2Y4NA

Paak1 in complex with phenylacetyl adenylate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
428
structure length
426
Chain Sequence
PLPLEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHENYLACETATE-COENZYME A LIGASE
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
total genus 147
structure length 426
sequence length 428
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y4nA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y4nA01
4U5YD 2D1RA 3NYRA 4G37A 3IESA 5BUSA 3IVRA 3FCEA 4R0MA 2P2MA 3VNRA 3A9VA 4GR4A 3E7XA 2QW0X 4PZPA 5BURA 2D1TA 2P2QA 1PG4A 2QVXX 5BSVA 1V26A 3L8CA 4DG9A 4D57A 3ITEA 5JRHA 4ISBA 5KYTA 4RLQA 2Y4NA 3C5EA 3FCCA 4M46A 4E5DA 3E53A 4RLFA 4RVNA 2P2JA 1AMUA 4LGCA 3VNQA 3IERA 2Y4OA 3CW8X 4R1LA 4D56A 2Y27A 1V25A 5BSUA 3LGXA 5BSRA 3DLPX 4GR5A 3RG2A 2V7BA 4D4HA 5BSMA 1ULTA 4EATA 3LAXA 5KEIA 1BA3A 3RIXA 3O84A 3T5AA 1LCIA 3NYQA 5IFIA 1T5DX 3A9UA 3EQ6A 4W8OA 3O83A 2D1SA 3U17A 4OXIA 5DWVA 3WV5A 1YJ7A 5BUQA 2P20A 4FUQA 3O82A 4OYCA 4D4GA 5DV9A 3E7WA 1MD9A 3T5BA 3U16A 5K85A 2P2FA 3LNVA 4RMNA 4RM2A 5BSTA 5D6NA 3KXWA 2VSQA 3NI2A 4RM3A 3DAYA 5E7QA 1MDBA 5KYVA 3VNSA 1PG3A 3TSYA 1RY2A 4IZ6A 3CW9A 5BSWA 4R1MA 4G36A 2QVYX 2D1QA 1MDFA 4RVOA 4DG8A 2VZEA 3IPLA 4GXRA 4GS5A 4GXQA 1T5HX 5K8FA 3QYAA 2WD9A 3IEPA 2QVZX 3ETCA 3B7WA 3T5CA 3WV4A 3R44A 3GPCA 4IR7A 4D4IA 3WVNA 2P2BA 3DHVA 4ZJZA 5GTDA 4FUTA 4WV3A 3PBKA 3G7SA
chains in the Genus database with same CATH superfamily
2VPPA 5BT8A 2DB3A 4ER6A 2H6EA 2P9GA 3KQHA 2I1LA 6AT1A 1NJ6A 2I2AA 1AF4A 2CFOA 3LUBA 2Q6TA 3N2ZB 2MYUA 3FLAA 3KYCB 2Q6KA 3UOGA 1TYDE 2A0YA 4JJ6A 1LDBA 4BQIA 1FW6A 1L1FA 4GKKB 3QK7A 1Z73A 2AZXA 1TT5A 4JJEA 2D1TA 4JQOA 4MV7A 1T1JA 2BFMA 2HK6A 1SVSA 3GPIA 1CDOA 2QBYB 1F6DA 1Y3CE 4CL3A 3UB2A 4P4LA 4IYJA 4GZLA 2HJGA 4WKGA 5ISMA 3TTTA 4N65A 3FTQA 3TO5A 2VA8A 5T4EA 2XVXA 3KP1A 5KYNA 2DEUA 4OGLA 2H8GA 5DBHX 1QKKA 2DZDA 2H9IA 1LSUA 2TYSB 4HI0E 1QV7A 4IIGA 3CG0A 5C51B 2XT6A 4EMSA 2ZRHA 3GXBA 4R7TA 3OZVA 3FGPA 3O95A 3RV4A 4ZRMA 3ZWQA 5FFFA 4D0SA 1YAHA 2QT0A 2X86A 3ESDA 2O3UA 4JN6B 3G2PA 4TQUS 5J1TB 2JFPA 3TIGA 3WYBA 4DKJA 1B23P 1H2RS 2QB5A 2X5JO 3N54B 4R7ZA 1SIBE 1PQWA 4M9ZA 3BK1A 1XMSA 4XCVA 3SIXA 1YA4A 3I0ZA 4FR5A 3WXMA 4BWYA 3T54A 3ZWOA 1RQNA 3H86A 1HOTA 1Z4NA 4Z51A 1NL3A 1DIHA 5LB4A 1T5DX 4CLOA 4REQA 3CA8A 5ILQA 2FH5B 4EW3A 1GDTA 3HB0A 2OP0A 1IEQA 2E5LB 2V9CA 4DV5B 1QGYA 4ZI5A 1C7EA 1R0KA 4F4CA 3CHYA 3NM5A 1RCUA 4DBLC 3CONA 2CJWB 2EZ8A 3E2PA 2X42A 4WE3A 3ABRB 5A5EA 1XRMA 4XH9B 1UBEA 5BMVF 3OQ1A 4RTNA 4TYPA 4OM7A 2OXIA 3VAAA 3PR1A 5B1EA 2HMYB 2I71A 1PS0A 1UOEA 5IJ9A 5IWCA 1VHLA 1E5VA 1A50B 1PZXA 2H8KA 2Q2VA 1Y8ZA 3GZTB 3IAEA 3NHUA 3UCXA 4B6PA 3FSJX 2HCFA 2GB4A 1OXTA 1SHTX 5EP2A 3ZV3A 3W7AA 3ADCA 1S7CA 5CT8A 1XVAA 2XT0A 3FRIA 1T9AA 2H1RA 2WZQA 3RC8A 1IBSA 3E03A 1DDIA 2FLKA 4GR9A 4HH3C 2VATA 5DYIA 3S5JA 3WL4A 1YJAA 1GRNA 2ATWA 3VDXA 3HV2A 1H6AA 3CUTA 3IXMA 2FFJA 3HCBA 4ARAA 5LM3A 5KQRA 3PNQA 3WLQA 4B4VA 1KEEA 3BC1A 4IO1A 3CUUA 4YMSA 3AI1A 4GKBA 2UZAA 1KL7A 1TMYA 1KI3A 1BOFA 4ACBA 1Q16A 5DHAA 4OP2A 2G80A 5KTPA 3U40A 1VMAA 3EOBI 3VR4A 1P9RA 2O8FA 1XZCA 2ASEA 3H5WA 1Q0QA 5HCUA 1LZKA 2WSIA 1GGVA 4HVCA 1JLLA 5AI8A 2R6CA 3G68A 3PJDA 5FTNA 2Q4BA 4A23A 4ITRC 2KS6A 4IL5A 2QTRA 3HMKA 2UUPA 4D9BA 4FI3C 1I7QB 2AK3A 2QJRA 13PKA 2V6FA 2NAPA 4QPPA 4RZUA 3Q8KA 1C3EA 1VLLA 4J0IA 3TI7A 3A7EA 4LY0A 3K5PA 3RIEA 3SC2A 4DV7B 1NUHA 3Q2OA 2D2IA 5DIFA 2JIBA 5F12A 4N40A 4G8BA 4KVFA 3ZHQA 3M6IA 1Z8DA 2OZVA 4LISA 3ZU5A 5J5AA 4Q9IA 1SURA 3FAZA 2EDAA 3K0BA 4F45A 1YIAA 1U90A 2PL1A 1NOKA 3D4NA 3QHPA 4Q00A 3MERA 4G84A 1W4BA 4FKZA 3U1TA 5TJ9A 2N47A 4E5NA 3QX3A 1XU9A 3HL4A 4CR6A 1KI1A 5JMOA 2Q5FA 1N6PA 3LDFA 4ID3A 4WN9B 4BB0A 1G1AA 3GK3A 3SKVA 4BCBA 1RHRA 4QXMA 3C41J 2GK4A 5TQ2A 1VCNA 4RETA 3K9LA 3GT0A 3O4IA 1W29A 4RUKA 2IOFA 1II8B 5HGJA 3HV0A 2HBYA 3KZKA 1WQ1R 4UTPA 5B36A 1V11B 2A33A 3AUYA 2VDVE 1TJ4A 2XSZA 4FMCB 4G5YA 1XDUA 3I30X 3OEYA 1Y1PA 3BL5A 4DVJA 2FEWB 3QWAA 5F78A 2PKCA 2P27A 4V3BA 2JIMA 4DYVA 1NW9B 1HL7A 1QM4A 1QVVA 2LV8A 1VRWA 3L7YA 4LC0A 1RWOA 2XNDD 3RDPA 1XVLA 2CHEA 3KJEA 3THXA 1P7CA 2HLDA 4BRSA 2NP6A 3PPWA 1MQSA 2ZR0A 4HRAA 2D62A 4JWTA 4AZWA 1Y4AE 1YQXA 3R8XA 1U5BB 2ZWOA 2OKGA 1RXYA 3EY9A 1JXAA 3JALA 2AUMA 3QJYA 4RVUA 2GESA 1VYUA 4IWXA 4Y1FA 5BMVA 1E69A 1FVHA 1NTOA 4AF8A 3UJ8A 4S12A 4DQKA 4DDWA 3AO0B 4JI6B 2D0IA 2P9JA 4ON9A 3DE6X 4JLBA 4CQJA 4ZQFA 3EX7C 2FAXA 3KCNA 4MS4B 2V3CC 3CN7A 4MZXA 4AO6A 2WABA 3QLEA 1A77A 4TX1A 3T7JA 3TQOA 4AO7A 3UT5A 2QUHA 1XO1A 5F77A 5SYAA 5D01A 3WWOA 3B1YA 1SULA 3JQGB 3OTIA 3WLFA 4DAOA 3IYLW 3CE9A 3G1UA 2OYRA 3QVJA 4Z1MD 4BMCA 5T8SA 1C4KA 2Z2YA 1LQTA 2BOVA 4MYTA 3GA0A 1QBGA 3G5LA 5J4VA 3EXFB 1NKTA 1TMKA 5J4LA 4NS4A 1MJGM 1XFAA 1DI0A 5J4HA 4XFJA 1XZMA 3BB3A 1AKVA 5ARDA 1XZDA 3F74A 4PYQA 3VOBA 3LO5A 3T4UA 3H1EA 1SIWA 4OKNA 3VV3A 2VHYA 4IDEA 1X80A 3S55A 1FFHA 1YZKA 5C32A 3K9NA 3L07A 1OIXA 1PA4A 5EZYB 2VDOB 2B92A 3A70A 4MQ4A 5C5CA 2FWMX 1PT5A 3KWMA 2FP4A 4FBGA 5DO9A 1CUBA 3WTBA 4DSNA 1L2TA 3M33A 1TA9A 5HRAA 4EBBA 4QAJA 1ULSA 4LAFA 2TECE 5KOIA 3I2YX 2IBMA 3EAGA 4GLLA 2HHHC 2X2FA 3I01M 2V0NA 3I8OA 1BCRB 2W2VA 5IDXA 2PZEA 5CZVA 2KW5A 3TM5A 4MI3A 3GLGB 3REQA 4OQDA 2CHFA 4KLNA 2IZ5A 2J5BA 1YR3A 3Q6NA 1JP7A 4KMMA 3W5DA 3TOSA 5JZMA 4CW7A 1M2NA 2Y6UA 3FCXA 1Y9AA 3IUJA 3FCEA 4HUJA 4WUVA 2IBSA 4G0UA 2MIIA 2Q0HA 3D2LA 2P68A 4P3XA 5LQDA 1RWKA 5FUMA 3CNLA 4WKOA 3U81A 2NO4A 4MPTA 1NXQA 3GO4A 1MXCA 5LBUA 4XCXA 3K71B 3EPLA 4OQEA 4UQPA 1PG4A 1GGMA 2D7CA 2XWBF 1U28A 4EMBA 4Q3LA 1PLJA 1ZOOA 2E55A 3KXPA 4FDLA 1VJDA 4WK6A 5TMBA 3RE1A 5CFLA 1BU8A 1P7YA 1QIGA 1HTBA 1GKLA 2Y0DA 3B85A 3BRWA 4HN4B 4FMDB 2VDWA 2IIBA 1LDGA 2J5RA 3N7UA 4L5CA 4MWTA 5AVJA 1CVLA 2EV9A 5BO5A 3SC6A 4NARA 3RANA 4MMZB 2OO5C 2B7BA 3BSYA 2FPPA 3BILA 1KEZA 3NOOA 4UE3S 4E33A 4AVYA 2IXTA 4K87A 2JH3A 2PDAA 4N12A 1TQ2A 3B5EA 4KQIA 4LIPD 5IT5A 2G04A 2O5RA 2IRWA 2BBTA 2BTQB 3RSLA 4GQBA 1CR6A 1IM5A 2PWYA 5BNTA 1W0JA 1M6XC 2WJAA 3TQTA 2ZCJA 2WYOA 2WJVA 2VZ8A 3MC1A 3IKMB 4P3NA 4RC9A 2OCYC 1NXSA 3VSCA 2GLTA 2JI9A 1H93A 3ZPXA 2JGFA 3OZXA 4D4HA 1TM3E 3ZJ5A 2DU8A 2PMKA 4V2UA 3GX1A 2CKDA 4H0NA 3TLGB 3V8PA 4P6VF 1QPBA 3OWXA 4HAOA 1H9AA 1ORRA 2YN4A 2Z5FA 1OXMA 4MTCA 1XRCA 2O50A 4DXDA 4DV1B 4Q9AA 1BOOA 1O6FA 1NNEA 5FOSA 1FXWF 4R3NA 4BBZA 3IS3A 3OVMA 5BQPA 5KCZA 2AOWA 2QU8A 4D96A 5DNCA 3EGXB 1AVTA 3HY4A 3O82A 4BNYA 3AY3A 1Q0HA 3G8CA 4DEXA 4PYJA 1DDGA 1XDBA 1T0IA 2DG2A 1GPH1 3PYMA 4JZYA 5FD8A 4B3DA 4NK5A 1NHGA 2ZB2A 2X2EA 5A7HA 4L9AA 3WSTA 2NTJA 2H2AA 3CZAA 3QLJA 3L1VA 4AROA 1ZJ6A 1S8AA 3IV6A 3VYUB 3X1KA 1GIAA 1XKQA 2A14A 2KQUA 1MEEA 3D1LA 4UC0A 1ZCFA 3UAWA 3NW9A 4Z0HO 2JAQA 4Q03A 3W5AA 5CURA 3KVYA 2R00C 3PVZA 4N5DA 2AH5A 4O5OA 1NWHA 3U7HB 1GUAA 1F2TA 5L6MB 2RGYA 1WKCA 2VAXA 4EJ0A 4KBFA 5TIIA 1Z2NX 4JODA 2UZ4A 4X45A 2C7PA 3TW8B 4TQAA 1C7ZA 2G82A 3WA7A 4UHJA 4O4JB 3KE9A 1FA9A 4QGSA 2RGBA 1J23A 3DM5A 3FYCA 1D2GA 1NFRA 2GF0A 2OUIA 4A0HA 1A9YA 3WWEA 1BHO1 1ZESA 4PUIA 1J22A 3RBVA 3ECCA 2IPNA 2QQGA 3T9FA 3P45A 4MS1A 2B0CA 2BJOA 1OYOA 3RJZA 2AKEA 3CRRA 1DL5A 2H2FA 1NUUA 4TL7A 1T9GR 3GFRA 4UM8B 1NA5A 2IYXA 1A9TA 2C95A 3NNDA 1W0KA 4FBLA 1SCAA 4ZJUA 4TQ9A 2C4KA 2HNKA 1I1QB 2HA6A 1T9GS 3A6KA 4U7WA 3R7WA 4BMSA 2IS1A 4KK4A 3UCFA 2QTFA 3KQKA 1CRWG 1G42A 1JQBA 3GZNB 2JNWA 3JATB 4Y2GA 4JYAB 3P9KA 5JTTA 2IUSA 1IZZA 1Y6ZA 4U00A 4UVGA 2ZRAA 3BAFA 1UOOA 3MTIA 5DN9A 3SZUA 3EG5A 4N8EA 4RAQA 4UEKA 3NT5A 4REQB 5CHEA 1QO0A 1VLHA 3IVAA 5CB8A 4DRXA 1EUYA 2BMAA 2AFHE 3EFBA 2D0PB 2IOYA 4A16A 5I7RA 3BCUA 3GLKA 3QUQA 4ZXFA 5A5VA 4R8LA 3U49A 2QL9A 3FJOA 1DCTA 4DV6C 1RLMA 4US2R 4EX7A 5FI0B 4A6EA 2V96A 1ZKDA 1JLMA 2X2PA 1U7DA 3EW7A 3QHQA 3ZG6A 4FB4A 4CIWA 3EBLA 3OURA 4KXUA 1RXWA 1Y7TA 2CFCA 2GEJA 3OZGA 2XWSA 3WMWA 5AOVA 2IEBA 1VE9A 3GL9A 4P9NA 1ESNA 4Q1EA 1CHDA 1F6WA 3TQRA 1KHTA 4DMCA 4OVKA 3OOYA 5BXQC 2VHTA 1KJIA 4J4TA 4DIOA 3CLSD 2QD2A 2QT9A 2O0LA 4M88A 3C87A 5CH8A 4AMZA 3R0IA 5H3HA 4EFLA 2ZB4A 3HZOA 5EMKA 5G4LA 1PDOA 3RVPA 1G4UR 3H9GA 4UTXA 4KR7A 1RG9A 4FZVA 4H3VA 1KEEB 1KH3A 1FXWA 3EIHA 3IP9A 4OQMA 3PC7A 3RRZA 1Q0PA 3FOBA 2DLNA 2ZKLA 2HW8A 2XUHA 4MO9A 3RF6A 1I6MA 3BJRA 3BFKA 3OMWA 1UBFA 2CFIA 4TLDA 4J4HA 1MT3A 2D5LA 2K7FA 4XX0B 3QA3E 2K2QB 4QOIA 4AQYB 3HUFA 4ZV4A 1I94B 1SVUA 1W76A 4QU5A 1UZMA 2VA9A 4QHSA 2O8FB 3H6GA 1ABBA 2IGTA 1C81A 3LUHA 4EF4A 1VIVA 1ETUA 3QKIA 3M4NA 4G65A 4LDQA 1ZC3A 2JLYA 1ONOA 2FPMA 2QMHA 1C14A 1E5LA 3ACBA 3LHDA 4EKEA 3U16A 2FFRA 1SXHA 3TNYA 3MBIA 1JG6A 1RVDA 5A2GA 3RODA 5BNZA 2QG6A 4BNUA 3EF3A 1V1MA 4EMUA 5JNTA 5CH5A 4GDFA 1MCZA 1OGIA 5D7NA 2WMOB 3AGPA 5ULLA 1T9BA 2P7HA 5DYYA 5JFTA 1FQKA 1U8FO 2C4MA 4WXMA 1DKRA 3JAKA 3ABQB 2W4QA 4YMIA 3SK0A 3CLUC 3DOUA 4P5PA 2FN9A 3KVNA 2VOEA 4LQ4A 1FYDA 4E5SA 1OBHA 3X1WA 1DXQA 2L82A 4FYKA 3DZ8A 4LJLA 2ZIXB 4DOMA 3SX0A 3N87A 1NFQA 3WLPA 3UG6A 3RQIA 3ZBTA 2I91A 5HKBA 2XUJA 2QGNA 2XB4A 4GI5A 1AZSC 3DJYA 1B7GO 4L8YA 1E3WA 1E8MA 3AI2A 3DYVA 4GX1A 5JSYA 4DS3A 1VIMA 4TTAA 2JJ2D 2HIHA 1XLTA 3C1TA 5FJJA 2COEA 2BONA 4YRLA 3DHYA 3L7BA 2H5JA 2VYCA 3DVSX 2HCRA 2QN3A 3NX4A 1XA4A 1IBKB 4GKJB 2OECA 4GOMD 4DDHA 5TQ2B 2X7HA 3UF0A 3GFVA 1P0IA 3VR4H 1ZW1A 1IEVA 2E7GA 1T35A 2PLNA 2VWHA 4HAIA 3B9RA 4MRPA 1NVAA 3TVDA 5GV7A 3D0OA 1NVUQ 3OO1A 3O93A 2ZQZA 2CL0X 3Q7EA 2HRCA 2Q0XA 5I3CA 2Q3DA 2WU0A 2JGNA 4JC4A 1AXEA 5KWSA 4E14A 4AS1A 2AQHA 2XUAA 5LQCA 1RDFA 3DOOA 3A1FA 3L40A 3T15A 1P1RA 2GAOA 3FD8A 4WINA 5I8WA 1AKTA 1G6OA 1SCIA 3TUFA 2AC4A 4N0PA 4HRVA 4RK7A 4YMTA 4U8HA 4N03A 3TR6A 2BR5A 4YAGA 5JYBA 3R5KA 2DQSA 1ZIDA 4TRMA 3UXMA 2WV9A 3LGSA 4FOTA 1ZQ1A 4ARZA 3CRQA 3KUCA 4KAFA 3NPAA 2X6TA 2ZR9A 3JALB 1TUEA 5JO0A 2FWIA 3DV0A 4EKNB 2FF5A 3OMXA 4BL5A 5BMVB 5KSPA 2GUGA 1JG1A 5HNKA 3LHIA 4PPNA 3GJ6A 1M7BA 1CBUA 1QQ7A 1ZIXA 2C9ZA 5AXCA 1CQIA 3DTVA 4BVEA 3T35A 3ZD7A 1PYGA 1T8RA 4KO2S 1DARA 3KZNA 3IHKA 3AUJB 3EARA 4XGQA 1ID8A 3GH1A 4ZYLA 4YJDA 5TS2A 4KFRA 3MWDB 3QRWA 3N70A 1GD1O 4G41A 3B12A 2JFZA 2P6UA 1HMYA 4KJXA 1SQSA 2XVMA 3PDHA 1FEZA 4V0MA 4Q9DA 3RS8A 4EITA 1KY5A 3T7AA 2ECOA 3LFHA 4RQTA 1N92A 4GVXA 3WGZA 4DJFC 2NACA 2YKGA 1E5XA 4N5LA 3BK7A 2CHUA 1CEQA 1HZZA 2OK7A 3LHSA 3PNYA 5EWLA 3RM3A 1O3YA 2Y93A 4E07A 1KO4A 1T0UA 5EE0A 3PT9A 3ICEA 1AU9A 1X80B 4L4RA 1R6XA 4RGVA 1XRAA 4TLMB 2VTBA 9LDTA 1LQUA 2X5XA 3NQ41 2DC1A 2ICAA 1UM8A 2QNRA 1LF0A 3IQZA 4UDNA 4Y2JA 3HCOA 1UPAA 4AY2A 1U1EA 3JQFC 3LSTA 3GGGA 5KPDA 3HM9A 2HMUA 3C7KA 1UT8A 5A3VA 1V7CA 1C3XA 2P9BA 1V7ZA 4BDTA 4O1HA 3AFHA 1R0XA 3T4XA 4CEIB 1QUEA 4R40A 4FI3F 1XKLA 1HDXA 1PWXA 2JKZA 2NT3A 4LSZA 4DT1B 3TNDA 4PRLA 1KS2A 3W8FA 2WYVA 3ZEIA 1BVRA 1VE7A 4IMIB 4C7OA 5AJXA 1YA8A 1JZQA 4DA0A 3VHQA 1H69A 4JP8A 1N2OA 1IPHA 1M6EX 2JGDB 1SY7A 2Q9UA 2WHYA 1HNZC 4EBFA 4JI4C 3KT0A 4FVTA 3LPMA 5DTEA 2CBGA 3EGCA 3EHDA 4QGGA 1ZDMA 2G63A 3M4XA 3X0DA 2QZJA 3ZNOA 1QZZA 2ZITA 3AHDA 3IB6A 4G0ZA 4DPMA 1KZGB 2ARKA 4GXQA 3HS3A 5BR4A 4G5QA 3R7AA 4MARA 4DMKA 2VHJA 4TT8A 4MW1A 2OV8A 1WKVA 4QEKA 2W83A 3LT0A 1P3Y1 2FPPB 3OCUA 5T57A 5AVTA 5I7FA 1H3FA 3B51X 3SJZA 3KQUA 2GZAA 1W5BA 2BC9A 3HGTA 1AE1A 4NDNA 3LQFA 3QWBA 3WLTA 3IAS6 4KR6A 5K0TA 3AR4A 1CS4C 1UR5A 5AKXA 2QS9A 2JL1A 4W7SA 1O94D 2WIJA 2JI4A 4UVHA 5DCLA 3JZIA 1VPDA 3F9IA 3WYNA 3C39A 3KKEA 3QVWA 4Q3EA 1NU6A 5DSXA 3PQ6A 5IDWA 3H87A 1IBLC 2WQZA 1MAAA 3WYAA 1RZVA 4A03A 1E3MA 4HZUA 2VK4A 1JX6A 2XZLA 4AK9A 1RQ7A 3ZXUB 3I6YA 2CFTA 4N6GA 2N9UA 2P0YA 1G8JA 3P9CA 3ZVLA 2J7PD 1B4DA 4TKVB 1FFBA 2XGJA 3EXIA 5I4CA 2IL1A 2Z43A 2V4ZA 1EB9A 1TM7E 3BGVA 3BORA 1F4VA 1FFXA 3CPHA 3K4HA 4K6FA 4K5QA 3LVFO 4NDAA 5EUCA 4AY3A 1JGTA 2B1IA 1E9RA 1IFXA 3IODA 4DIEA 4F3CA 1V71A 1LPBB 1NDUA 4JDUA 3KQMA 2C8VA 4C6RA 4X7BA 4F8YA 2H1WA 2PK3A 5J5CA 4Q1CA 4WY8A 1RI5A 2A57A 2BSAA 3KFLA 4YDQA 4FP9A 4WLVA 3WWCA 4B09A 1VKZA 5LYJA 1IIRA 1HNXC 1C7JA 1PYDA 1VGQA 2H1IA 1EP1B 1OXUA 3GVCA 2XTNA 4N18A 5J2TB 4ENPA 1MJHA 3LH5A 3EH2A 1Z22A 2HT6A 3SG0A 1TVEA 4LHXA 1FXUA 1M2EA 3A6ZA 4JJ4A 3TEJA 3TVTA 2AE1A 2MTBA 2QTLA 3TD6A 3WRXC 1I13A 5DF1A 4J0CA 2ZBQA 3LQ2A 1RNLA 3H1TA 4NQRA 3CUYA 4QEDA 4HTFA 3M4YA 3UW1A 2GTIA 5H9UA 1Z68A 4N39A 5ELXA 1FP6A 1Z6QA 4HCJA 4B2PA 4ATNA 1ISRA 4KPUA 2BELA 3QU9A 4MW9A 4HNTA 3V7FA 4KC0A 2X3UA 3AEQB 3L8FA 5K6AA 2AJTA 1F2TB 2B21A 1NW3A 2Q21A 2QMQA 3AHEA 4OAPA 5CW1A 5D6OA 4BHTA 4EGQA 2C77A 4RKRA 4P3KA 1XJWA 2ERYA 5AMXA 1LI4A 2A3RA 1NF3A 3TMKA 4HXEB 5M5BA 4PSCA 1ZJZA 2WUEA 5LFAA 4UTRA 5TQ0A 1LX6A 1PQYA 4YCCA 3DOHA 3QJGA 3BHIA 2E0IA 2VF7A 3EOAI 2WAOA 1ENOA 2HR1A 1O0SA 1P4SA 2OV4A 3D3JA 3H0CA 4WY2A 4CDGA 4EECA 1NBMD 2CMKA 2V97A 1OXKB 2ZZKA 5LLTA 1TXGA 1CKEA 3ZGVA 5FWNA 3A2NA 1WCV1 3BIWA 5CJJA 3OKCA 5L4LA 2O8VA 1Q77A 2J5QA 2GPYA 1Q15A 2ODEA 1DSSG 3WISA 4UUPA 4TTPA 4EO7A 2N42A 1WSAA 1KDZA 1U7HA 1DAHA 3R7WB 3UAGA 4A0GA 3A9RA 2IS6A 4LFCB 4YP1A 3QLVA 2ZCUA 1RE0A 3K2QA 4WD3A 4PR0A 1YFJA 1RJGA 5T8KC 5AW8A 1X8XA 3DEIA 5B2ZA 1CRZA 1XNQC 1N5JA 3SXPA 1S02A 1Z5NA 3HU2A 3LM8A 1GU0A 3IRUA 1T5HX 3TLAA 2AMYA 2C2ZA 1ZSVA 2HGZA 4P7BA 2EU8A 3LDHA 3TPFA 4N3AA 5BRJA 3SZ3A 1GG5A 2Z9DA 1SOUA 4OSEA 1U0GA 1JDUA 1YB5A 5ELMA 5A0FA 2OB2A 3SM3A 1MRNA 5EE9A 2VO1A 3T41A 4BDSA 4DIKA 1JWLA 2BE7A 1NF9A 1T2EA 1KIMA 4IGKA 3AY0A 3QW4B 4X6YA 1PW5A 1CZUA 3AJEA 4TSRA 4WNAA 1E62A 4H7FA 2C59A 4UD2A 4R0MA 1LD3A 3ZWDA 5GONB 2UVQA 2HSDA 3D7LA 3HP4A 1FFYA 5JG7A 5KCMA 1MPTA 3ORQA 4WK0B 3WGVA 1HDYA 1JPJA 3SHFA 5GZ1A 4NATA 1JHRA 1PV1A 2F4VB 3IRVA 4K9MA 3GCGA 5SZIA 3SYRA 2H1LA 3IALA 4AO8A 5IUNC 2VP3A 4UBNA 3L4KA 1JQ5A 4KSYA 1GPDG 3SJAA 3TLCA 4ZZ1A 3SLGA 4CNQA 1VL5A 4WKBA 2FSUA 4L16A 1VZ2A 1Z7GA 2XUKA 5BYJA 4EB3A 4LJAA 4TYMA 3W6PA 2XB8A 3O8OB 4JLNA 4QPJC 2NUTA 5M04A 1ZJ4A 2UV8A 3QXXA 5IH3A 3WLEA 2Z1DA 2R7MA 4DREA 3BQNB 1I6LA 4DWWA 3U2QA 1M6WA 4IJVA 1UFKA 5AW6A 1N5KA 2D2VA 2R6FA 2XF2A 3MXOA 1T5BA 4AAYA 2W0SA 1E98A 3C8UA 4WZAB 2HD4A 1P4JA 2KMLA 6PFKA 1IC6A 5P8WA 1OBFO 2JEZA 1XMXA 5DTRA 4B3FX 3VYRB 3JAKB 1TCUA 3WOVA 3CQ1A 1GAJA 1IIBA 2R65A 3C2QA 1PYOA 3ZI0A 1J0EA 1JJIA 2VNIA 1BFDA 3HJGA 4LNUA 2HU2A 2I7TA 3JSXA 1Q3TA 3K0KA 4P33A 4S35A 1HYGA 1BFKA 4ICIA 1D6MA 1UMDA 2JFFA 3MOGA 3CCBA 4ZPJA 1KOLA 3U44A 4WHMA 1NV8A 4XTRA 1W36B 1R4NA 3DGFC 2Y1LA 2P4EA 2FA9A 2R96A 2XWQA 2IDMA 1MRZA 5E9QA 4J29A 1CP2A 3H11B 3LLMA 4WW0A 3I37X 2F8SA 4F71A 4JQYA 3MM4A 1KPIA 1NMZA 4W1RA 2LKDA 3VHXA 1E2DA 3ZCSA 2PLAA 1TJYA 3I62A 1T0PA 3A2MA 3DAOA 4NCJA 3RJTA 1T34A 1W4RA 3K1AB 2VPTA 4UBJA 1R12A 4HB0A 4OAOA 4EFMA 5KBYA 4M99A 3HJFA 4GMDA 1TOAA 1YT5A 2IXEA 1ZNWA 3MINA 4JY7A 4LF5B 3IMLA 2LRHA 4BFSA 3EBOA 4M0PA 1YDGA 4JEMA 4M1YA 2GXUA 2BP7B 2EW8A 4L9WA 1A98A 5A3SA 2HMSA 1E3LA 5JXJA 4B3MB 4HQFA 2P9CA 3J80A 5B1DA 2WJ6A 1S4QA 2H08A 2VK1A 4DQDA 1Z15A 4GC5A 3WL6A 2ZB7A 3RRBA 1WPQA 2VXYA 5TPZA 3MILA 2H2GA 3OX4A 4XWYA 1RI4A 4I4NA 1BYIA 3SE0A 5BWNA 5AW4A 1XN4A 3RT7A 3SR0A 4B75A 5KSZA 2ZYUX 2CN1A 3TIXB 2ZYDA 4GZ5A 3GFQA 2C1ZA 3K5HA 4OJMX 3ZDQA 4ZHSA 1XTVA 4IOLA 3U80A 7MHTA 4BFYA 2O8BB 1P1FA 4KAJA 3VU9B 1E2UA 1K0FA 3IHWA 2ZT7A 4J91A 3OU6A 2J5KA 1IBMC 2JBAA 1GFSA 2O2SA 3OPXA 3VX3A 4L7IA 1AKYA 4UTNA 5LL6P 5G3YA 3TAXA 1U3VA 3PKIA 3DE4X 1QKJA 4MUJA 3GLHA 1G9SA 4R9UC 1GSOA 1MIOA 3I0MA 3MYYA 1QGZA 1BX3A 3R40A 4UOZA 4BCCA 2RIPA 1I4LD 2PAAA 5E6RA 1RWBA 3EPJA 1KFKB 1AHHA 1QVAA 1WE2A 1XVIA 2R5FA 1UZAA 2GZRA 3C3AA 4MI9A 4QTTB 1NI5A 2ADMA 4IXTA 3MRSA 1NVWQ 3A28A 3E84A 2QUIA 2W6IA 3ESAA 3O75A 2HSGA 4MPRA 4RH0A 2XF8A 2Q8QA 1N6NA 4UUOA 4A2WA 4DHEA 4ABTA 1TTTA 2VRCD 1SOAA 5FLKA 4ZI3A 2OHXA 2FPIB 1M76A 1USKA 2OD7A 4DR7C 5KKCA 4FTWA 5LQMA 3JAWA 4IJ6A 4EVQA 1X14A 2I6TA 3D02A 5DP1A 3UQYS 3CLVA 2ZBFA 3JYNA 5DIZA 1FUYB 1T8TA 1U0SY 2CW5A 2M9MA 2WC1A 2CNDA 4NCAA 4OL9A 4LDNA 1O4WA 3QFFA 4QUBA 2J4CA 3VNUA 3MSCA 5K3SA 2R87A 3L7KA 4RKEA 1B1AA 4CF5A 3N6VA 4KQ2A 4R1LA 1M1YE 2XJ4A 2H2IA 3MFYA 5FPHA 4BUCA 4IX1A 5K0GA 2OTCA 1R0CA 3BKWA 4MLPA 1XEXA 4CU5A 4R5MA 2GO7A 3PXUA 1KYVA 3SEZA 4BU0A 4E30A 1VKNA 5BY2A 4C7OB 4BCDA 2G71A 1PL0A 4AYTA 3EZ6A 1DKMA 1GA4A 3PIDA 3ILVA 5KTRA 2HQRA 4GR5A 4A8PA 3BICA 4DR2C 5CZXA 1WEKA 4S04A 3JD3A 4A10A 2IC5A 3TI9A 1KC1A 3M9XA 5IN4A 1QM5A 5FOWA 1LZLA 1JLRA 1RRMA 4TKZA 1SUAA 3LGAA 2G4LA 2P90A 1CERA 2GILA 3CWZA 4JL8A 1YR6A 4G8CA 4YJHB 6REQA 4NIMA 3PUZA 1XMPA 1KDPA 2GN0A 5KINB 1Y82A 5CDTA 3FYDA 4YX9A 3MCUA 4ITVA 5ADWA 2HOQA 1YVEI 3H2YA 4OK6A 3HI4A 3FB4A 1P6QA 2VLBA 1XX6A 1USWA 2XXBA 1ZRSA 1WUJS 2IU4A 2G5GX 3ZI4A 4BNHA 4FLEA 5A0TA 3LY5A 1TH5A 2LW7A 2VJDA 1MD9A 1A2OA 3AR9A 3OA0A 5HIKA 1O93A 4FK8A 1JF8A 2VQFC 1OF1A 3WGIA 4P3YA 4WKPA 3AEUA 3B1KA 2VSQA 1KS9A 3BVPA 2F9LA 1II0A 3KKOA 3UJAA 2O05A 5AUQA 2AN1A 2KLHA 5CVUA 3N6RA 3NGXA 2XBLA 1L5SA 1O6BA 1N6HA 2Z1NA 4IWNA 3JAMD 1DBRA 1XQ6A 1JAZA 1V8BA 3F7TA 4LHSA 3SPXA 4D46A 4JLKA 1JE0A 1IXRC 1JSCA 1S3FA 2VHZA 3DT8A 3LRXA 3FUCA 5KZMB 4J2TA 1PR4A 4L08A 3TRIA 1HDCA 4GM0A 3LXXA 5LNK1 5TLSA 1VYHA 3EXIB 4GXRA 2PV7A 1YB2A 2JLXA 3WQBA 1OZGA 5BVGA 2XYVA 3L79A 4YQFA 2WU1A 1KWKA 2QVZX 3GEHA 3IDZA 1T8PA 1ZCBA 3OJLA 4DJEC 4W9NC 5TRTA 4O5AA 1RRGA 2JFOA 2B35A 4IHJF 4LRWA 2G88A 3C74A 1PVDA 1YRLA 5JDIA 3SYNA 2GJ9A 4L74A 2YC2C 4TV9F 2YMPA 2RGEA 3GCWA 4FFNA 2MJLA 5HF6A 2E87A 3D3EA 4HKTA 1XCOA 3AETB 4Z9XA 2ZSDA 1BWSA 4QFCA 5DE3A 1SVOA 3ORSA 3OJXA 3G7SA 4O2AB 1M83A 3WDKA 3DOEA 4F1KA 4NBLA 4Y9UA 2NSLA 4O2LA 1JB1A 3IVRA 5HK8A 2AD5A 2VIIA 1NN3A 1R74A 1M1NB 1HSZA 1XCGB 2NGRA 2DUNA 2WT8A 3DWIA 3KLPX 4D79A 1RE1A 2W2OA 2FP3A 3AI7A 3R3ZA 4H4EA 3TB4A 4PCLA 1XVUA 3B9QA 4P7FA 4BKMA 4WX2B 3KWFA 3IOBA 4KPUB 4DE5A 4L6IA 3H9EO 1LH0A 4BKQA 2BFDA 3AEZA 1ID1A 3ITEA 4ASUA 1DIBA 5JUWA 3E4CA 4LY3A 3K8ZA 4F5WA 4LK3A 4ZI7F 3N6XA 3UA3A 1U63A 4ITUA 4FT2A 4Q7MB 3PFKA 4PHGA 2OY0A 4UM9B 4FTFA 2ZTHA 3WHKA 2ZFUA 3BKXA 3IOEA 3KU4A 3OE7A 4L28A 3FJYA 4JB3A 4LDAA 4MJ3A 3GOQA 2ETVA 1L9XA 2XRMA 1U8YA 4LDRA 3TB6A 3X2EA 1NURA 2HRQA 3E3LA 1RI2A 3QNWA 4ZRDA 3SKXA 5BWOA 4MDFA 4YUWA 3CPEA 4JLSA 5DP2A 3T99A 3FOEC 4AECA 3R5SA 3P71T 5EWJA 3HK2A 1RC8A 3EVBA 3OJWA 4LDZA 1QHGA 3IBFA 5E1OA 2LDBA 3AR6A 3MN1A 3GJSA 3L7IA 2QYOA 4IV5A 4HJXA 5D5PA 4ZZ0A 2Q3MA 4GOJA 2PH7A 1SA0A 4GRAA 1SHUX 1U7OA 4YRSA 3V7YA 5AVKA 1PSWA 4FE4A 1B16A 2WSSD 4NABA 4WKNA 5F1KA 1IN6A 2ZANA 4Z9FA 2SHKA 1XD2B 4M0EA 4U9IS 5AJYA 3KVRA 4PNPA 3V8BA 3ICQB 4EPXA 3W5SA 4FGUA 1HE2A 1ULBA 1AUQA 1XQ9A 1YFKA 2ZTUA 3LWZA 4FZ3A 1TK2A 4Y6GB 4AYWA 4FR2A 1OILA 4L4XA 4HYQA 3T3EA 1E4YA 3GQBB 4LZOA 5T41A 4JHLA 2H07A 3NUGA 4I9GA 1ZX1A 5CT6A 3IVMA 4BNFA 3N2LA 3SJBA 3GJTA 3GLIA 2JLWA 3D6FA 2A6PA 2IVFA 3F6RA 3NANA 1SKQA 1FL9A 3MS7A 4JLAA 5D87A 3NVDA 2C9DA 2FTKE 4D25A 2VRWA 4UREA 4JR1A 1JXOA 1SXJA 1C1YA 3S0JA 2I4MA 4TMWA 4ZC1A 4B8YA 4B7AA 1LK5A 4HNAB 5JV5A 1VGRA 2C5GA 3HBFA 4KSBA 2XQFA 4XPZA 5KYXB 3T52A 1NRWA 1E9AA 1OI3A 2Q6OA 3GIDA 5BN3B 1X9HA 1Z2AA 1J7KA 4HB3A 1UKKA 1GY8A 1I2AA 5CUQA 5DZSA 3V7UA 4YT8A 1R5OA 4BUZA 1QFJA 1JKXA 3N9IA 1ATZA 1OAOC 2PZLA 2M6KA 2EYQA 1CD5A 2OOSA 2WJ4A 3I08A 4PYLA 3X1DA 4CHTA 1JT9A 1UZUA 2E9SA 1DO2A 1I2MA 2I62A 2X8JA 3EEQA 3QOXA 4IHJA 4IX9A 4M0LA 2Q4DA 1ZEMA 2YW9A 3D81A 2G9RA 3IBGA 3MS2A 4L3VA 1L5OA 4TV9A 3WLNA 2PX8A 3T7EA 1G21B 5ALLA 3IDFA 1NV9A 2VKQA 3QLUA 2HO5A 4OUKX 1K63A 2Y1FA 3PWSA 4AICA 4IXWA 3GEDA 3HYTA 2BHTA 2HJ9A 4Z49A 2OCKA 3CGGA 1VCMA 1JKIA 4P4TA 4L27A 1CY2A 1I01A 3AW9A 3VH4A 1QDUA 3AUXA 3UXEA 3IR7A 3LPCA 3UQZA 1VL2A 3UUFA 1NIJA 4AJHA 1K97A 4TMKA 1H3NA 1D2MA 5LIPA 3DBLA 1NZDA 1D7OA 4OQZA 4LNUB 4X65C 2KDNA 1SOVA 4MZDA 3CPJB 4YGYA 5E3IA 5JAMA 4R9VA 1TUBA 3OLQA 5C53B 4ZI7A 3N1UA 4FOPA 1EEXB 3W2FA 3ZIAA 3U44B 3JQFA 1ZA2A 2ZM6B 2XXAA 4QDTA 4RZQA 3EPPA 3RT9A 1UWDA 2G6TA 4DSAA 1L3CA 1R5JA 2ZRMA 3NUZA 1ZAKA 4IZHA 4YR7A 3UPUA 3LL4A 4Y2PA 2HIGA 1EWTA 1U8AA 2IEIA 4J4BA 5EJ6A 3OICA 4IDPA 1NMYA 1DUIA 4QDUA 4DCTA 5FA8A 1QQ6A 4J75A 5DSZA 3UAYA 1QU2A 1B8OA 2HK9A 2XDAA 3BJZA 3Q7IA 3SE7A 5HKOA 3I9NA 3PNBA 3K3PA 4HYTA 2JD2A 3JWIA 3V4SA 3VR6A 1AKUA 1VPWA 3P26A 1I5OA 2AEMA 4HGYA 5G3ZA 4IKEA 1F4LA 1YZVA 2MYTA 4W8GA 5DHQA 3HA5A 4Q02A 5EWMB 1V45E 3HRHA 5A19A 4G1EB 1V6SA 1E63A 3C6MA 3MINB 2QOEA 2G08A 4R31A 1Y4SA 3MCZA 3PUJA 3WHIA 3JX9A 1N0VC 2X9GA 5EIEA 3RRMA 2INGX 3TDNA 1PEYA 1MIHA 4KN6A 3C3YA 4OMFG 3WDMA 5KHAA 4YUAA 3ETGA 1SMKA 2W00A 3JARB 3REOA 4BFZA 4KGXA 2I76A 4TROA 3SIPA 4CV2A 2ZRIA 1X7YB 2E85A 1INLA 1D04A 1YWGO 4R54A 4OBXA 1DO0A 3H2HA 3V1LA 3DE1X 3GNSA 3CQ2A 2JVJA 1MZPA 4NMLA 1CQJA 2W6JA 1FVOA 1KR5A 3GWZA 2PZKA 1YRYE 1GG9A 3FYSA 2KYRA 3LWDA 1G8KA 2Z2KA 4GMGA 4CZ2A 5KHOC 2DTDA 2Q8PA 3ZV5A 7REQA 1RYHA 2JBAB 2WY2D 1VG8A 4MRSA 1EWVA 1ZM3A 3OQJA 3NI2A 4P81A 5E7QA 3BDVA 4ZVKA 2VN8A 1IAQA 2YY7A 2QP3A 5ADUS 3AX6A 2WOJA 9ATCA 5AKGA 1P4HA 1AGNA 3H6HA 3WDLA 1IU9A 3OQ6A 4M83A 5E6RB 1CUUA 2PPVA 1OJ7A 2X4DA 3FM9A 1UKZA 3M3PA 1LK7A 4ZVNA 4KX3A 3ZV4A 2C78A 1Q74A 1Q7CA 3CVUA 2QY9A 4NE2A 5FR2A 3DE0X 4YRBA 2X0NA 3HYLA 2XCTB 1EFAA 3RUHA 1REQA 5L4NA 3E3NA 1RAFA 2OCBA 2ZWIA 2CLDX 2RAPA 1C9NA 1XTRA 2PA3A 3N0XA 3P1JA 4LZLA 4HDRA 3DC2A 4N5IX 4PZDA 5JW6A 3JAWB 3D4IA 3V8EA 4AWAA 4MRMB 4IGAA 3WXBA 2RSLA 2RC6A 5DJ5A 2NSDA 2CWDA 2JBWA 1YUNA 1NDHA 3KQWA 1PQUA 3EERA 1YO6A 2WPNA 4PYRA 3UJ6A 2QL5A 1AD2A 5JCJD 2AI3A 3EFOA 4I5FA 5AOAA 2VCEA 3B20A 1FFDA 2ALJA 3G0BA 3I53A 5GTDA 1VHTA 4HHEA 4XUCA 3UUWA 3ZWYA 2GSDA 5ICFA 3EIOA 2FPSA 4DA7A 1U98A 4OD0A 4KR3A 2BFBA 2PLFA 1NUTA 4F2GA 3OTGA 3LVRE 2YFKA 1XEXB 3SIRA 3ZDYB 3O2NA 4J07A 4E94A 4WS9A 2AOTB 2XNSA 4AJ2A 4DA4A 1RLTA 4Q34A 4K0BA 1ZUD1 1TQDA 2JW5A 4OSOA 2JKVA 3BM5A 1BW9A 7ADHA 4F96A 2PUGA 2CUNA 1V3UA 1GKKA 2CEAA 3K96A 1FP7A 2FUNB 1DX4A 3O92A 4TMXA 4TTJA 3PUKA 1G2PA 3V4RA 3U13A 4ANFA 4OHOA 2W2XA 1AQJA 3LYUA 3RHFA 3WIDA 3O8QA 1WXDA 2AJCA 4OX9C 2VF2A 3N5CA 4XDGA 4FOLA 3K9WA 5TDHA 1ILWA 3FNGA 4ZGWA 1A8QA 2EKQA 3JSAA 2IXGA 1QVWA 1RPTA 1W4AA 6REQB 2AFIE 1C50A 3JQ8A 3NEYA 4ZN6A 3NIFB 2OMKA 3WJ2A 1WD5A 4BX8A 4IEIA 1RPNA 4B9AA 5M2QA 2FLVA 2GLUA 3IX7A 1XU7A 3ZGNA 2QD1A 2PD3A 1WH9A 4ZDJA 3S8MA 5G0TA 3IO3A 4MQEB 3KTDA 4A26A 3P9YA 4H7JA 1S3IA 1YGYA 4H1TA 3D6UA 3TZQA 1ECFA 1RXSA 1X86B 3X1XA 1IHOA 1YQWA 4OV6B 4V0SA 1MORA 4LZZA 3ZK9A 4YR9A 1Y89A 5JHHB 2A9PA 3GLFB 2WUGA 1SRQA 3D31A 1DIOB 2BISA 2HQSA 3D4OA 3PK0A 4GPD1 2DPMA 4KEAA 2XKJE 3NBMA 5EHQA 5A04A 4JOSA 1JDZA 4O3FA 1ZRMA 3EEOA 3ZHBA 1OH8A 3NOQA 4WFJA 3IAAA 1UJ4A 4DV6B 1CS0A 1FDIA 1R37A 4JUCA 3KQSA 1VJGA 1NBEA 4QBKA 4FCVA 5BVGB 1UDAA 1I3KA 3Q10A 2B34A 1KBQA 2GN9A 4A36A 1KEVA 1T9DA 1K7EB 1KFJB 3HZRA 1AM4D 3OJCA 1EFHA 4E3WA 4YACA 5SZJA 2FKNA 4P8RA 3L4BC 3O1HB 3E5HA 5CMLA 2B5OA 5EKDA 4IZOA 3HEMA 1NQAO 2PXHA 4P7GA 4P4SA 4XWOA 2QWXA 3DB1A 1NMSA 5I7EA 4P83A 4CN9A 8LDHA 5FBKA 1Y8RB 3NP7A 5BQ5A 2GJSA 5HVNA 3CNBA 1V7QA 3QE0A 3AIMA 1HE5A 4F9FA 4ZGBA 2D7DA 1X8KA 4OQFA 3DL2A 4Q4AB 3ZS9A 4LBVA 4RSMA 5F1PA 5TXGA 2JKYA 3SC4A 3UV3A 1NE7A 2QVYX 1K8YB 4JBLA 4P93A 1YBFA 4DLPA 3ZE1B 5ICSA 5T8TA 1N0IA 5KUTA 1TLLA 1CUIA 4BWVA 2CZQA 1YDMA 2H4XA 3DMFA 3TSZA 4JUFA 4HVAA 4Q12A 5CK4A 5LDGA 3DQZA 4QPNA 1L4UA 4QL3A 1CYEA 2RCYA 4HUQA 3RVJA 2AQKA 5HKAA 1YVUA 1HH2P 4IHKA 1KYQA 3IULA 3GCZA 3LDAA 1KETA 2COKA 3P27A 5HUQA 2CZCA 3SQXA 1ZHFA 1KU6A 4XOIA 3V8VA 1OKKD 2G4CA 4GGMX 2M5HA 2V55B 3F6PA 5KDLA 1N57A 1JQDA 4CEJB 1RRVA 4ZCPA 1JKMA 3HJTA 1I51A 1H23A 4NNOA 2QRPA 1ODFA 2A59A 4AZ3A 3T3OA 4HRXA 2VSFA 1L4BA 1GQSA 2HA2A 2CXHA 2HREA 5EWJB 4X1KA 3EULA 4KITB 4GDMA 1YHYA 1AUXA 1K9SA 2VRBA 3SDZA 1R6AA 1X1AA 2D6FA 1MFZA 2O2DA 1ZVJA 1N2XA 1F0KA 2B8JA 1H6CA 1T6YA 2GBPA 3DZDA 4MV4A 3SLKA 1E4EA 2C07A 2GI4A 2NIPA 1EZZA 3QI2A 2PYIA 4I55F 3RWOA 3UWOA 4DBZA 3OY7A 1PG0A 2JHAA 3MCVA 4GFDA 1AH2A 5DEOA 1JRLA 2QPAA 5F64A 1WPRA 4RK0A 4JT9A 4CKEB 1USIA 2AMLA 4QGHA 2V7VA 3JYHA 1LPAB 4U39A 3FCCA 3HN6A 4PRKA 3HSSA 4BLQA 9ABPA 2PSFA 3ZN2A 2IYNA 4HLUA 1N7IA 3DZCA 4D1YA 3Q7TA 3PTAA 1THMA 3G0HA 3PNOA 4O0MA 1DMRA 1UC4B 5KNDH 4LYHA 3KR0A 1GDHA 1MP0A 4CNBA 4Y2SA 1EX7A 2CXRA 2EJBA 2GA8A 4N5HX 2ISQA 2IEDA 2C3UA 2LVBA 2QT1A 1SH7A 4O59O 3VC2A 3OIUA 2RDMA 5A6VA 5TMPA 3AIOA 3VNVA 1C4WA 3IAHA 3FPAA 4IWYA 3B5JA 4X71A 5ALXA 4EUKA 4AKSA 3E3OA 3KB8A 1C9EA 1S2OA 1XSEA 1J5EC 4HNGA 4G8DA 3H7IA 2P3QA 3RKSA 2ZSHA 1XTQA 3GGPA 1CE8A 3HO1A 3WG9A 3HXMA 4J2OA 4ESEA 1PJ4A 1RKBA 5CLFA 3HDVA 3KOYA 4PCAA 4ER5A 4P4NA 2Q6LA 3VV2A 1JG4A 3I3OA 2WM8A 3GGDA 2VH2A 2YJ6A 2ZB3A 4JEHA 1S2GA 3MMZA 4ODIA 3CVVA 2WWTA 3FFWA 2A94A 4TV9B 2PU7A 5G1OA 2IOHA 2KSQA 4OB6A 2Q7XA 4D9GA 1ISIA 4I3GA 4RIEA 4I5IA 2XCSB 1RTTA 1U0EA 2BJHA 2X23A 3QPBA 1A4UA 3N8KA 2CXPA 3R6DA 4NJOA 4H3SA 2X0EA 1NNI1 1TZ2A 2YNMA 3EE6A 2YZGA 2Z56A 4WZZA 1TC1A 2PT5A 2O7VA 1CY1A 4MCJA 1E2EA 1M2VA 2XMPA 1GO2A 4PXSA 5BWMA 5IC4A 4QARA 4D0NA 2VH1A 4H6WA 1PTJC 2EKZA 4XFKA 1LXCA 3VNSA 4DSTA 4KXVA 1BVHA 1RR6A 1Y1QA 1H6DA 3VMMA 1SU8A 2C2HA 1DHRA 4J0JA 1D6NA 3B2QA 4F84A 3Q9UA 2R48A 2ZYSA 1N2CA 3ZYCA 4B7ZA 5HK9A 5TQVA 2E1PA 2JK0A 3ACDA 1M2FA 2FGJA 3DBLB 3OT5A 3R1IA 3S5UA 3PPYA 5CU7A 3TCXB 5B4UA 2X8LA 5JJ5A 5K2OA 1JEYA 3LHFA 1WIWA 4EY7A 2C5BA 2QRKA 2ZI7A 4G3XA 4W6QA 5A4MS 1WXIA 1RYYA 5J4YA 4XUDA 4J9VA 3NKFA 4J43A 4NECA 4FHFA 2B2XA 3D4PA 2CVFA 1KHHA 2G09A 3ETCA 1F51E 4S24A 5H0IA 1TZMA 1WS6A 2ZRCA 7YASA 4QELA 3L3BA 4P92A 1AOXA 3BN3A 2IHBA 1TKCA 2WWGA 3FMOB 3I92A 5J63A 1F3LA 4FCWA 1D8AA 3PF8A 2BV3A 5AESA 1UXOA 1UJCA 3FYTA 3WQSB 2I3GA 5KVCA 4NBVA 1VI5A 1GSIA 1KDTA 2EJCA 3OEHD 3DVQX 4LN1A 5B37A 3L02A 1RC1A 2IDZA 1HNZB 1OFHA 1SJ9A 3KO8A 1XAHA 1E2PA 5CJPA 1Z56C 1AO0A 4JI4B 3CLSC 3T0FA 1PWEA 3AP3A 4I55A 2SECE 1SUFA 1V8OA 1T36B 1Z4JA 4DNXA 5JQWA 2FDXA 2ZYWX 2EP5A 2QW0X 5G4KA 5FV4A 4HMQA 3QG1A 3LP5A 2ECQA 1YOVB 2NO1A 3LBNA 5JD4A 2RE8A 3VVBA 4K9KA 2ZPUA 3JV7A 4PLPA 1W9HA 1L5HA 3CLHA 4INJA 4KTTA 5GIPE 1L5WA 3Q72A 5CPFA 1JIIA 4HWSA 3GYGA 5KNCD 1SXIA 4GOOD 3RIGA 5JS8A 1X1BA 2DBYA 2AGVA 4I36A 1V60A 3NCTA 1RQPA 1ZGGA 1OFUA 2HN9A 2VJCA 4WVFA 4RADA 4HRYA 4NYMR 1IBLB 4K2AA 3AUSA 4RL6A 1JIQA 5FJIA 3CLKA 1ZH8A 5FFNA 3OMLA 1OLXA 4BMXA 4WMLA 4HGZA 2Y1KA 3MJCA 4IH4A 4U3JB 4NBNA 4JKOA 4KMRA 4X8MA 4YLYA 5JNVA 2VTDA 2VWGA 3Q0IA 3X3HA 1Z8HA 5JJIA 2ATCA 1Z25A 3RG2A 3MJDA 4XVRA 1QFXA 3FZYA 4I5EA 4TTTS 1BKDR 5MGNA 1E2JA 3ZCQA 1YFZA 1RPJA 4QJ4A 1VLJA 4UD6A 3RIYA 1L5KA 3TRKA 1FX0B 2R6JA 2VYVD 1WTCA 1JYFA 2MMAB 1FU8A 2Z57A 1J56A 4URHA 3ZW7A 5BYAA 2G6BA 5IXSA 1KFEB 1IG0A 3P2YA 3PD7A 1F2DA 1DCFA 1MJNA 2FZGA 2EFEB 2JIZA 3I61A 3NRJA 2VJPA 3DLTA 3U17A 1HNXB 3RTDA 1KKUA 4KE9A 3N8GA 4KO4S 5EUQB 1FX1A 1SAYA 4G5XA 3RU9A 1FRZA 2POCA 2HSZA 1TW2A 1H85A 5MHTA 1W19A 3KT8A 4ZAVA 4M0DA 3NASA 2IHZA 3W05A 1TCVA 4XX2A 1Y8CA 1E1RA 3QBVA 3P2IA 1X7XA 4QT0A 2BM8A 3T5BA 2X0JA 3SYLA 1XK7A 1WM1A 3CEJA 4CQLB 4G5RA 2HH9A 5JAUA 2EQAA 2XE7A 2NU7B 1KI9A 1QG0A 2QTTA 2R44A 3KQTA 3B52X 4KLRA 3GVPA 4LKRA 4PZAA 3UNXA 1OU0A 3W5IA 1IY0A 3WIVA 5JAOA 2BCGY 3J81k 2C7OA 3AKCA 3F67A 4YMWA 2H1CA 2NNLD 3VPHA 2GZMA 1EZ4A 3A32A 3HI6A 4NMWA 4ZAWA 3URKA 1ZC4A 2PUBA 3MYRA 3B9BA 2IE0A 2N46A 1RVV1 2PX5A 3FDJA 1WXEA 5A4FS 3IH5A 4UPEA 4C4TA 3O8QB 1A69A 2CCJA 4XD7D 3HR7A 2HPZA 3P0EA 2CK3D 4I81A 4U1RA 3HXQA 3JR7A 5DK4A 1HE4A 1PDWA 1V5WA 2RAUA 3SQLA 1ZN8A 4JNCA 3ZWVA 4DZTA 3NBQA 4LWOA 4NG5A 1A4IA 3FHCB 3B6ZA 4IDFA 5FBVB 3QHAA 1FSPA 3A6FA 1ZYUA 2FCRA 3BXEA 2RI6A 5IAJA 3RYCA 1AA9A 3ZOZA 2FZCA 4L5JA 2HU7A 3V4FA 4EG1A 3HWWA 3KJQA 4KWHA 4R8MA 4JUBA 1QZ3A 2RGDA 2WJGA 2P2LA 3O2JA 4MWEA 4B82A 1CLUA 1P2VA 4C3OB 3MGBA 1CJUC 3X1ZA 2DQZA 2VJKA 5EI5A 4J0HA 1IN4A 4XYGA 2NP7A 5DYWA 1L7XA 1M75A 1QIFA 2NUPA 4ZO8A 4CTMA 4Q3NA 1XNQB 2WFZA 1KI6A 4Q7EA 4K8RB 1CDEA 3U3XA 3S1LA 4V03A 5IF3A 1Z7EA 4YRRA 2QTNA 3DZFA 4UXHA 4WKCA 4EKIA 4XWWA 3WC4A 1IWPB 1CUCA 1BRMA 2GYUA 3I0NA 5BSVA 3I9MA 4PZUA 3NR2A 2HQ1A 5DM0A 1D4ZA 2HEIA 5CNKA 1OHHA 2Q1SA 1QS0B 3ZLVA 4E7OA 3K0CC 3EQ8A 3DGEC 1JQJC 3TLEA 5SZKB 5A7FA 4DCVA 4LRQA 3ORYA 3EZ7A 4JBWA 4TQGA 4UHEA 1T2DA 1DFGA 3IELA 3DMTA 3AB7A 3KKQA 2ZI5A 1IY9A 1HURA 1IXZA 1YV9A 4NOKA 5KAMA 4EGFA 1GZVA 1CQPA 1N8SA 1BNCA 2OVBA 3AUKA 4QDZA 1DIAA 5IAKA 4BMOB 4BP3A 4G4SO 3WJAA 4BGUA 3L7CA 3TGPA 1NC1A 4P4SB 2MCFA 1QIHA 5FORA 1T6BY 3OPQA 4C06A 2AMJA 2RD2A 2C2YA 2C1XA 4KJZA 4BYGA 2PT6A 2BGJA 2IOFK 4I1VA 4PPGA 1YZQA 1U2DC 3F6YA 1I3CA 4M60A 2E37A 4TSFA 1T3SA 2BKLA 1T13A 2BZGA 2DUWA 2J0UA 2JLBA 2PT9A 3IAUA 2HXYA 4G0YA 2YFYA 4IHQA 3GFBA 4I4IA 2OPBA 2GBLC 2QP9X 3M5PA 3NAQA 3LT1A 4KUGA 4UXIA 4CUJA 3U9TA 5EIHA 1NMXA 4EJSC 5JTUA 1P39A 2HSEA 3FUXA 4MHSA 3GMSA 1R9NA 4FFWA 4MGYR 1VMEA 2AOVA 3QPDA 4R1PA 5HG0A 3T8YA 5GY7A 1JWAB 5JCPA 2YV4A 4HUQB 3UK7A 3VKWA 5IANA 1NRJB 3I8XA 4DR6C 3E48A 2D5IA 2DCMA 3AVQA 2REXB 3L6OO 3ZK8A 1O9HA 1SKYB 2DH6A 1JHYA 3EA4A 4RVDA 3COVA 3T9DA 3LCMA 4EG0A 3EMVA 3FAKA 4FQ7A 1ECLA 5K0ZA 1N5DA 1OBOA 1UDXA 3Q4GA 1KK2A 3LPAA 3OU7A 4RPHA 5EZQA 1UKVY 1G20A 2F8LA 4MCAA 3QXJA 1GCUA 4OHWA 1KORA 1ZW6A 2V58A 4W5OA 3COPA 5EEHA 1O95A 2GBGA 1W88A 3OCVA 4M0MA 4YIHA 2R6ZA 3COYA 1Z34A 4MDHA 3RH0A 2HKIA 1H3EA 3H9JA 2E4UA 3GU3A 3KSBC 3OQHA 3OT1B 1OMOA 3L9XA 2MSLA 4UEOA 3HMQA 1WSDA 3F78A 2JHFA 5JI2E 3DZHA 1E0SA 1SG9A 3LX5A 4QGFA 3S1AA 2GF2A 3EGOA 3QMVA 3VPBA 2D0DA 5IFLA 1SXQA 3EVCA 3ROEA 2WSMA 2WTBA 3PFWO 3UA4A 4ZCTA 5JBNA 4JLVA 2YUIA 1UP7A 4YJFB 3WOHA 1BRTA 3EUFA 2G17A 4GPIB 1Z4IA 1AT1A 1XJCA 4ZQGA 4UCQA 4C6SA 3F5QA 5ANRB 4DADA 4EB6A 1Z47A 3QKUA 4FUTA 4BN4A 4OMUA 4REMA 4FDUA 3EDCA 4RTKA 2Y1GA 4NOJA 4NPAA 1W2GA 1AGPA 5T6MA 3UK2A 3I8SA 1W75A 3NATA 2HIMA 4X64C 1MJ5A 3UMGA 3V7WA 3NV7A 4ARBA 1VB5A 1Y1KE 4TT3D 2H59A 2CLSA 2PS1A 2R86A 3AY7A 2HF8A 2TSYB 3P0IA 4O4HF 3PNVA 1GNRA 1JDSA 2WFMA 3WRVA 1M6HA 2WBLC 3QX9A 4LGYA 4KUEA 4WBNF 2C1EA 2UUOA 3GGSA 2XKAA 4PO8A 1GQFA 5CM8B 1EK6A 3IOCA 2ZBPA 4B7XA 4JLDA 4KIFA 1KVSA 1NJ2A 2ACVA 1IBMB 1PGPA 3HA7A 3HUUA 2ZIVB 1FTNA 3L1KA 3IEUA 2PR2A 4EG7A 1MOPA 2ZE8A 4BJHB 4CI9A 3J81D 4XCQA 2LXNA 3EVZA 1DC8A 3SQMA 4D8WA 3Q7QA 3KLOA 3AZQA 1M2VB 1DBVO 2MU1A 2RHRA 4MCIA 4B6RA 2XPCA 1AG9A 1EI9A 3KPUA 1OGJA 4UHCA 2OFWA 4PTYA 4FS3A 2V03A 1DGQA 1EUCB 3CVOA 4X7MA 1TLFA 4OQNA 4TGLA 3W0LB 2YXEA 3C1OA 2EFCB 4GVPA 3O3OB 1N2CB 1DJOA 2BY4A 5KWVA 3AVXA 4DR7B 4MUKA 1VSQA 5IN5A 3SAJA 2CU6A 2ODTX 3BXOA 1ZZEA 1SXGA 2XH8A 3VKUA 1LC3A 1DJQA 2ZLBA 1PCXA 4GOKA 4Z8YA 4CRWB 2P2ZA 4EHNA 1KPHA 2H92A 2MSEB 3PFNA 4EQZA 5LWHA 2JASA 2PU5A 2VP4A 4KE6A 4RCVA 1DWUA 4KO3S 1IJFA 4OFWA 2DFTA 4ERNA 1Z17A 1M7GA 4I14A 1BD3A 2DULA 1PR6A 1U4NA 4D5GA 2P20A 3RLFA 3T3NA 3TAHA 4BLRA 3HG7A 3I5UA 4K1LA 4QXRA 4XJVA 2XNCA 1NUQA 2P2DA 3ZJ4A 2F9FA 1PFKA 3MT0A 1R0SA 3G2QA 2P3OA 2QLJA 3A6EA 1GN9A 1L4FA 3N74A 5LLSA 3V1UA 4BVJA 2DOKA 2ZT5A 3CMMA 2UUBC 1WZUA 5TT0A 4BEVA 2XXJA 1ZCAA 4TMFA 2Z2IA 2HHCA 3DMYA 3QPWA 4LQCA 5AQEA 3PITA 3C3JA 1G3MA 2OGSA 2MR5A 2CUZA 1NJFA 3D54D 4JSTA 5JSQA 2PH1A 2WUFA 1SQ0A 4DR4B 2H7XA 3FWYA 1JHVA 1DAEA 3KSZO 5G0UA 2C82A 2X0FA 5GZ3A 1ZVQA 3ADKA 4HH4A 4MWGA 5ESWA 4EHJA 4DMRA 2E3JA 4MUBA 4XI9A 1A7UA 3PXCX 4RFSA 1Z63A 3KJGA 4KR9A 2X14A 3TYXA 1C7RA 1MX3A 1NBHA 2IW3A 2UYYA 3R9KA 3BXXA 1D0SA 1P4AA 3OP1A 2CMFA 1Z6AA 2GF9A 2FETA 5LU8A 2VQFB 3REGA 2ZUEA 3RWMB 2VP5A 2O8DA 3IUEA 4M9QA 1TEZA 1T1GA 4HPVA 1TYCA 3UZ0A 2AOXA 1G8AA 3MTEA 4HGRA 3KXDA 4QBTA 3BG5A 4LOJA 5B55A 4D8TA 3LK6A 3GMIA 2LR0A 4MA5A 4MKZA 1WHTA 5EPOA 4DLZA 3BMOB 2WTAA 3FUUA 3RB8A 1GWNA 4O4HA 3VH2A 1RYFA 1F17A 1YS9A 3BGDA 3V8QA 2EWVA 4IGFA 2XNJA 4M49A 5CJ2A 1QTIA 1D2NA 2D2EA 3TDEA 5T3YA 4CT4B 5FAXA 3ZY3A 5KNBA 1GGFA 2X9QA 5ALYA 3DZKA 2DPHA 2IIQA 2OLJA 4WBNA 1MNQA 2HYDA 5L3RA 5AOBA 3THOA 1Z37A 2BVNA 3RFUA 3BYZA 2CYAA 3QU7A 2CJXA 5A06A 3LBAA 5DT2A 3O7WA 1YRQA 1J0DA 5D51S 4F11A 2ZSIA 2ODPA 3EPKA 4WERA 3L4BA 1JAIA 4XQ9A 4PHHA 3UZUA 3DMNA 5H7XA 4E31A 3IQGX 2DR2A 2Z6AA 3W6OA 4EFKA 4IF4A 5KNLA 4KWTA 3ZCVA 1MC5A 2XUFA 3E53A 5H1YA 3P9NA 2H0AA 3PHLA 3EYWA 4CTKA 3GEBA 3AFIA 4DNOA 3QV2A 3P5BA 1E9VA 3G82C 4JXZA 1MFPA 2OVFA 2BSQA 1T4MA 1X7XB 2B99A 2HDHA 3RSZA 1Q92A 1T9KA 3E15A 3B2NA 4JELA 2Q3JA 1UODA 1PJQA 3C6BA 3RYFB 5ALNA 4QTZA 1OOEA 3GA7A 5F5NA 1UP6A 1H8HA 2MMGA 4INPA 5TEVA 3STWA 4MVWA 4JJFA 1FRNA 1BXGA 1FYXA 1PQ4A 3DTNA 3G9QA 4GSLA 4REOA 4F60A 2CKMA 4G86A 1FFGA 4NNPA 4C4OA 1M74A 5BR8C 3VZDA 3AM3A 1JYEA 4V0RA 4BUJA 5HYVA 1MQ9A 2F8MA 1T4GA 3QVKA 5LQUA 2C2BA 2F6RA 1DRVA 1TPZA 5J3JA 4DYHA 1HR0C 2AFHA 1IB6A 2ON6A 3A4TA 3ENWA 3O2EA 4G1IA 5CYGA 2V7GA 3DW3X 1HNNA 5DWVA 1TMGE 2G76A 5ALGA 3QTLA 3D1VA 3E5MA 3C3BA 2E82A 4KFUA 5DXJA 3VDRA 3PGMA 5EP1A 4QLAA 1SBHA 3NDJA 1U7XA 2XTMA 5DV9A 1T3TA 1FS6A 2FLWA 3FROA 4UCWA 1EDDA 4CTOA 4BQEA 2BPOA 4WZBA 2Y76A 3PNPA 2EOAA 4TS1A 4Q7LA 3JQ9C 4YQYA 4X1YA 3KQNA 4P7JA 1VSUA 4LOAA 4AKTA 1FZTA 2C2KA 1MW9X 2GYYA 1RLJA 5E4YA 1BE0A 1H66A 2A2ZA 2OQIA 4KXLA 4RFLA 1M6VA 1P33A 2NNWB 4IKOA 3ASZA 4QYXA 5ERYA 4Y2QA 2NYVA 4F9TA 4ETNA 5EUBA 3CMCO 3ZE9A 3PP8A 1C1XB 1ISFA 3JS5A 3COJA 5DISB 4IDOA 1AY0A 1K2WA 2XTZA 1G2IA 3HU1A 4HS4A 1KQ3A 2EQBA 2WU4A 3EH1A 3D8BA 4RF5A 1VPEA 3OM9A 4A1FA 4B33A 1EFRD 1XXHA 2ZEJA 4YV0A 3FPBA 2HRDA 5JSFA 1OI4A 1N2ZA 4LHEA 5KTKA 4OHPA 5TGZA 1RLOA 3V34A 2UXCC 2ZQYA 4GP7A 2FEKA 4AQ7A 2LKCA 1SCKA 3NVKI 4XRRA 3KPYA 3BTOA 3TZHA 2IF2A 3CH5A 4MITA 4UASA 1AF7A 4Y6RA 5BORA 4B5LA 2VQDA 1EUQA 1E2IA 1GEEA 3HJBA 1JXMA 4MW0A 3LVBA 4B74A 1EQAA 3OE5A 2DWQA 4AG6A 4U7PB 3Q5GA 5J47A 1QRRA 3BH0A 5A9RA 2ERCA 4EATA 2XMCA 3JR3A 3EWAA 4EPRA 1RU3A 2GD6A 1X13A 2JDID 4TXJA 5LA6F 3H2SA 5KWJA 2Q5EA 3AB8A 4RJTA 3PNMA 5IEBA 4BNNA 4YRAA 2X4LA 3I23A 4I50B 4W6ZA 3DDCA 2I65A 3PXEA 5KYUB 2G1KA 3BCRA 1K8XB 5JMWA 4MXDA 2IF0A 2FR8C 2J0UB 4RA6A 4UEQA 2VRNA 5DMHA 3WSWA 3A9SA 1BHQ1 1MAVA 4D9KA 3K70B 1YMQA 1KI4A 1V8PA 3FI9A 4MPPA 5FHRA 2D13A 2H48A 2W6QA 1L7EA 4QYIB 3RC3A 2ZRFA 3CX7A 5LJLA 3TAUA 1QYCA 4MUXA 4GICA 4RMHA 1X7ZA 4RLQA 2AYXA 2FWJA 2ZU6A 4X54A 4IOKA 1VDZA 1TI7A 1R4MA 1SKBA 5FBZA 3UTCA 4CMCA 4EVIA 1FJGC 4E5DA 1KERA 4XJTA 4CF4A 2RB5A 3NU1A 1OB2A 1PTJA 1H4SA 5LJIA 1BN6A 3B13B 1PD0A 2QTVA 1KVRA 4S1NA 3DTYA 4G0OA 2QSUA 3EISA 5GAJA 4HPXB 1QVZA 3HLKA 4R0NA 5I7OA 2BE9A 3O7MA 1KSHA 1NT2A 5DTQA 4LSWA 3I6MA 4F4IA 4X65B 4OU5A 3A6JA 4K7JA 2CLFB 2GEKA 2OAEA 3CF6R 2AD1A 2OGWA 3HCDA 1BJKA 4ZDWA 3S8YA 1AQIA 4MVJG 1QCDA 3NTOA 2FSHA 3T7CA 4HAVA 3PSAA 1CX9B 1Z4KA 1P60A 2VYND 4B3GA 1OIVA 2H54A 5CVDA 3ZIDA 3P9PA 3OZIA 1NYTA 4UNQA 3CBGA 1E2MA 3IBYA 2BGWA 3GDOA 3R3UA 1GP2A 2B36A 2AXEA 4MAFA 5T4HA 3WGJA 2DSNA 3HUDA 3KR1A 1RADA 1N3BA 1V4BA 1DC6A 2OQ2A 2VZ0A 1FOEB 5B1IA 3BE6A 5ALUA 4Q15A 4DCJA 1JZTA 1MLDA 4XYEA 2G9ZA 2ONYA 2QN6A 2RBEA 1H2YA 2ZRQA 3EODA 3NT2A 4QO8A 3G7UA 5FYQA 5AVYA 5KOYA 2WHRA 5JU6A 1I7DA 5AI0A 1F8UA 3M6MD 5DB4A 1VGVA 2GPNA 1MAHA 4MICA 2HM7A 4YXFA 5K45A 2IP2A 1WSWA 3C5HA 4WEOA 1Z33A 1ZI9A 4MV0A 3H9QA 3ISJA 3H2TA 3K2IA 4MWZA 3V4LA 5K0NA 3MCWA 4OHCA 3HVRA 2C3YA 1O9TA 5EE3A 4E15A 3BWYA 2H1SA 1PG3A 3AMVA 1V8FA 3VOTA 1SC3A 1MABB 2C9CA 3H2GA 4PPFA 5HRCA 4HATA 5JPCA 1JXQA 3NZEA 3RKUA 4OPMA 2C4HA 4MUNA 5CT9A 1VBNA 1JH8A 1P75A 1SC6A 2C2MA 2FSFA 2W9XA 2XUIA 3O1LA 5A6SB 1SD1A 3W06A 2WSBA 4I2VA 4H4DA 1DG3A 2I6GA 1KC3A 4J7XA 1SD2A 2B3TA 4F2PA 2CVPA 3B3AA 3TW6A 1PZGA 1TQ6A 1E2LA 1XAJA 2ZAGA 3GEIA 4XGNA 5DX0A 4F12A 5IASA 2YZMA 4C20A 4EUSA 4Y9DA 4F5DA 5B7QA 4CL2A 1W52X 5KJEA 1OFVA 4F3RA 2RGUA 4L85A 1GUDA 2VQ6A 4RJKA 1EDOA 5HS4A 1NJ1A 4AKHA 3G9UA 2G9UA 1W1WA 2J85A 1XE3A 5SY6A 1JKJB 4B5KA 3DCIA 5LA6A 1MF7A 3DO8A 3PTLA 3UYKA 3V9PA 1DOAA 1USUA 2XA9A 5A9TA 4Q7QA 1UIMA 2VNAA 2OBBA 4UNPA 5GJVC 3ZH9B 1R6DA 4HK4A 4LE2A 3D7KA 3NIBA 4ND7A 3O3NB 3WRWA 4PC6A 2WNHA 1QYVA 3GNTA 5AM4A 2ZIGA 1TYBE 1UBUS 5JNRA 1FDRA 3VNRA 3DXZA 2N3ZA 3C3XA 4PZLA 4TSKA 5JH7F 5KTYA 1SBNE 3AJ9A 3S2IA 3WI7A 3IEKA 1JFFA 5E6SB 5LBTA 4BBJA 1G6Q1 5AO9A 2ISCA 1HZJA 2E8CA 4YPFA 2AUTA 4F91B 1RWVA 2W22A 4H6XA 1G2QA 2QMZA 3FSGA 4M0CA 3B6MA 3L8CA 3RVBA 3ACCA 1VSTA 5JQGB 1PKEA 3IUNA 5HOQA 3HDQA 1YZUA 1FLDA 4N5MA 1B2LA 3HR4A 2V9PA 2CLEB 3O8LA 2PQ0A 3NHFA 1H05A 2CJFA 2ZG6A 3KEOA 2PN1A 1BS2A 3X1MA 3PHCA 3QEOA 4JR0A 1WXQA 2J7KA 1UBLS 3Q3HA 3ZZ0A 1QQ5A 4PGGA 5J5VA 1A0OA 1E99A 1IUOA 2DTEA 2JFUA 3PHGA 4JJKA 3RC2A 4DGQA 2G40A 3Q40A 1ZOPA 4QVGA 3ZH2A 4D4KA 3RUFA 1DO8A 1D5CA 1M67A 1ND5A 1XG5A 1VP3A 2QDXA 3E3MA 5JNLA 3G3EA 5KS2A 2JI8A 1FTQA 4Z4FA 3B48A 3EQ2A 5EJGA 3WAKA 2XMGA 3ZY4A 3HH8A 4WBSA 4OX9B 3K9CA 3TQSA 2F2TA 1GZ3A 3CRVA 4PFJA 1BGWA 3NB0A 4WCFC 3SR3A 1LVHA 1BGXT 1N9GA 5T67A 1M0TA 5FT9A 5JDCA 4I1PA 2GCPA 4NPCA 2EZ9A 4JQSA 4MVJF 1W94A 2GHRA 3OF3A 5C31A 4HFMA 4RFSB 4D0RA 4J1QA 2WJZB 3O90A 1NQTA 1JBEA 1SR8A 3E58A 3JYPA 4U9HS 3UFBA 1K7YA 3IA2A 4GAEA 5IUKC 3AOEA 4LY9A 2AVNA 3EQZA 3VDQA 1JR3A 2EGTA 1N2FA 3RVKA 3MD0A 1E9DA 2XQJA 2GZ1A 2G9QA 3L06A 5GV8A 3VTFA 1KMHB 2BM0A 4WFIA 4DQUA 2P9TA 1KQFA 1TL7C 2Q9AA 3A1UA 3BFPA 4RO0A 4AJ4A 4BWGA 2A1UB 3N2KB 4HNHA 1JMKC 4B47A 2Q2NA 1XF9A 3GP3A 3JQAA 4B6OA 3EIWA 2OCXA 1BIFA 3N76A 1F12A 4RESA 4O4HB 1YB1A 3UAZA 5K8VA 1GV0A 3EAQA 3GLVA 2J07A 4G0WA 3SS8A 2QAJA 1G2OA 5TMEA 2P8SA 5DM4A 3CXUA 1JI3A 2JIDA 3FRHA 3K0CA 5J4KA 1Z12A 4NJMB 5DGCA 3PDCA 3HABA 2CYCA 5BXYA 4P08A 2PJUA 4M1QA 3C0KA 5CX1A 2PE5A 3ENZA 4AKGA 5COBA 4NENB 5FQNA 4C7VA 1CZRA 3K30A 1M2GA 3WBFA 2PKEA 1IRIA 2XE4A 2GARA 2YZ2A 3MJSA 4K6CA 4TZ0A 1N0HA 2C2WA 2VT3A 3T5CA 4CLRA 3DZBA 4K2HA 3KBOA 4AY4A 1MU0A 2YXLA 1A95A 5CPBA 3FETA 2YH2A 3FGOA 2I2CA 2Q3EA 2QM7A 3O1IC 3ZTYA 4O2BF 2DYKA 3OBIA 3UX3A 1LQ2A 4F46A 1N3YA 3OIYA 3GDGA 3UMBA 2Y1DA 3VUEA 5JH7A 3CVJA 3WMXA 1XTIA 1HYBA 3OIWA 4ARUA 3ANMA 4FWBA 3ZW8A 1EE9A 3TOCA 5JANA 1FYVA 1BXGB 2IQ5A 3JYOA 4AD8A 1E1CA 2RHMA 4LMAA 1A5SB 1EHCA 2VQ3A 1BWRA 4LMRA 5AVWA 2AKYA 2NCLA 3R5JA 2CB0A 4H0FA 1CIJA 5TGDA 2BKAA 1JN0A 1OLUA 3WO0A 1OH7A 1DBPA 4OY3A 1AKWA 3BMQA 4N7MA 5AVUA 4OSPA 2VAMA 2AN4A 1NI3A 2AFHB 4CM4B 2QZZA 4CQNA 1G55A 2B1JA 2R62A 4CDMA 3A6GA 4PR3A 2J0EA 3EF1A 3KSMA 1O97C 2GPWA 3BH6A 4OI4A 2WEKA 4DJJA 3RUAA 4IH9A 3SBDA 3V8NA 1MA3A 2P2NA 4JXKA 2IYYA 3OSZA 1DEAA 2Z9BA 1U2GA 3WFZA 3EMKA 1OR8A 1R0LA 2QRJA 3RWBA 1T5OA 2P9EA 3BWDD 2O1WA 3FWPA 4X91A 3S2EA 4N49A 3BGOS 1K5PA 3EEYA 4K9LA 4X1YB 5BSKA 1C41A 2Q3CA 4R1SA 2CFSA 2G36A 3SFVA 4C5CA 3VA7A 3CTMA 4A2PA 5HX7A 5LPNA 1QX3A 2ASVA 4R9NA 3WBKA 4EB8A 4D80A 2J7PA 4FC7A 3MD9A 2QLTA 3ABIA 2AZ4A 4OGWA 4UHDA 2PWPA 2QLBA 4MVJA 5EKXA 3WK9A 1NOIA 3IT2A 1EKXA 3ZHCA 2DGDA 4IHAA 4CWAA 4C30A 1IWBB 4BFTA 4RXTA 4E2YA 1BMDA 5GQSA 3QBJA 1W5SA 1DVRA 2W2TA 5LKRA 1WQ4A 1OWOA 3IDSA 1OLSA 2EZ4A 1WL8A 2HLNA 2P9QA 2PLWA 3LC2O 5K0LA 4EA9A 3UK6A 3FBGA 4NU0A 1VCOA 2X9NA 3BEOA 3WZMA 1J21A 5E4JA 1QYRA 4AJLA 1SQ6A 5FUXA 3O4RA 4IUDS 1RBYA 2ADFA 1SCJA 2JFBA 3R09A 4BFXA 4KNYA 4ND1A 1EE1A 5AOCA 5HFJA 3UGTA 3KTAB 4NBKA 4P2GA 3G8DA 4EZEA 4W8OA 5TVGA 3AF3A 4IMPA 4LBYA 3H4TA 2M98A 1ZJJA 1P6XA 1BS1A 2JRLA 3EZ2A 4B17A 1C2TA 1NU8A 4RZ3A 5ITWA 1MN6A 1Z2EA 4FD2A 2C2GA 4P35A 1DBIA 1Q2UA 4IPTA 2JANA 4IBOA 1RMYA 2O7QA 5HZMA 1H22A 4RA6B 1B8PA 1I7PA 1JAXA 4IIBA 5IULC 3ONWA 4J0GA 1X8LA 2FVXA 3QKTA 2H1VA 3RK4A 4G9BA 3GJYA 3I9V6 1YQUA 3U4DA 2LDXA 3LA8A 5AHRA 5I7SA 3ZZNA 1MRSA 2VEOA 4HX9A 4LYGA 1TJPB 4MKFA 2QLNA 2W6NA 2WE8A 3GWGA 4PGAA 5FUBA 4DWOA 1UWKA 1G9TA 1JR4A 2A0XA 1X7ZB 4BECA 5IVPA 4O2BA 1KOGA 4Q7JB 4WLNA 3LBIA 3HJNA 4IICA 2JGMA 4MNTA 2ZIZA 2H4HA 3DAHA 3I4FA 3WVNA 3WQRA 3LFTA 1ISPA 1V16A 3B6KA 4KN9S 1N2IA 2SKEA 5KQSA 2XW6A 3P2EA 2PS3A 2GAFA 3BMXA 3TQFA 1YH3A 1SU6A 2BR3A 3K2EA 2OYSA 2YINC 1U0FA 3CU5A 3I6BA 3QE4A 3WNCA 2FPGA 4QREA 1W85A 4WGFA 3V5NA 1XUOA 4Y9TA 2W11A 5KTMA 3AR8A 1USPA 1GNQA 1V6CA 3DFUA 4MS3A 3TQQA 2IWRA 3H4VA 4PTZA 5FR1A 2BYTA 3G85A 1UMCA 4BB6A 1G19A 2C4WA 3DBRB 1RAEA 4YMLA 4UHHA 3F1LA 5BURA 2JFNA 4BTEA 1UJ2A 3G2MA 4MHOA 1C7QA 4DMUB 5KVVA 3L92A 3CVWA 1W87A 4ODJA 3MJRA 4I9UA 4KR0A 1H4TA 2WIKA 3A0RB 2ZDGA 3KLMX 3TTXA 3D6MA 1GKIA 5AICA 3ZWCA 5E3HA 3NWPA 4TKUA 4QRIA 3SXUA 2GYWA 1PZMA 3T61A 3SSNA 4CM3A 3PEEA 3O0TA 5CXSA 4HC4A 1J5PA 2QI9F 4YPVA 1H4QA 2GH1A 3H13A 1ZICA 4LA4A 4L4YA 4GL2A 4DUZC 4YJ2F 4UHKA 2UVPB 3CZMA 2IEYA 3L6DA 4U2DA 5NULA 4C0LA 1P19A 2ET6A 4DARA 1P74A 2PJDA 4HLDA 3F46A 4JWKA 2ZUTA 1VIDA 2RJNA 2VP6A 3NONA 1E1NA 3KUDA 3OKFA 1VA5A 3L5OA 3Q5DA 4UMFA 2V5UA 1QP4A 2XQKA 5F2NA 2PX3A 1ONSA 1TPYA 4BNGA 2PM8A 5ALZA 3FNRA 2OO4A 2P5UA 1ZVVA 1VE1A 1UDRA 4N3GA 2R4UA 3BCHA 1KE1A 4HDQB 3WK7A 2Q99A 1N4AA 2PQ2A 2UZ1A 4RDHA 4PWYA 3SP1A 3O4HA 4G1BA 2WINI 3M2PA 4DQVA 3MAGA 4V0NA 5FXMA 3VR1A 3FTDA 3DPSA 3EVEA 3TZ6A 3EHEA 3QVVA 1JG2A 3A04A 4EEXA 1KO7A 1JQEA 1T4CA 4GBGA 4OK3A 4U2GA 4UM5A 5KYKA 2ANCA 2OPHA 3OZCA 3ZHVA 1QG2A 2OGTA 1Q6YA 4HFRA 1IM2A 1P0FA 1RMQA 1WW2A 3IKVA 3P2KA 4TS3A 1U1CA 4V2IA 3CLTD 3DOIA 1M1YA 3WLMA 4EF6A 4EW1A 3R5TA 3RKRA 1W6UA 3SNHA 1CV2A 3AR2A 2NADA 4UZFA 4J3NA 2NU9B 4E2XA 3A2KA 1DELA 1RZ3A 1NVDA 3STHA 4PYKA 3LXUX 4EF5A 5A4JA 4OI0A 2JGLA 3V4VB 3VDMA 1RP1A 2G5CA 4V0KA 4G36A 2J08A 4G0NA 4NX2A 3N59A 5DOZA 5F9MA 5KX5F 4DJDC 1MG0A 2WUDA 5CVCA 3ZGYA 3K72B 3EVFA 2A5LA 4FKBA 4K9RA 3HZZA 5FI1B 5JR3A 2ECPA 5KMGB 1FMTA 1WB4A 2ID8A 5DNAA 3L01A 2XMZA 5I47A 4E7PA 3UMVA 2YV5A 3VRHA 2OFFA 4QBGB 1KNQA 1RHJA 1XJQA 3U7FB 2I1QA 3CV3A 2ATXA 4JEIA 1P4EC 4AU1A 1SUPA 1VHJA 4KIWA 3CR7A 5CT4A 1ZNQO 4KV7A 2ONKA 3GLUA 3ILSA 1PFYA 2QV0A 1WVIA 2RHHA 1ABEA 2OHVA 2QP4A 4XWGA 1PT7A 1NYEA 4L15A 3VR5H 2VYQA 1JQLB 1TZBA 2CF5A 1IOVA 4BFCA 1WZNA 2OO3A 3N2GA 1CQWA 4Y30A 1Q1QA 3A6HA 4IFEA 4BBYA 1UDCA 4JITA 5LQKA 1H2FA 2ZRJA 2BH2A 4JFRA 5B58T 2B4KA 1BX1A 1KI8A