 2EXXA 1L5MA 2QTGA 4Y30A 5D5PA 1L1QA 4NZ9A 3KETA 4KK3A 5JH7B 1X7DA 3PHJA 4LHSA 2L82A 2IEYA 1E0DA 3ZLVA 1XB2A 2CY1A 3GFGA 4M0LA 1MEOA 3O7WA 4HI0E 1YJBA 4G4GA 3K8OE 2WD7A 4MXDA 1EE2A 3Q7PA 2WYHA 2AGVA 3L0IB 3DLHA 1N0IA 1KYYA 2R2GA 3QWIA 4F6RA 5F3WB 1I3NA 3LQRA 4GBJA 4AYWA 1UP6A 4D45A 5GJBA 4KQXA 4G0VA 2W43A 5DH9A 1OBVA 3Q3EA 3QEMA 1YB4A 1UDAA 3TRIA 2FZEA 2JI9A 4YP0A 1MIOB 2XQKA 3LK7A 3P9XA 3W2FA 3QUBA 1EWQA 3QPBA 3DBLA 4Y6GB 1NRIA 3CLTC 3MAAC 5K5EA 3KE9A 4DV4B 1KJIA 3CPJB 1JILA 3LA6A 5DTQA 3RUCA 4P34A 4ZGGA 2ZDQA 3EMKA 3GD5A 3K2QA 4OM8A 5HFAA 4UTVA 721PA 3FHTA 2IBSA 4ZGWA 4NXMB 1W1IA 4KR9A 1YE8A 1SD1A 4GP6A 4V2UA 3JQFC 5I9MA 1N0HA 4D5GA 3WG9A 2GETA 3AR7A 4X7MA 3TZEA 4D8WA 4F4DA 3NWJA 3WWEA 3S82A 2OWDA 4EA6A 4OLAA 1ZD8A 4B46A 5JS7A 3KCQA 2DKOA 5EZYA 5C80A 4ZI2A 3ENQA 1L7OA 4I0WB 3A2MA 4EMBA 3T3OA 2P6UA 3DZBA 3CR3C 3QYJA 1UPAA 4CEJA 2B98A 3SHVA 4Y2GA 3SF8A 1YGYA 1DQPA 1OGIA 2C3OA 2VNAA 4RD6A 3ZVMA 2JFNA 8ADHA 3JWHA 5C4MA 2VP6A 2DQ4A 3RS3A 3T5PA 3A2LA 4BFSA 1M7BA 4QPDA 1ZITA 5JNLA 4D6PA 2JAWA 5AI6A 4ZK2A 4YPFA 1KJQA 1THGA 2VHQA 2IEDA 2JF0A 1QIJA 4HWGA 1Y9EA 2ZS7A 2Y99A 4PYRA 4WAUA 1KH1A 2CVPA 4LZAA 1YOVA 2ZIZA 3DM5A 3JQ7B 1POWA 1IIBA 4JYBA 3QSYA 2XTNA 2FLVA 4IG9A 4J0CA 3IQEA 3W4JA 4Q19A 3CUVA 2DH6A 2VQSA 3ZY2A 5HM6A 4X6XA 3D4NA 2QS9A 1DAKA 4FINA 3JQBC 4G1FA 2JZOA 1J8QA 3RASA 3PRHA 4QJ3A 3KSBC 5D3ZA 2HWYA 3RSQA 3RT9A 4J76A 3S5JA 4GEKA 3UMVA 4DR1B 2HYIC 2EERA 1RI3A 3R5XA 3R3UA 3I6BA 1N25A 1AB5A 2RAVA 3GOQA 4FNGA 4R54A 2WU0A 3C6QA 3QFFA 1LRKA 1KZ9A 4ONEA 3BM5A 2NN3C 3H4TA 4QQFA 1O90A 2GEDA 2Q3BA 2AK3A 1APBA 2VJMA 2GA8A 4XWWA 5E38A 4DTCA 3BB3A 3KFVA 1YH3A 4EW1A 2P9HA 3HUTA 2PQ6A 2VTVA 3OETA 2VTBB 5CD9A 5EMKA 1YWGO 4EVSA 1RE1A 4JLOA 1PR1A 1YS6A 1FXUA 1U7ZA 3DXYA 3PIRA 5J4HA 3HB7A 1OXXK 3UHJA 2QGFA 4HMQA 1PYDA 2B78A 2JFPA 3N07A 2IYUA 1ZG3A 1LC0A 2ZTVA 1ETHA 2COKA 2YFYA 1GKIA 3C2QA 2VZ8A 1I6MA 3LUBA 4BRSA 4E51A 5CA1B 1Z08A 1WZCA 2V4MA 1RXIA 2RONA 3HJAA 5ENVA 1E2JA 4PWYA 2P68A 3O4RA 4NL4H 4XRRA 1M2VA 5THXA 1T8WA 5JAQA 1ESEA 4IYJA 1ZA1A 2BRUA 2EL9A 3L04A 3MAGA 1Z7EA 2LE0A 3CB2A 4GWKA 4IRXA 1DO2A 4JUAA 5KSPA 3EWNA 3C8ZA 1MN6A 1ZH8A 3IQDB 3AB8A 4GZ5A 4J7AA 4QXAA 4V0NA 2FFQA 1YZLA 3DM9B 5IXSA 4KUEA 4F9TA 4C6TA 4UNPA 4YRLA 3RKRA 4QOSA 3CU5A 3RB8A 3JU3A 1VCHA 2WLTA 3D0OA 3LXRA 3TZLA 4MQBA 3LNVA 2YJTD 3WLFA 4AZTA 4BUZA 3DEFA 5DNUA 4LJ6A 1I4TD 5LP6A 1Q16A 4K9DA 3HDQA 4ZZ3A 5KB3A 4JXZA 3LPLA 2BZGA 4DIDA 2WJWA 5FI1B 3BN3A 1FLOA 2VRBA 3PHIA 4CODB 4MWGA 5A6SA 3PNSA 2IYWA 3ORHA 3QIAA 3R0IA 4KXMA 3CNNA 3NR2A 3LBNA 1ODLA 4L5BA 4ZVVA 2EQBA 3KXWA 1YR1A 2WD7B 4JELA 1O3YA 4J3NA 3IURA 3WVNA 3C6XA 5EI5A 1U8XX 3OFVA 4I3GA 3PQ6A 2UVDA 4F6RB 4F4CA 3NTOA 2NXWA 1KK3A 3ELYA 1Z0AA 3T54A 3L1VA 3C7DB 3TR6A 1P4AA 3QEMB 1OBFO 4P2GA 3VHXA 2PO5A 4JL5A 2YH2A 3RWBA 3W8EA 5IDQA 1TFRA 5DBFA 2UXCC 1CBUA 3DBLB 1PG4A 1MJHA 3TX2A 4QD3A 3S1AA 1L4HA 1PD1A 2V5VA 3CX6A 2A0FA 3WYCA 3ZYZA 4B0PA 4CG0A 1M74A 3R74A 3KYJB 5HK8A 4WKOA 1C8VB 1QPZA 4C3ZA 2AZXA 2DB3A 13PKA 1LQ2A 2D0DA 3IAS1 3S3TA 3X2FA 5ALGA 1C29B 4ANFA 2YZGA 1B6SA 2H1VA 5I7RA 4W5TA 1K7EB 5IKPA 4ALKA 3AMVA 1OJLA 1W2HA 3G2LA 4Y6OA 4XLTA 5HFNA 3GA7A 3ER6A 3M3PA 5EZYB 2AB0A 4QAJA 1G3IA 1FFDA 2VR1A 3ZI7A 1YACA 4X0EA 4CEJB 2ONKA 3W79A 2F9MA 3URKA 5JEEA 1JMVA 1U7DA 3SF8B 2ATEA 4NK4A 3E0QA 3H18A 5DLQC 4BFLA 1EK5A 4QVIA 4WCVA 1ULHA 2PANA 1K92A 5B6JA 5KTKA 3GEPA 1Q1BA 3ONVA 2ZYSA 2EWVA 3HEBA 1L8QA 2JGKA 2VAVA 2Q7OE 3CVWA 1QE5A 4LOJA 3IBCA 4Z9XA 1GNTA 2FQWA 2P7HA 1G55A 3DXFA 4CF3A 4MR9A 1WA5A 4XQEA 4ZZ2A 1BVHA 1PG3A 3X1MA 1YOVB 4CETA 1LLDA 1ADJA 3WAKA 3TOXA 3IKTA 1BFDA 2QTFA 4ZOBA 1YQGA 3DAOA 3EXAA 2HRRA 3OFND 5BNIA 3NDJA 3CB4A 2JIBA 3HXPA 3NHKA 4YHBA 1TVMA 4LFBC 2E82A 2O50A 2XMZA 4MCAA 5A4MS 5CB8A 2B1GA 2OK7A 3OZRA 3SMVA 1O5TA 1NPYA 3HNPA 4AXBA 1FA9A 2VDLB 3K0EA 4LDRA 4A16A 1SOAA 3TOZA 1CRQA 1I4DD 4J07A 3A2KA 4QZVA 2PD6A 1T9CA 4H15A 4KE7A 2W6IA 3LLCA 2PUEA 1YONA 2Q2NA 4ZT5A 1WU8A 3SMQA 4DA9A 5C31A 1OLXA 5HF5A 4UBOA 1L7VC 3RE1A 1NQVA 4HGOA 4GHWA 2VJMB 1YIAA 3ROEA 4AFNA 4CR7A 3AP3A 3F46A 4Q7KA 1RRMA 3SKYA 2B36A 5CH3A 3L0BA 3EDOA 1P45A 4HZIA 3QVXA 2AI1A 4KPEC 3CUTA 1QFZA 2ATXA 4QDUA 4KNVA 3TJZA 1RD4A 2EFEB 2C31A 2V4UA 1SAYA 1FDSA 1NW7A 1V39A 3BWEA 1IBCA 4B6EA 2CXOA 2RHMA 4EG6A 3GLGE 3KHUA 1MXFA 1RKQA 4RVNA 2BHTA 2P11A 4J4HA 1Z82A 1YUMA 1U0LA 1IFXA 3THOA 1C30A 3S40A 1E3QA 1M2VB 1EFPA 2ZT7A 2C2GA 3ZWDA 2IZOA 4ZVSA 2D06A 4MUNA 1V8PA 1AKVA 5I9BA 2CYCA 1YL6A 4GZMA 1JDVA 1Y42X 5J2TF 4RTNA 3AUJB 3STVA 4NWIA 1K5HA 4DMCA 4NESA 1UEIA 1WM1A 3EMDA 3FLEA 2BKUA 4IMIB 5BNWA 2YNMC 4DV5B 1S5PA 3EEBA 2UZ1A 3K5PA 4C6TB 1GPNA 2ZQ5A 3CZ5A 4OD0A 6NULA 2RIPA 5T3UA 2PSSA 3ZLBA 3WYAA 3V1NA 2MR5A 4EVRA 2ZIUB 4W9NC 5DN6A 2XUGA 1XJQA 1RZVA 2C8VA 3I9LA 5HCUA 3FE2A 5IJ9A 3COPA 5LP6B 4E12A 3QP9A 4HYTA 4C1BA 1JUDA 1N6LA 1ZXLA 1UWLA 4G8DA 3EYAA 1W48A 3RGGA 3BCSA 3Q3JB 4DEYA 1XA0A 4DKJA 1US8A 2VYNA 5IH3A 2XOKA 2O14A 5A6SB 4EH1A 4X9XA 1ADCA 5CEEA 1CJCA 2VJPA 1D1SA 4K9SA 3B6KA 4GYKA 2O2ZA 5LQAA 4QPJC 2G1UA 4HS4A 2PD4A 4V0OA 1XNQB 5JRZA 5BN5A 4OI2A 5J5CA 1IBKB 5BSUA 2G28A 2RC6A 3E1SA 3MJVA 4MUXA 3VHXB 5KX5F 3SJBA 1XLTC 4PCVA 4WJZA 5J2TA 4I1YA 3EW9A 1ZICA 1SOVA 2OORA 1JQEA 2ZVDA 1H4VB 4M76B 3U19A 3OFSA 1H2HA 3OZGA 3S1AB 1VOTA 1CR0A 2ZI5A 1VTKA 2G76A 3SHQA 2XRZA 3EPRA 5T5QA 4A8TA 4I5EA 3ZQ4A 3O0DA 2BKEA 3TG2A 1TZBA 5DV9A 5FHQA 1FDRA 2RGBA 4BLSA 3RWOA 5YASA 3OC6A 1J0EA 4DAEA 1V3QE 1ZDMA 1REQA 2DYKA 2J3KA 3NHJA 3P26A 5SYMA 3SKVA 5HF9A 2PRSA 2ZIWB 5FPQA 4KK4A 3DFFA 4BBYA 1E6MA 1MG5A 1ZD2P 2EBFX 2R8EA 1DBRA 4Y1EA 3I5MA 2VUHB 1VJ0A 4KFTA 5FO1A 2EHJA 1T2NA 1CFJA 4PE5B 2VSQA 1WSBA 2PMFA 3UXHA 3WHIA 3CX3A 4K26A 5DP2A 5HEKA 3SWWA 2P1DA 3CM0A 4OL0A 5AOBA 2Z0MA 3TVDA 5BQXA 5KWEA 3K4HA 1ZXXA 5D6OA 3I8OA 4XVUA 2UUCB 1B0AA 3CJRA 3IKMB 4H9GA 4OKSA 4UXIA 3FMGA 2QJFA 4LISA 1MORA 5K05A 3WBKA 5KX5A 2C2HA 3TTSA 3C74A 1XMIA 4PYLA 4EG4A 3B70A 4CCWA 2P9QA 1Z6ZA 1HTTA 4M0MA 1EUZA 4YRIA 3KJEA 2FXIA 3QU5A 4MR9B 3UJDA 3DYIA 2QGZA 1YIDA 3HKCA 4DM3A 4DNQA 2KZ0A 1N7IA 3CZ9A 4LJ8A 2IH2A 1R0YA 2PMCA 2I2WA 5B37A 3SCZA 3FTCA 2XB8A 2BE7A 5DE3A 5B7NA 5CURA 4JCCA 4KPUA 2I5PO 3BSFA 1DC5A 3JVDA 3LMKA 4HHEA 3W6NA 4X62B 3A04A 3B9PA 5FYQA 1YIOA 2J9ZB 3AHJA 3QNUA 2X5XA 1M1NA 2O2DA 1Z17A 4QGAA 3QOXA 1KP3A 2BBWA 1X86B 2JGJA 4LGVA 4E7PA 1KYXA 5A4JA 5A1JA 1OLXB 3DEIA 1C7EA 1ULTA 5FLYA 2FG5A 3LLUA 1Z6TA 3LO5A 4GI3A 2N3ZA 3FBTA 4DR3C 2ID7A 3H87A 3KLNA 1MXAA 4NNOA 2Y1CA 5H3HA 1WBBA 1PR3A 2WTAA 3K5IA 2QD4A 1E2BA 1SBNE 2VRCD 3UBMA 5L6MB 3H2GA 2Q45A 1JVNA 5DM2A 3OQNA 2CDRA 3OOYA 3RUFA 3MGKA 2BYTA 5FWDA 1S8NA 2BHSA 1PU1A 1X0XA 1RBQA 2DSNA 3P20A 1XO1A 4JBWA 5IFKA 2ECQA 4FJ2A 5EUCA 4FZ5A 1E2PA 1U8FO 2HQRA 3W6OA 3RROA 4E2XA 3IESA 1C30B 4G1UC 1DOAA 4AKSA 2QTZA 3IUPA 4XLLA 4A2PA 1EFPB 2P62A 5EXEA 2YWDA 4HGYA 1FDVA 1NOIA 1PJ4A 1B8NA 3L3BA 3HB4X 4UVHA 3SHOA 1IN4A 3Q7RA 2EFYA 3KXIA 1TYAE 4UU1A 3LXMA 4AU1A 1R5JA 5LIPA 3RVRA 3JYNA 1DKRA 1TW3A 1PE0A 2AF4C 4MRMA 1GZSA 4DMKA 4NU5A 1U3GA 4LIPD 2WJHA 4NYJQ 2G0NA 1BQEA 2FUG1 3OLVA 2UZ1B 4W8GA 4KXXA 1DWUA 5DNEA 1JAHA 4FOSA 4RW0A 3BJZA 3MJCA 4LXXA 3EQ2A 4TS1A 4YMWA 3WP1B 4CDMA 1DDGA 4KCGA 1TU4A 2ODQA 1A98A 4QXMA 3TE7A 1XCBA 2FJUA 3G9XA 3E58A 1N1EA 4O1IA 1SHKA 1C9NA 3GAMA 5I7EA 5IJ9B 1Y82A 5KTMA 5H9WA 3UGJA 2CVZA 2J33A 2NO0A 2VIIA 1TEXA 2O0KA 3OZUA 1NHGA 1US8B 3PK0A 1MC8A 4XJSA 4D0RA 5CEJA 2ACVA 1L5SA 2ZWPA 2P77A 4TTJA 1KL7A 2XCSB 3CUKA 1LNQA 3FYCA 2PAFA 1X1EA 2ZM6C 1S1MA 4V02A 3TL6A 1PZFA 3CVUA 2O19A 1XLVA 2GK7A 2QVGA 4BC9A 5KC9A 1EVZA 5EOVA 4MP3A 4Q9KA 5BN5B 5F3DA 1XEWX 2QRJA 3KL4A 5J2TB 5BN4A 3Q15C 2E8EA 2PN1A 2PA3A 4HNQA 4TM8A 3TGPA 2KWIA 1H23A 3V8QA 3FF4A 1X1AA 3A6JA 4CM9D 3TSYA 1XNJA 4CLOA 4US2R 2PS9A 2Y76A 2VF4X 3B52X 1G20E 3JS5A 4N0EA 4XA8A 2NYVA 3PCRB 5FA8A 5J5AA 1Y6FA 3UK6A 4DR6C 2NP6A 1QIGA 2CUKA 4KI7A 1YS1X 2VP5A 5KI6A 4KOAA 2QSJA 2V96A 1REQB 1A8HA 2RAFA 3G85A 3SEAA 3L4JA 1JBEA 3NKLA 5SYAA 5E7QA 1NVDA 1RKVA 2G04A 4IEEA 1W29A 4Q24A 2CUTA 1IBLB 1FW6A 1CUUA 1PNOA 3LL7A 1SCAA 2ZSDA 2BEUA 4AT1A 4M55A 3QH4A 4J03A 3D6NB 5A9RA 4MS3A 1HKUA 1K63A 2ORED 4UMDA 4MLZA 1E2QA 3KQWA 4C30A 3CMCO 1NIJA 3QEAZ 1NXOA 1TO6A 3PLRA 2QQEA 3KHTA 2X6QA 3LIIA 2H51A 3PCTA 4REQA 4H1WA 3S8YA 1AA9A 3NBKA 3HPQA 3VISA 4Z3OA 2VUSA 1JQAA 4HQ0A 4NH4A 4D43A 2X5JO 1NXTA 3E3NA 4MYDA 5FTKA 3KQSA 1EDZA 4DSOA 4UD2A 2FUG6 4KIUA 4ZANA 4BZPA 3FTEA 3IPXA 1ZNZA 4LQ4A 4AIRA 4AVYA 3G1TA 3EWIA 4XB2A 3HKCB 4OI4A 5DCWA 4BFCA 2P9GA 2XRYA 1VLZA 1XQWA 3F7OA 2FN8A 1ONSA 3Q7QA 1K1EA 3W04A 1J0CA 1QX3A 2F59A 3R75A 4JOCA 5K8JB 1PG0A 1E0SA 3RFUA 5LLDA 1ML8A 1SUAA 3JRNA 1KEVA 3D2AA 2IP2A 4KPUB 3IE0A 2ZYRA 2C7OA 3RYIA 5B58T 2BJOA 2Q1SA 3RD5A 1KVUA 3NJRA 1Q0SA 4UVIA 1G291 2R3SA 1UZNA 4PPQA 4U9HS 1KS2A 2UVPA 3F49S 4GO1A 1QO7A 3BH6A 1RHQA 4G1EB 3D2BA 3LE8A 4XAQA 1LF0A 2QY6A 4JI4B 1DEAA 3R7NA 2LTAA 3OCXA 1ITZA 4C4TA 1Q21A 1XZKA 4YMHA 4Y7CA 1XS3A 3AY0A 2OSVA 2PZLA 1UCFA 3BXEA 1KRXA 3IMLA 3PTLA 1IBRA 4MPJA 4QBFA 3HY3A 1H05A 4Z0TA 1FDUA 1T36A 3KCNA 2OMEA 4WXEA 1ZH4A 1Z2DA 1XNHA 1W6UA 2QN8A 2XVAA 3QVMA 3NZEA 1XKQA 3S6JA 3TL2A 2AJ8A 3UHAA 2BGIA 4IGFA 4FKBA 2EAUA 2O7RA 1E2IA 4M21A 4F3KA 3M4XA 1N36B 1H8HA 2GDZA 1XMQC 1U7TA 2JJ1A 2FDRA 1TPYA 1X92A 4OBEA 2MYPA 5TT0A 4OEHA 1LJLA 3DT8A 3PFWO 1EZZA 3QX9A 1JZTA 3N0XA 4F11A 2IYPA 2IE0A 3GNQA 3W7BA 1XQ6A 1K8QA 1SNYA 2C96A 4HS9A 4AP9A 4L8WB 3G5MA 4MICA 1LBTA 5ARCA 4MRMB 1H0RA 3PXAA 5IH7A 4RVCA 4BO1A 2QRZA 2W2NA 4MLDA 2NT4A 2X6TA 4XASA 4ZT4A 2YHBA 1FEZA 4MITA 4N8DA 1GOTA 5B4UA 5EIEA 4EENA 3L6CA 2AHRA 1YQXA 3GZNA 3W06A 5LU8A 3NT5A 3VSAA 5C7LO 1GYPA 1Z6QA 4FB4A 2QTVA 4JA0A 4LW8A 4MJXA 2QEQA 5EHXA 2FMKA 3HSKA 3CZCA 2A86A 1TUBA 4OOEA 4KODA 3OQHA 2OCBA 4NXNB 3GBVA 1H22A 2Q21A 5K0CA 5F21A 3NGXA 5FULA 1VL8A 5EMJA 1LPPA 3ZU6A 4DQVA 4DQUA 3O8CA 1PZEA 2I4MA 2PJDA 4W1SA 4YBRA 2IWHA 1RJWA 1FTQA 1XLWA 4D0GA 1JKMA 4F2PA 2BGRA 1BZYA 5L40A 1L4YA 1Z0KA 5DYTA 4HCJA 2QK4A 2IUSA 1JDBC 3R6GA 5JSUA 1UOPA 3EX7C 1OHHA 1NJ6A 3F96A 5BN4B 2GILA 5JDCA 2NXJA 2GJAA 3B7PA 4TMKA 4CLOB 1EJ6A 2E48A 2OGSA 4OU5A 2UYQA 1IIRA 2WVJA 2C88A 3JYPA 1A2BA 1CUWA 1A50B 4GKBA 3DNMA 2WSBA 4ACBA 4BL5A 4R68A 1TVEA 2QKYA 1E3JA 3O75A 1U0OC 4ON9A 4R9UC 1XMOB 1QK3A 1OZGA 1D6SA 1XD9A 4G81A 3IT1A 2BIFA 2JC3A 1NLYA 2ACEA 1ZSVA 2F7SA 5JJLA 5JMOA 1G66A 3BYZA 3RRXA 4FD2A 2FWNA 3FW1A 1NXQA 2BEUB 1ID8A 4A23A 1KOGA 5FJIA 2CLLB 5J2UF 4MS3B 1JJIA 3LXXA 3M9XA 5JNUA 2J0UA 2PWYA 3E5HA 4REQB 4TV9A 4NAHA 3MIZA 4AJPA 3KWFA 9LDTA 5BVHA 1TTHA 3V7NA 3PKIA 5JRHA 1A71A 4Y1FA 4B8ZA 4M36A 4DS3A 4OQYA 3DF7A 3RSLA 5JW6A 2H2WA 4P84A 4UZSA 2DTXA 3TTUA 4A0HA 2JLXA 3PUYA 4YGYA 3SZLA 2TYSB 3ETCA 2OAP1 1P3DA 3S0JA 1BO6A 1FVFA 1H6CA 3E0XA 5CT8A 2HOQA 4FHCA 4LF4B 2OUKA 4P6VF 5ICCA 4ND5A 5KQRA 3G5LA 1Y3AA 4QU5A 4KQHA 3DUFA 4YRCA 4WXRA 3TCNA 1EFKA 5T41A 2WICA 3RYIB 1ECFA 5C8VA 4XYGA 2JBHA 1YJ7A 4ARAA 1IXKA 4LDNA 1HGXA 3MBIA 3W9SA 2ZSKA 1XVVA 5B6PA 2F00A 6ABPA 4YQEA 1GYRA 2UVPB 2YXDA 3L93A 4E1BA 3V46A 5C8YF 5U4QA 3NJ8A 2DTDA 5E7JA 4JYCA 5J2UA 4AX4A 3NYWA 4YAWA 1XTVA 2Y9MB 2RHJA 3FCSB 4ALLA 2R7LA 1P1JA 3NBZC 2DHEA 2TMDA 3T9DA 5BNTA 3KAQA 4G5SA 3P1JA 1EQ2A 4R2MA 3QMVA 2FSHA 4XWOA 2WBLC 4U63A 2I6SA 3HJGA 2A9JA 1PSDA 2BY4A 3E2IA 4Z5XA 3BDIA 1T36B 2ATIA 2FHSA 5EE0A 3QY0A 3VNBA 1GVNB 3P9QA 5JCXA 3QFHA 3T41A 5A0FA 5AESA 1EB9A 2WHQA 1E6WA 3P9SA 2XMGA 4V24A 1C0PA 5TMDA 3AYZB 2JJ8A 4KBYA 3DW1X 4DDUA 3CJEA 1N6IA 4TTQA 1VJTA 1QOPB 1GDHA 1E9VA 1TJYA 1W4LA 2F4NA 1YDHA 1GGNA 3HFSA 1G20A 3P9KA 1WCJA 1W4ZA 1AZWA 4OMFG 3RYCA 3KQNA 2BKLA 3CISA 1R16A 2MSCB 3IVMA 1B8PA 1U1DA 1PJCA 3OZEA 3HS3A 4M0CA 3SQMA 3W5DA 1ZOLA 3BGVA 1C3JA 1R0BA 4FFBA 3UCXA 4CN9A 5IEBA 1WV0A 4B3RB 1DG3A 1NBIA 1ZHFA 2ARKA 3TRKA 8AT1A 3LVBA 4LNHA 1JAZA 2GVDC 1UKEA 1TO1E 3IT3A 2C0PA 4BYMA 2VHYA 1QQAA 2FYTA 1PT5A 5AVJA 4ZO6A 1F14A 1YHYA 2FEAA 2JL1A