2Y4NA

Paak1 in complex with phenylacetyl adenylate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
428
structure length
426
Chain Sequence
PLPLEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
molecule keywords PHENYLACETATE-COENZYME A LIGASE
total genus 147
structure length 426
sequence length 428
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y4nA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y4nA01
4D4IA 3LAXA 3VNQA 3LNVA 5D6NA 4R0MA 4G37A 3T5AA 5BSTA 3WVNA 4RM3A 4GXQA 1PG3A 5BSUA 5BSWA 1T5DX 4IR7A 4R1MA 3EQ6A 4IZ6A 5E7QA 4RVNA 5BSMA 4RMNA 4M46A 1ULTA 2P2BA 3VNSA 4DG9A 4D4HA 4W8OA 1MDBA 5BURA 1MD9A 3RIXA 3FCEA 4FUTA 3U17A 5BUSA 2P2JA 2QVZX 5BSRA 2P2QA 5BSVA 2VZEA 2Y4OA 3B7WA 3NI2A 5DWVA 5K8FA 5KYTA 1MDFA 4PZPA 4R1LA 3DLPX 3IESA 1PG4A 2QW0X 2P20A 4GR4A 4WV3A 4RLQA 3QYAA 5K85A 4ZJZA 3WV5A 3L8CA 2QVYX 3RG2A 1T5HX 2WD9A 5BUQA 2P2FA 5KEIA 4D4GA 3WV4A 3E7XA 4G36A 3ITEA 1YJ7A 4OXIA 3O83A 4ISBA 2QVXX 3R44A 3IERA 4E5DA 4U5YD 3CW8X 4RLFA 3E53A 1LCIA 4LGCA 4OYCA 1AMUA 2D1SA 5IFIA 4EATA 3IVRA 4RVOA 2Y27A 3CW9A 3PBKA 3VNRA 3GPCA 3KXWA 3A9UA 2P2MA 2D1QA 2D1RA 4D57A 3DHVA 2VSQA 3E7WA 3O84A 3TSYA 3FCCA 3T5CA 4D56A 1V26A 1BA3A 2D1TA 3ETCA 3LGXA 3NYRA 4RM2A 5DV9A 3C5EA 1RY2A 4GS5A 2V7BA 3A9VA 2Y4NA 3T5BA 3U16A 5GTDA 1V25A 3DAYA 5KYVA 5JRHA 3O82A 3G7SA 3NYQA 4FUQA 4DG8A 3IPLA 3IEPA 4GR5A 4GXRA
chains in the Genus database with same CATH superfamily
4RZ2A 1Q15A 1DC4A 1M6HA 2FZKA 2P5TB 5SYMA 2R79A 1Q20A 1DBIA 3AJEA 1EU1A 1F1BA 2A30A 3JQBC 1G7RA 5ILQA 1L7EA 3AO0B 5L7WA 1YQUA 3WRWA 1KDRA 4NU6A 3H2TA 1UZAA 2XYQA 4LZPA 3UJDA 3EDYA 4J9UE 1ZVJA 1U0TA 2NXEA 2XDYA 3QU2A 2FRXA 4MRMB 5BN5B 4CBVA 2EKQA 4OB8A 4ETIA 5BN1A 4QHYA 3WJ7A 2JASA 5EY5B 4JLWA 4G0NA 4JKOA 3T7AA 2BFFB 3PDIA 1M2KA 3FROA 1NOIA 1THTA 2RONA 5DWDA 5H16A 1A7AA 1E9DA 2F3RA 4AWBA 1AKVA 5BV1A 4FMDF 3INRA 3ABIA 1MHPA 4XUGB 5K1ZA 4AYTA 1NF2A 1V2GA 2AEJA 3JD2A 3QVTA 4MTNA 4I4NA 4QUIA 1KNQA 4DWOA 1VYTA 2XDAA 4N18A 1Z4KA 5BW5A 1JHAA 3TW8A 3KQHA 2PBRA 2YFYA 1USIA 1XFDA 1E3MA 1MG5A 2GRJA 1Y33E 3NAZA 2BI4A 4ZAFA 4L74A 3ZCQA 5KTSA 1DAMA 1XTVA 1KAQA 1Y9JA 3LP8A 3MEQA 5G0TA 3ZS9A 4B3HA 2GDZA 4G26A 2YY6A 3ZWCA 3L8MA 3WGHA 1KARA 4GQIA 5DTEA 3ND9A 3BD9A 5HCUA 3DMYA 1PJBA 1SVNA 2HHJA 2Q45A 3HADA 5LOVA 4MDHA 2EKDA 1EVZA 1ZOIA 2AH5A 1V47A 4ZJZA 2R2GA 4H1VA 4YJ2F 3E22A 1YB4A 4YP9A 2CCJA 3WGLA 3VHRA 2BKLA 1M34A 5MFZA 4Q00A 4MW1A 4CF4A 3P5BA 2Q5LA 3ZWMA 3TOVA 2QGNA 3UXHA 1EUYA 1IXKA 2QMOA 2Z6VA 1YUNA 3SJBA 3T4UA 3TMYA 2D74A 5C32A 1AXEA 2CEKA 3WA6A 2NYUA 1U0GA 2X5JO 2VC2B 3C85A 2ALJA 2AYXA 3I1IA 3UPUA 2X2PA 4LJ8A 4EKDA 2GNAA 5FUBA 2HWUA 3NU1A 1G9SA 2RK4A 1YDGA 2IKSA 3LBIA 4UTOA 5DZSA 3RTEA 4TS9A 3CONA 3WAKA 4ZGGA 3DNMA 3U39A 2RHWA 3BGIA 4C07A 1B23P 1YA8A 4XTRA 1HDCA 3NMUF 2D3WA 1AT1A 2VNIA 4CMIB 1A9TA 5HKKD 1QG0A 4TL7A 3R7LA 5K4GA 1B8UA 1EINA 1TX4B 2QTNA 3U4GA 1E3SA 4XQCA 3HXQA 1KE1A 3U62A 1WQ4A 3VR4A 4YLYA 3ZWKA 4JBLA 2D54A 3STWA 4DKJA 4PQGA 1GL6A 1CQZA 3FPFA 1YVDA 2XHEA 5EJ8A 3OO0A 2X9NA 6LDHA 3QX3A 1YZHA 2BBTA 5G0UA 1IUPA 2PL9A 2P2NA 4AJJA 2ZTVA 1U6KA 4O63O 5K0SA 2W6JD 1C7QA 1C4KA 3IKMB 2ZJ7A 3NXSA 3EXAA 2ZG6A 3OQVA 1KWKA 3KSUA 1N75A 4TZTA 3T5BA 3DE1X 3LYHA 2OP1A 1EA5A 4G5XA 4F7DA 2X1VA 5JW6A 1A9YA 4DTCA 2W22A 4EGCB 2B69A 1NXXA 3EMKA 3DW3X 4B43A 1H6DA 3EC2A 4E46A 5GONF 4JYAB 3I12A 3I8OA 3DSRA 3NVMB 4A7PA 1L3BA 1OBFO 4DR1B 3HCRA 3KAKA 5F9FA 3EXG1 1U8AA 4XFJA 4QYIB 2I80A 4HT3B 3W5DA 4K6MA 5CM8B 3S7ZA 4R9VA 1UFVA 4CEIA 1V1RA 3QFSA 2CY0A 2G06A 3VHLB 4OPMA 3WNBA 4POOA 3B7GA 4G0QA 3U4DA 4JI1B 1QTIA 4LC0A 5B1EA 1OILA 4GL4A 3AEUA 4E5SA 2W48A 4JP3A 2WMYA 3H19A 4YCJA 4N41A 2VJBA 1LS6A 1EUCB 3REFA 3V33A 4F3YA 4O8ZA 2HT6A 3DCIA 5I4KA 4Z0TA 5C7IO 5JCXA 4NDNA 3L7AA 4O3MA 4EH1A 3HJRA 2WUFA 3N7AA 2X22A 1AV6A 3F97A 1XU9A 2E82A 2W2LD 4BN0A 5BN3A 4A92A 3NT4A 4NAUA 4Q7EA 3U6KA 3HP7A 2WVGA 1OCEA 2ZBFA 3UZUA 3WXMA 3IBYA 4CWAA 4EZEA 4PC6A 4L76A 2H2AA 2PD6A 3FNIA 3HN7A 3MCWA 4PS0A 3VR0A 3P94A 4BBAA 5ILGA 3KYCB 3L7IA 5A0VA 1H23A 4TS1A 1BFDA 1JKXA 3H5NA 4MQEB 1I10A 4LSGA 3GPLA 3M7IA 4PLWA 5DHSA 3T12A 1OH5A 3FTEA 4JJAA 1BD3A 4GR4A 2HMWA 2PAFA 4F8JA 1KO4A 1N2SA 1YR3A 4OV6B 3KVRA 4JLPA 4WLUA 5D6OA 3W78A 2H54A 4F6RA 4RCZA 1UFQA 4RLHA 5B1SA 3KL4A 4CF6A 1E0AA 1N32B 2JAUA 2J9GA 1W5SA 4WESB 4ZJYA 2JLCA 2GPWA 3V8BA 4KGDA 1DWQA 1M83A 1QR2A 1FYFA 5CEEA 2QD3A 1GSIA 2JFHA 4W5OA 1OYYA 3DEJA 3KCNA 5JBIA 1XZIA 5IU6A 4KO3S 2B30A 4YC7A 2PWZA 4PX2A 2QVXX 3SR3A 3QVLA 3OIYA 5EE5B 1VBKA 2I3BA 2PCLA 2NPOA 3QVKA 1N0HA 1ZNYA 4U7DA 1ZQ9A 4CL0A 2WSBA 5F35A 1J0XO 2ZAMA 3L18A 2O59A 1RYEA 4IXNA 2X0IA 2FSIA 2O3JA 5CEFA 5HRAA 4BSZA 1ENZA 4QBIA 5FTNA 4CF7A 4JSRA 3IKLA 3F6BX 1T34A 4NFYA 4AJIA 3Q3VA 5JCPA 3B5IA 5EVJA 4F91B 5EIBC 3AONB 5DX0A 4D41A 1Y98A 3IJRA 3GPCA 1P2SA 2LNDA 3EH2A 1IUNA 1SAYA 1Z8NA 3B1JA 3IODA 3MT8A 4K9QA 1DQNA 3DEKA 3TSYA 3CA8A 4PZAA 3F1KA 3H83A 3CF4G 3HE3A 4C4ZA 4R3UC 3EF1A 5FFFA 5G2OA 1K5DA 5ALVA 1TGYA 2XVMA 3QFTA 4D5GA 3MNFA 1V60A 5H9UA 2UYOA 3PITA 4UBIA 1VKRA 1V6SA 5CA1B 3R4CA 4MWTA 1KI3A 3AFOA 3QOWA 3ZQJA 3DVLA 3D2CA 4BQNA 4CW7A 3IAM6 4QZVA 4G89A 5JNTA 4LN1A 4F45A 4PZZA 4KIGA 4GRDA 1VKJA 2OHGA 1R00A 1C7IA 4PAMA 2BT4A 3IALA 16PKA 2HGSA 3BZUA 2BUCA 3CIOA 3NHZA 4YJ2B 4TYWA 3S68A 4AF7A 4B87A 1U8XX 1DKLA 3V32A 3IP1A 2V98A 1G5RA 4JITA 2IU3A 3C2QA 2BEWA 4K1XA 1G2QA 1RLUA 1CQJB 4K3UA 1H3NA 1OIXA 4QUAA 3BL8A 1KJZA 2B5OA 3BA1A 3L0OA 4TKLA 3RO7A 2JGRA 3GFOA 5CVDA 4US2R 2AKEA 4JI7B 2HRQA 2P9CA 3PXGA 5TMDA 2IY8A 2YZ7A 2ICAA 2VYNA 4FZRA 3C5WP 4MJ7A 1MJFA 2AXQA 3KOUA 1E7WA 3O7MA 2O14A 2NOAA 4XCXA 3ER9A 4H35A 2WFMA 3G8AA 4GKVA 4GKBA 5AESA 2XNDD 4J0HA 2WD8A 4B3RB 1ONPA 3WWOA 2IELA 3BD8A 4NZNA 3ZU5A 2P5UA 4GKAA 1E59A 3W3AD 1PZFA 2CHEA 5D85A 1YQGA 3O4JA 4CIAA 5JJBA 1TZCA 1OZAA 4RTOA 5EE9A 2VDKB 1OFUX 2J3QA 1PW7A 4MTCA 3NBFA 1G3RA 3R5HA 1HQCA 4RQBA 4R8RA 3RS5A 5GWXA 4YV1A 2EFEB 2ZYGA 2BLNA 2V45A 5E9JA 2P5YA 3ACDA 3FLMA 4QU5A 2ZSIA 1CQIB 4YXWD 4PHHA 5KBYA 3E9ZA 3DMHA 1FEZA 1UOOA 2FJUA 2YNMD 4LZWA 4P35A 4AXBA 4F72A 1ZCZA 3EODA 5EIOA 4FD2A 1JOSA 3AFNA 3D0OA 4Y6QA 1IWPB 2HWKA 3FPAA 2OENG 4YACA 3W1WA 3KJHA 4B35A 3ETOA 4EYGA 2RKOA 4DQKA 3IE2A 1NVFA 3VZCA 1KAOA 5JSYA 3PPVA 5TPZD 2WJ3A 1MEJA 1JU3A 2GAJA 2C2ZA 1JKJB 1VIYA 3QNMA 4NYJR 3WL5A 2MR5A 1NLUA 3TYXA 3D8TA 3Q3GE 5I3ZA 1UJ5A 1K8YB 3TX6A 3ORQA 3DBHB 5F1OA 4MVCA 1RKUA 2YXLA 1WCYA 2ZQYA 3OEHD 2XYGA 4DB2A 3GCDA 2WHRA 3O7WA 1V45E 3PNYA 4N39A 1LW7A 2CHUA 4B82A 5CX4A 1OROA 1LCIA 3AL3A 1XS3A 2VBIA 1YRLA 2ZDQA 2QUIA 1J07A 3B6MA 3FLBA 1OI3A 3K8QA 3QWAA 4JIGA 3WK5A 5KTYA 4HWSA 4PFJA 1ORIA 1OWLA 2EYQA 3A37A 3IUMA 3B6JA 4YB8A 4PONA 2P0YA 4F84A 2JAHA 2WI8A 4Q12A 1HR0C 5CYPA 2JFVA 5FOSA 2ISSD 4BC0A 1GTMA 4EHJA 4BX9A 1Z5ZA 3Q12A 2DYJA 1MJHA 2X2EA 3C24A 5EEHA 1DQYA 2FZ5A 5SZIA 3RV4A 5EXXA 1NUSA 4AB1A 1V4VA 4CR6A 1OH8A 2GOYA 3FCCA 4C1BA 1IY9A 1E4YA 5CCEA 4PG8A 4L2ZA 5THKA 3TEJA 1SVSA 3FM9A 4JB8A 5DLYA 2PBFA 2VHUA 1GZ4A 1EGAA 2P6UA 2Q6VA 3LO5A 4LBVA 4RSGA 2IXDA 3HYNA 4FFWA 4ZYZA 5JIBA 1A5TA 1QG6A 3VHQA 2O2XA 1YS7A 2BY4A 2PZKA 4KFRA 3P0FA 1DB3A 1XC7A 1E5QA 2IKQA 5K5EA 2B2XA 1UQUA 3VKUA 4HBGA 1C9MA 2CBGA 5T3UA 2X19A 2A58A 3VMFA 5K09A 2CLSA 1P7VA 5ESWA 3RVMA 3M49A 2E4WA 5HQ3B 3JQAD 2IS1A 1WQ1R 3OZUA 1AUXA 1JDBC 1RI2A 3BH7A 1NY8A 4OQLA 4K6FA 5AVRA 3LUGA 4X97A 2R7KA 3PTZA 1SJ9A 2WQ6A 3L9WA 4DMLA 3IP7A 2X2FA 2WB2A 2XOKA 4R1QA 1FCJA 4HB4A 1T3SA 3IPXA 4Z0HO 2GSWA 1B8PA 3I30X 3NNNA 3MXOA 3HNPA 1RBYA 2F64A 4MV6A 5CA1F 4DZRA 2HJVA 4QPJC 1A7KA 3L0IB 3GEIA 4L7QA 2V4UA 1VZ2A 1XLTC 3LHDA 4OJTA 2FSFA 4NECA 4PS1A 4BNKA 1Z75A 1KDTA 2OGUA 3L6OO 5IANA 5JO0A 5DCUA 3I9V6 4GMGA 4J2OA 4M9XA 3UYLA 3QKTA 3JVUA 3CYFA 2DCMA 4OA8A 4BJHB 2FPGA 3MQ2A 5L4SA 2YWBA 1C9YA 1JHZA 3D1JA 3UOAB 3RRYA 1I6KA 1Z17A 3GPDG 9GPBA 3TGPA 2Y1LA 3CF4A 1T2NA 1TFUA 2Z6QA 3OPNA 2PT5A 5IN5A 4EG4A 2AD1A 4G1EB 2XUAA 4UCXA 3TQIA 3IBGA 4LV6A 4P34A 1UMCA 4CL3A 4EW3A 2W5UA 3B9BA 4FM9A 2K5UA 4BMYA 1NI5A 3N6XA 1AKNA 3L07A 4PBRA 4TKVB 4V0QA 3A05A 3FZGA 2WFZA 3Q1LA 4I9HA 3OWXA 2ACKA 1WBJB 3QVVA 5BSEA 1YRYE 4IWNA 1MB2A 3DB1A 2W8ZA 1E98A 4Q39A 3RFUA 4UUMA 1QIGA 4CZ2A 3BXEA 5I8PA 4RV9A 1VMKA 2PS3A 1T1RA 4ZQHA 3I5AA 2H1HA 3GEEA 4GPZA 5FI1B 4G5HA 4Q18A 2GESA 3D5QA 1L5ZA 2ZIGA 3TAUA 1UINA 3GA5A 4N6GA 2AFHE 4R1OA 3SY8A 1TI7A 2YN0A 2O8BA 4Z7JA 1HYEA 1ZJ6A 4GKJC 1G18A 3IHWA 3QW4B 2OE2A 5KVAA 5J5AA 3KTDA 3RVNA 4B3CA 1H9CA 1D1PA 2P40A 4UHBA 3RADC 1B8NA 2XCIA 4RZ3A 3TBFA 5JXIA 5ABPA 1DQPA 3KEQA 2JLXA 4RHXA 4C6TA 3EVBA 1G4AE 3ZJVA 2EKBA 2PH5A 1SCKA 2HJWA 1IK4A 2QE7A 4Y18A 5AO9A 5FIUA 3WL4A 5JPDA 1U0FA 1CF4A 1SXQA 1J0EA 1JPVA 4FCVA 1W59A 3SFVA 1NKVA 1NVBA 4CM4A 3UJAA 4TRNA 3E8SA 4LOLA 4E5UA 3HQ4O 1DE0A 2VP2A 3BGSA 3K4PA 4Y9RA 4D8TA 3OQNA 2OC9A 4LFAB 3PJRA 4BC1A 3KBBA 1C9DB 2NWQA 2P2MA 4H4EA 2VTKA 2NU6A 2EAUA 4LJKA 4UDOA 4RKEA 2H65A 1FVXA 1E69A 1WG8A 5ELLA 4YXFA 2JIOA 2OCYC 3RARA 3OQ1A 1MQSA 2CMGA 1QYXA 2GBGA 4LDZA 3TE7A 1AO3A 1QP7A 5ALKA 3BQMB 2V55B 5DULA 1JHVA 4IUCS 1P7WA 3DWFA 4GI5A 4GS5A 4AJ1A 1YFJA 1DEKA 4F06A 1MB3A 1XQ9A 1IZ0A 4MUYA 1U2GC 1XJWA 3E22B 2RMKA 3FRHA 2UXBB 4NS4A 3PLNA 1IBRA 2IIQA 3OQBA 3UANA 3IUEA 3RJ9A 4ZMSA 5KDOA 1DLJA 2ZUSA 5EJ7A 2I65A 1PKXA 2Y92A 3H5IA 2HIMA 4NJMB 2OCXA 2VJDA 1E6EA 1QOZA 5COQA 3ZBQA 5KHOC 1P80A 5MGBA 3BCRA 5EPOA 1BNCA 4PPYA 1A04A 421PA 3DT6A 3ENQA 3E61A 1J4AA 1UKYA 3PQ3A 3CH4B 5DXJA 3A6KA 4YUYA 1PFYA 1DQRA 1OASA 2YN2A 3OJWA 4RSRA 4X91A 5GONB 5T4HA 4P1ZA 2I62A 5GINE 4FNGA 1OZ0A 3MMXA 2CY1A 4WY5A 4UU1A 3N2KA 5KNCD 1Q0TA 1X8LA 1GZ7A 3LWDA 3TQCA 3ENZA 4MKHA 1PU2A 4G1CA 3N2EA 1HI9A 1LTHR 1ZCBA 2VRCA 3GT0A 3MMSA 1ZIYA 4YGXB 3RYTC 3GLIA 3E2IA 4TMTA 4KR3A 3PTAA 4AM8A 2FB9A 3VHXB 2XQVA 1U0LA 5SV2A 2PMEA 4BJ1A 3THXA 3SZOA 3K31A 3MGKA 4PV7A 3SC4A 3D0QA 2ZDHA 1PJAA 3EB9A 3VPAA 3EUWA 1R9NA 2YS6A 1WAMA 3QBJA 2YHBA 1T6BY 3WE7A 1FZQA 4IEEA 2YV4A 2PRKA 4FFNA 4JB3A 4R5MA 3SDBA 3UKOA 4QDTA 3EWNA 4O59O 4Z5XA 4YI3A 2P9QA 1U3TA 1SIWA 2NTYC 2ZYHA 1CXZA 1SD2A 3QVGA 3VPGA 4CMCA 1SHKA 5DBGA 2YN4A 5BWCA 3Q11A 1VFPA 4K26A 4C7JA 5K3OA 1YJ5A 1YQQA 2XQJA 5HX7A 5JNVA 3BIWA 1MN6A 5CU7A 4OX9Y 3VDQA 4HJXA 1FDSA 2HOQA 3WLMA 4ARZA 4E3ZA 1WIWA 2OZVA 4BFXA 3R6DA 2A9OA 3RI3A 5LA6B 4PLYA 2F8MA 4R1SA 3ZCTA 2HLDA 1GNVA 1XTPA 3VTZA 5BNIA 4OX9B 3IB6A 4HMQA 2GAOA 4KOAA 5I45A 2IFTA 3GJ0A 3GR6A 2CBZA 3AY3A 3HBLA 4DIUA 4F9FA 3EZ6A 2QIOA 4IJUA 3URKA 1PJTA 2PXHA 4DC1A 5EE3A 4ZHSA 2YWRA 2WJIA 5CFRA 1P2BA 2AUMA 4CF3A 1CZKA 5HS4A 3GZ4A 5HIKA 2GEKA 2HHHB 4JLUA 5TX7A 1JIJA 2R6FA 4OK3A 4EZBA 5L8VA 5K3FB 1L5OA 3IUPA 3HB9A 2II6A 3PHCA 3WSVA 3RVOA 2YFHA 3KJXA 3C7CB 1G98A 4DA9A 3MTAA 1VMEA 1CT9A 1N3BA 1NY6A 1V6CA 1OA0A 4OYRA 2GZHA 4CM3A 2M9MA 2QX6A 4O4HB 3MBKA 3VH2A 4HB3A 2HK7A 2W37A 5IT9D 3EMDA 2D7VA 3I4CA 2OBFA 1CJBA 1B00A 1T8YA 3VXKA 3IEKA 1E63A 3I58A 4D7AA 4J75A 1GA4A 5FLKA 5KX5A 2WIDA 2IK8A 1CS0A 4R2HA 1WXFA 1RPTA 1U0RA 2O8FA 5JI2E 4YX9A 2J08A 3H3FA 3DXFA 4DUPA 5H82A 1J2YA 3IHLA 1B3BA 4ER0A 4FMCF 2QUZA 5CG1A 3CU5A 1NXWA 2WK1A 1NKSA 3HB4X 3A9VA 4I4LA 4M1SA 4GC5A 3SYTA 2J07A 1FL9A 4RVFA 4OQPA 1V9SA 3IHTA 4KR9A 1MPTA 3GO4A 5KCMA 2BZSA 4LOHA 3AR7A 4YDHB 5J59A 4TYNA 2ZZMA 4O2RA 5IVHA 2FQQA 2IPXA 2NO6A 2PE5A 3N70A 2CUKA 2EJBA 3FPSA 3LAXA 4KPUB 1QOQB 2N1BA 5EJMA 3TZHA 3ZXUB 4B2IA 5H3HA 3THSA 2NZJA 3LRXA 5DI9A 1SY7A 2FN9A 2G0AA 3DC2A 2UVQA 3GG9A 3Q9UA 1NOJA 4HBZA 5T57A 3O8NA 4X3PA 4J16A 4B4OA 2ZQ5A 5BSWA 3KR2A 1XRAA 3AXSA 4L9AA 3H9CA 2JFNA 4R0VA 5EGNA 4DIDA 6GPBA 2C0PA 1OFVA 2Q9UA 3K4QA 1L5HA 2MSNA 3RWOA 1YCGA 3DOUA 3L8HA 3BJRA 1R3DA 1GCAA 3GFSA 2OHIA 5E8RA 3TTYA 1IEXA 4W99A 3F78A 5FLXA 4I2NA 3IURA 1Z2PX 4YJHB 3S1LA 2AR7A 3HXOA 4RULA 3CQ3A 3FNEA 2H1OA 3ENKA 4ND8B 2AL7A 4JJZA 3SZGA 2AOXA 2OFFA 5D84A 1RJ9B 2PPLA 3NB0A 2E6UX 4WZBA 3SS9X 2EJWA 2JF0A 4YCCA 3KE9A 2KI5A 3LCMA 2XRFA 4Q05A 2WHQA 2OD7A 3QYJA 5LQUA 1AURA 2BFOA 1Z34A 1C1HA 4AXXA 4CF5A 1PIWA 4KRXA 1UOPA 2PKXA 4DJTA 1SG0A 4NZMA 1C8KA 4BFLA 4CM5A 3G8YA 2GZSA 1ZXBA 1XWWA 2HU7A 1Z6QA 3U4QB 2ZULA 1T2FA 4TLEA 3JZAA 2H1SA 3NHUA 3GLSA 1RLIA 3MILA 4MV1A 2R8OA 1M1XB 1KMNA 1F2UA 2QROA 3H2YA 3P4YA 4CT4B 5IJ0A 3UHPA 1T0HB 1C7FA 2I1LA 1GPDG 4JT8A 4QSMA 5DNEA 1WE2A 4UAUA 4IHJF 1GAEO 4I1SA 3L77A 3OZ7A 2ZTLA 4PPFA 5T8TA 1RZ3A 2BMEA 3WFIA 4DG5A 2G9VA 4B7AA 1DNPA 1PR5A 3VFDA 1M0WA 1I9CA 1PHRA 4MW7A 4MI6A 3SGLA 2I2AA 1HG1A 3KZVA 1R0YA 1RC1A 3NEAA 1I33A 5EG5A 4HDKA 1ML8A 1T5SA 3FHOA 5IULC 2DC1A 1G59A 1USPA 1H1TA 2XE6A 3TH5A 3G1UA 3AZPA 4DY6A 2YVUA 5EMKA 4C0LA 1BCSB 1A95A 2GTPA 3KLPX 4WZZA 5EXSA 4D0LB 5CDUA 5D6NA 5FL3A 3SZLA 3TUJC 1IUKA 2EQAA 2L0XA 3P9KA 4PLVA 4F56A 1DAFA 1FNSA 2QRVB 3JAKB 4DSOA 4PGMA 3SE7A 4CQJA 4NMMA 4GPD1 1P4EC 4L3WA 1KY4A 1IY0A 1S9HA 1CHDA 3DD5A 3WLTA 4R9NA 2Z3ZA 3B2EA 3K4HA 4FYXA 4F8EA 4I6EA 5GIPE 1FFSA 4L0QA 1L3IA 2I2BA 2AJTA 3C8DA 4LHEA 1S7GA 1XZLA 1KJNA 2QTBA 2EWMA 1P1KA 2W0SA 3BDAA 5LZ5A 1ENPA 5DF1A 1KDVA 3DTTA 3QELA 2AFHB 2FZEA 4ZOBA 2GCGA 5JAZA 3N8HA 1CB0A 1R7RA 2QLMA 3II6X 3MUNA 6ADHA 5CH5A 1T2VA 1TXGA 3B48A 3J80D 4LYGA 5ESDA 1SKMA 2IYLD 3AUSA 3RJZA 3G7SA 4LAFA 2HPVA 3GH3A 1Z2CA 1IHPA 3JS5A 4ZAZA 5LZ7A 4CTMA 1QGYA 1N2ZA 2EDCA 5TS2A 1KNXA 3EVCA 4X3OA 1P9RA 2XSZA 1LQUA 4ZU1X 5LR6A 2HO4A 4QO8A 4R7TA 1CP2A 4M36A 3KLOA 2Z2ZA 4WK2B 3W06A 1I3LA 1BW9B 4QSHA 3KSZO 4H7JA 1LQ2A 1WCV1 2F1JA 2R1UA 4UFNA 4V0LA 2WJWA 2YZKA 4MMXB 2A3NA 4BFWA 2NVUA 1PG3A 4U7JA 5HA5A 4PLTA 2WYHA 1L5KA 2CJWA 5E9AA 4XXHA 3QQPA 3L8GA 4W5QA 4R51A 3HI4A 4IDAA 2R48A 2ANBA 3HDVA 5JJLA 1E79D 5HFNA 5A1JA 1BU5A 4QHSA 5U1PA 2RGCA 1U2GA 2UUOA 3BE4A 3EN0A 4U9IS 3DEIA 4B5LA 2AUTA 3TQSA 1AUPA 3V4VB 5LD2C 4G0PA 1WUKS 1Y8RB 1ULZA 4MUKA 1MX9A 5INTA 1JFSA 3G9ZA 2HFJA 2Z2YA 4MS4A 3LNOA 3RGWS 3TQTA 4JP1A 4EJSA 3OY7A 1ZRSA 4JBNA 2BAGA 4DR4C 2F7SA 2NZ8A 1QTRA 1R18A 2P1RA 3HMQA 4JLSA 3U3KA 5HIMA 3DOIA 1CY8A 1NN0A 3AM4A 2Q1SA 3HXTA 4EQ6A 3JAWA 1L1QA 4BO6A 1E3QA 4MS3B 4LRYA 3FPHA 3FZEA 4NICA 3ABSB 5IT4A 5JNLA 4MK4A 2HU5A 3D4IA 1B6TA 4YMIA 2YYAA 5AHKA 3BWMA 3VR2D 3AR6A 5CDGA 4RGQA 3R3YA 3U40A 2O0KA 2CFRA 2GEDA 4L8GA 3I5YA 3ECAA 1ECPA 5H9WA 1QHXA 3UTCA 3RSCA 3QE4A 2VO1A 1IMJA 3I5XA 1KDZA 1RTTA 3OZVA 4TN1A 4TOIA 1H2RS 4KFTA 2VDNB 2H1CA 1X8XA 3K70D 1SO8A 2VJYA 4K87A 1N3LA 1YMVA 4URVR 1OV4A 5KMGB 3TOZA 4JI6B 1A77A 3BSFA 4LF6C 1JLMA 2GM5A 2HA3A 4CG0A 1A4XA 1OQAA 1NT4A 1P1RA 4BB5A 1EFKA 2ZSFA 4DV5B 4N65A 4RPIA 1I30A 3I45A 3PCRB 3LLMA 4Y9UA 1W1IA 3TAXA 3PLRA 1DC6A 4UQPA 1FP4A 2XNKA 1FRVA 3BJZA 3HYCA 5CP8A 3CPSA 5H81A 1WWKA 1TF7A 1N5KA 3NHYA 1EJ2A 1S4QA 2FI1A 2HMYB 4U2GA 2BSXA 4QQ8A 5JDCA 2PL3A 3KXPA 2VYND 4CUJA 2FR8A 2PUTA 4R54A 4MEBA 2ZYIA 4GIBA 4H15A 1NR1A 4PAOA 1REQA 3TW4A 3N75A 4N7RA 3PE3A 3SE0A 4I19A 4LHVA 1SXIA 3G2NA 2BR4A 5IAEA 2H63A 1E4OA 1A9QA 1Y89A 2QTHA 3DMNA 3M1AA 3UWDA 2Q4DA 4ECEA 1TJPB 4DV1B 3RUPA 4EOGA 1I6MA 1Z7GA 1QH0A 4S1VA 4CDGA 4IV5A 3ROZA 5J2TF 1MKYA 1N6IA 3I2IA 3M8KA 1XEXA 2VUHB 1L5MA 5HF5A 4HWTA 5C5IA 4URXR 5ICEA 1GTZA 2HEGA 1LSOA 2PWAA 3DNFA 4HSGA 2Z3VA 4KLCA 4O2BB 3SF0A 2P27A 1NMEA 2OORC 5I7RA 2JA2A 4DRZA 1JHXA 4E3WA 3LUAA 3SHWA 4PIMA 1W29A 3SS7X 3LQQA 3UJ9A 2L82A 1EUCA 3LNVA 1XTQA 4KZPA 4HLUC 2OGSA 2X0FA 3LGSA 5KQLA 3LY8A 4XIJA 4DJAA 1LBIA 4UHHA 4KQHA 1M8PA 3NFRA 4P53A 1LBSA 4GZ6A 4J3NA 1IZYA 2VSOA 4LJ9A 4V0ME 4RK5A 2IXGA 5HK9A 4CKZA 1W93A 1LLCA 4JOSA 3TVTA 3TTWA 1Y34E 1E3EA 4ATNA 3DBHA 3JASB 3S8MA 1SPBS 5DBHX 3S40A 4EHIA 4G07A 4J7UA 3NWOA 1U7ZA 2HZ7A 3LOQA 4BS9A 3VNBA 4DSNA 2PH3A 5K01A 1V35A 4W8OA 2FUEA 4PAWA 1RM3A 2NAPA 3W8EA 2FN3A 4U7PB 2NSDA 1GAQA 2J45A 4CLXA 4KXLA 1QLJA 1Z82A 3G88A 2AJDA 3PKIA 4HDSA 4UBOA 4XEUA 5HFAA 3C8MA 5JO9A 5A5GA 2I29A 1ZRMA 2V1XA 4CNBA 2VH1A 2DKOA 5I4IA 4NFHA 3GC6A 2PK3A 3EHEA 3HVJA 3OPYB 4WY8A 5HM8A 4G0XA 1ZGGA 1ZITA 3H2JA 4RX1A 4D3SA 1R9GA 4UDNA 4DPMA 5AW2A 3G0BA 4BLOA 2GM9A 2QZ9A 5IYZB 3WHLA 1Z2AA 3L7LA 1SUFA 4D3YA 4LX8A 2NYRA 1PSWA 3MWKA 4CMAA 2PO7A 2QXYA 2Y0CA 2VLIA 4MAMA 1G20E 1PDOA 3TQRA 5FT9A 3MYRA 4PO9A 3OIFA 1XV5A 1ZK4A 3TQFA 5BSHA 1DUSA 4B44A 1VXOA 3IP5A 3B52X 3OQ6A 4ZAVA 2GKOA 1NI4A 5EMLA 3DUFA 2C5EA 2ZBEA 4IQ4A 1SUEA 4OGWA 3D5EA 4W82A 3FR7A 3RKSA 1QP0A 3H2SA 2B8EA 2W6PA 2D0DA 3HA2A 4YO8A 4IRXA 5A7FA 3BL5A 1HTWA 4GSKA 2VDUE 4WZAE 4C4TA 2NSHA 1FS6A 2WNSA 5CLHA 5LQCA 5JCOC 4JZKA 1UF9A 1YR6A 1YR8A 2YVAA 4TYPA 4U9UA 4MWEA 2XWSA 4A73A 4B17A 4X92A 2JH3A 4JL6A 3VZDA 1O6BA 4S05A 4IOKA 2FPOA 2IIPA 1GG2A 2GJ4A 1RJWA 5JSHA 3T7KA 5A4IS 4OVKA 5JBNA 2F90A 1RYZA 4FYKA 2WA2A 3SZMA 2P2ZA 3HBNA 2HSGA 3T7EA 3R0IA 5DRYA 3R8FA 1MZPA 1V37A 4KV7A 2B6HA 3G2QA 4ZOQI 1YS2X 4LKOA 4MS1A 1EZ1A 1S02A 3C3CA 1G2IA 1TA9A 3W2TA 4GKJB 1FZTA 1GIAA 3KJIA 1WV1A 4A0SA 5IHPA 1XALA 5FLEX 3QY0A 4AG3A 1DMSA 1HSOA 2YW9A 2OGZA 3PGLA 3PX3A 3UXEA 4B31A 3PF9A 5EZSA 3PC4A 3RQIA 2XUPA 4UW9A 4GT1A 1UC4B 4ZCIA 3LSTA 1GL9B 1K7EB 4KE7A 3FKQA 4ALIA 1ULBA 3RRZA 1IDOA 1N2CB 3ND7A 1RWWA 2NG1A 2HN9A 4UZFA 3WLOA 1LWOA 4C14A 3TOXA 3WYEA 2VHQA 4QBTA 4QUKA 3TR3A 1TADA 2BZ0A 3C6XA 3N39C 4TYMA 2GAFA 3EIHA 1BDMA 1NQUA 2OV2A 3I1JA 4GR5A 1IQRA 3JRNA 1XMQC 1JJ7A 1YC2A 2AN3A 4U2CA 4BAUA 2IV2X 1BAPA 2AOUB 2XNCA 1V11A 4TRJA 4R6WA 1OWNA 1X2EA 3VYWA 4EPTA 2GF0A 5B12A 4A0FA 5LJLA 3UMVA 1FA9A 4JEIA 4RY2A 1Z18A 4CMEC 3UHFA 2B9VA 3PEVA 1FTYA 1SRQA 3RV3A 1XZPA 3EUEA 1SNYA 3AL0C 3EA4A 5ALPA 4EJSB 4U3JB 3VO9A 4V2UA 4HV4A 5F23A 1RD4A 5CH8A 1G6OA 3INNA 4MI3A 4UU0A 2HLHA 5EUQB 1GCOA 1PK8A 2JFWA 3P9NA 1WNFA 4LGYA 3RJTA 1U8ZA 1XRCA 3T0FA 4EG6A 2ZREA 5E1DA 4TVBA 3RBXA 3UUFA 1G21B 4BO9A 4KWTA 3U3RA 1GFWA 4H7KA 2JW5A 5KVSA 2ZIEA 4WK0B 5KKAA 5MFPA 5DE3A 4RD0A 1JN0A 5CA0B 3LVBA 5DHTA 1Z06A 4QYMA 2DUUA 1BHSA 3DLAA 1EFHA 1B93A 2R47A 3T5MA 3EQ2A 5BUSA 3LPMA 1LLDA 3OFNA 2P67A 4HEQA 4MSUA 3I9JA 4B4DA 4TGLA 5L53A 1JNXX 4NJOA 3WLPA 3DZFA 4RZIA 4D8WA 2JLZA 1KOFA 2NXNA 2E0GA 1QHYA 4KRYA 3SXJA 4A0GA 4FINA 4R2JA 3SBDA 2DT5A 2P75A 3H11B 3ORRA 1IK6A 2NADA 4G0ZA 3J80A 1AKMA 1PSDA 1V4NA 3I5MA 1I3NA 1XZ8A 2VJLA 2WJGA 1T4DA 4R7ZA 5E7MA 3WFJA 4DT1B 1C3VA 2GBCA 3KQOA 2YJTD 2WZBA 5C0OE 1EFVA 1F6BA 1MX3A 3CVYA 4PYNA 1MX5A 2YICA 5REQB 1DI0A 8GPBA 1ISJA 1DU4A 3N8IA 3N74A 4K2AA 1O2DA 2CFIA 1RADA 1UT8A 4RNCA 1VHLA 2I8AA 2PROA 1FLDA 2SCUB 3F67A 2BMVA 2EXXA 3CY6A 4TVOA 3OZXA 1NC1A 3EPRA 1G8PA 2JCVA 4QUHA 1K66A 1EHIA 1HO3A 5AQ1A 2QTVB 4DANA 4O1HA 5IG2A 1Q0UA 4C3OB 3R44A 2OV6A 1YZNA 3CNNA 1QB7A 3JALA 5B53A 1XBTA 2I7XA 2CYBA 4I50F 4LGCA 1KH2A 2CDAA 5G4KB 5BNFA 1I7DA 1ZEJA 4OOFA 3UT0A 3N2GA 1JYSA 1T10A 5DOZA 1D2NA 3A4VA 3MJDA 2QZJA 3CW2A 1EG2A 2FW6A 2ZVDA 3KUDA 3O1HB 3KZMA 3Q7IA 3TL3A 2CZCA 3NOXA 3DOHA 2JFQA 1USPB 2H4ZA 3HZRA 2BFEB 3R09A 1R16A 3TIVA 1NHWA 1DEAA 2FHPA 2D1QA 1U5CA 2GS9A 3OD5A 4A8HA 1S2IA 3BMXA 2KS6A 3NBZC 4PTYA 2FUKA 3ETEA 2FPMA 3P2KA 2XX3A 1ZL0A 2YJ4A 4WCFC 3FYSA 4L5YA 1FJXA 2BZ1A 4M8LA 2GHIA 3M33A 3FTPA 3DL7A 3WB1A 4B7ZA 5BMVB 1P5ZB 1TNDA 2IA5A 4RD2A 5HXAA 3NATA 4EG7A 1WSBA 3BVPA 4XTCS 3GNSA 1MJGM 1ISIA 4UHJA 3VMMA 2CXTA 2IQIA 5L3VA 1YO6A 4ZZ2A 1U9IA 3G2JA 3TR0A 5AVSA 4IIJA 4FJ1A 4HGZA 4RH0A 4FUQA 3UGTA 1U28C 4K1LA 5JYBA 4I55B 4GXRA 2W6ID 3ZDCA 1D1TA 1E7RA 4C0AC 4Q4JB 5ULLA 4BVAA 4NG4A 4PG6A 4DSTA 2ZETA 1P8AA 2CHQA 1U3CA 2FMXA 3LAWA 1YCDA 5EP4A 1MX1A 3DV2A 3Q7TA 5F1KA 4R69A 3OPYI 2MOKA 5E0KB 1FLVA 3EXFB 3WGUA 3HR4A 3PCXA 1Q19A 4XJVA 1XMOB 2VH2A 3USCS 4P81A 4WK4B 5KTMA 3K9HA 4U7WA 1DVRA 3U1BA 5JXWA 5JD3A 3SM9A 2CMHA 3DW1X 3UYKA 5ECWA 1VRWA 3NZEA 4S12A 1QCDA 1BOOA 2B3DA 4TKUA 3EYAA 4O2LA 3IDFA 1ZHHA 5EQTA 3SZ3A 3EEIA 1HRKA 4X1KA 1IY1A 5DGIA 2IODA 1EM6A 2FZWA 5AVQA 3EUAA 3KFXA 1CE8A 4EHAA 4D0NA 3LLCA 2OT3B 3R9KA 3KV1A 1E1KA 1V8OA 1M3SA 3O38A 2POQX 4ES6A 1TQ4A 1J1ZA 4N3NA 4NONA 1Y8AA 1DXYA 3HY4A 3KQPA 3TSWA 3WIDA 4DQLA 5ENZA 1XHJA 4FBMA 4A2PA 4CMGA 4LFAC 3VR4D 1X7DA 4BYMA 1Y9EA 3RK4A 1K9SA 3K71B 2QUBA 2F55A 4YAEA 2E21A 1FFDA 2VQEC 5HF8A 5KIAA 4CKEB 1G291 2N9UA 1BJTA 4JB0A 4BWYA 1W9MA 5DSTA 1QVAA 3KL2A 3SVTA 3QX7A 4ZHQF 2R00C 2K4MA 3OZFA 1BRTA 4QXAA 5AM2A 4U2EA 3TIXB 4M37A 2BGIA 3B3QA 3OTOB 3AVUA 1FYWA 3MYYA 4L5BA 2ECQA 3EUFA 5CT6A 3PQEA 4Y2JA 3EGWA 5AXBA 1EGQA 2RAFA 2FSSA 2B3TA 2PHZA 5JXGA 1NQVA 2NUPA 2ZI6A 1XD8A 1DX6A 1YOBA 2I3AA 3NC4A 3P1JA 4IIXA 3U4CA 5EIBD 2YBDA 1SKQA 3KK0A 4F11A 1JSCA 3PUKA 1CRWG 5LLSA 3ENNA 5G0VA 1G8FA 2XTMA 2FMTA 3JW8A 4ZI7A 1QHEA 1RYDA 1RABA 2VYQA 5TT0A 2IEBA 1Y81A 4A0HA 5CB4B 4JLNA 2WLTA 1A2KC 2ZBGA 3W5HA 3K6RA 1ZMXA 1MMFB 2ZRDA 3A1UA 3T4PA 4A6XA 2WUVA 3FTNA 3R7WA 4MVJM 4TTRA 1RDFA 1VA5A 5JWRA 3L7DA 3AOGA 2XQKA 1VLZA 3IXMA 4QOSA 4BFSA 3KUXA 1U99A 3P20A 3DP7A 3GFVA 3AUYA 1BROA 3LHKA 1PKEA 4HRVA 3E0QA 3A6DA 1XDUA 3GPBA 2QXUA 1Q3KA 2JGIA 2WAMA 1ST2A 3A6HA 3E23A 1K92A 4ZO9A 5JADA 3QELB 2OGWA 5I4BA 1SXJB 3DQPA 3W6PA 1FS4A 2IOYA 5EZ6B 4OHKA 5FNZA 4BNDB 1S1CA 1FDTA 1VB5A 4B3BA 1Z5UA 2WWXA 1GZ3A 5EOVA 3T94A 3AJ8A 5A1GA 4Q9NA 4B9AA 3H1BA 1Z5OA 2NSYA 3KTAB 3NTQA 3O31A 4M1KA 4Q4LA 1VFNA 1TEZA 1G2OA 2CL5A 4JEUA 2QJFA 3KB1A 3QVXA 1ODLA 1UQRA 5SYNA 2IITA 1QGUA 3M4ZA 2GGSA 3O8DA 3T1NA 2HA7A 4L1KA 4ENUA 1D0VA 2VRBA 3I4FA 3QFFA 5LYYA 1RI3A 4YEDA 4YRNA 4XFDA 1OT5A 2I6XA 3ORSA 3A8TA 1X1EA 3BL6A 3IQZA 1USUA 2GI4A 3GVXA 4EMSA 3PK0A 1BX1A 3LUKA 2UYCA 1FDIA 2LGJA 3AIIA 3ESRA 5J1TB 4FC6A 3LQKA 2FFQA 4RA6B 5CEJA 3NQ41 1ZOLA 3T8YA 4Q3EA 1L4GA 5AKZA 1UM9A 1QMPA 2WMOB 1WU7A 5KYXA 3PEEA 1WY5A 3THXB 2O7RA 4BO7A 1UBHS 4HO1X 2HR1A 5DLQC 4TS3A 3GH1A 4JUBA 5A3JA 1F8UA 2BSAA 5AOCA 4D0SA 5JPIA 2FFHA 2HX1A 3AG6A 3FKSA 3RYHB 3U7QA 4AZ3B 4RV4A 3NHJA 3U4MA 2EHJA 1VE5A 3LUJA 4NEQA 3KJEA 1Y8ZA 4H0FA 3ET5A 3L7MA 4US0R 3N58A 4L72A 5JTTA 1XZEA 1MENA 1PJ3A 1LVUA 1Y6ZA 3SQDA 1X87A 4RKRA 1E0SA 3QQ5A 2E4ZA 1MFZA 5C18A 2AN1A 3B7WA 2IYFA 3N8DA 3R5SA 2VRNA 4ZO6A 4MGHA 1JB9A 3WSTA 1RRPA 1WUTA 2OECA 2VF4X 1Y7LA 5EMNA 1ZIDA 1TA0A 1UKZA 1HETA 1PG4A 2IRWA 4AUNA 1STOA 3PQ5A 1BG6A 1GUZA 2HHCA 4RCVA 3PFBA 3ADCA 3DOEA 4L4RA 3C6YA 3K5PA 5IUNC 4EY4A 3A3KA 1M33A 1N7HA 4CIYA 1T36A 1E6UA 3CUWA 2DXIA 1R0LA 1OHHA 2WHPB 1HWYA 2H92A 5JT1A 1L7OA 3VJKA 4JJEA 3E05A 4ZCQA 3ZC3A 1Z29A 1TAQA 4JROA 1NP3A 4GOOD 1MVOA 1SURA 2FPXA 2YYYA 4TWZA 1FB5A 1X13A 5FOXA 4ZT5A 1TK2A 3WKEA 4HLNA 4WLNA 3WRYC 4CTOA 2C7RA 3OIVA 5CFMA 1VTKA 2Y1CA 2CL7X 1GT91 2P3LA 4KQ9A 4MRVA 1X39A 3M6IA 1T4BA 4PAQA 4KGZA 2PKYX 1RTKA 2HNBA 4TROA 4Q1BA 2B34A 4R81A 5DM4A 2FPPB 1RACA 2ZT6A 3OE1A 1QR6A 1LK0A 3QWIA 1VE9A 4HGYA 1O92A 2XCOA 2HYIC 5ANRB 2P0AA 4C6SA 2QBYB 3VJRA 2WAYA 2I2XB 1ONNA 1NVVQ 2JGNA 2RK6A 3B9RA 3D1LA 3D8UA 3JRXA 4JBYA 3VPHA 3VVLA 5SY9A 4M38A 3GI1A 1MH9A 4H7IA 2AEMA 2J7PA 4L2IB 1DOHA 2JLVA 2J7PD 3KXWA 1DADA 1TM4E 3ESCA 1JZSA 1PFGA 3OG9A 1XDSA 3HACA 4OXNA 1TTTA 1PLJA 1IMOA 1CHNA 2GEFA 4U7FA 3JZMA 4E4RA 3T5CA 4NJEB 5KTNA 4BMCA 2ATVA 4IRMA 2ZUDA 1DXHA 4CMKA 4DEYA 3K94A 1D2RA 2MSLA 4DLBA 4JM1A 2WJHA 3BK2A 5CIWA 2HXSA 4G86A 1DRKA 1Y1LA 2ZROA 2A86A 2ZTHA 3RFFA 3HDJA 3RHTA 4C43A 3Q7RA 2XDWA 3ZU2A 4B47A 2OMEA 4MQUA 3B3AA 2R25B 2DQYA 2VQSA 3IH5A 4P3PA 5A4DA 1SIUA 1BVYF 1GUBA 2C4UA 3G2PA 2CU6A 2XBUA 3PCTA 4MULA 5F2OA 1J56A 2WU0A 1YMQA 1Z2NX 3PPIA 1GY8A 3PSAA 5DI3B 2ST1A 3M83A 4QYWA 4TKVA 2ZRKA 4URYR 2XCUA 3UCXA 4KITB 5A0TA 3S28A 1VL5A 4O29A 1O9TA 1UMCB 4G37A 4AMUA 3TGLA 3U4HA 1G8JA 1H22A 1ZY2A 3LECA 2ODWA 1EVEA 2PGXA 4FDUA 5F3DA 5BPFA 5FFMA 1Z45A 1ZA2A 3QF4B 1KMHB 1GZDA 1KAMA 1N5OX 2FG7C 3CZ5A 4O4IA 4C21A 3OFKA 1RYHA 2I8LA 4XX0A 3T3EA 2X42A 2CXCA 3FBGA 2WIAA 1MV5A 4Q3KA 4TQAA 5JSZA 3L5KA 1ISMA 2V9ZA 3CZRA 3CEHA 4NMWA 4RAOA 4BVJA 5HQTA 3M1LA 5CH3A 3X3HA 3UWPA 4WDQA 2XXJA 3FUVA 5JAQA 1TUBA 4ND6A 1L2TA 2QG9A 3SHQA 1QWIA 4R1UA 5AQEA 2AZTA 4NFSA 1Y8QA 5KB3A 4L78A 2G8NA 2QL8A 4DDVA 4IXTA 1X0VA 3TFWA 2WFLB 1BEUB 1DHRA 3Q7PA 4YO7A 1WMBA 4F1JA 2VF5X 3PD0A 4P84A 2X4GA 2PX2A 1MZVA 1YC5A 2FLKA 1AQLA 2MMAB 4DCUA 2O2HA 4TS4A 4X65C 1P18A 5ITZB 5M3BA 3ZVLA 2K2WA 1GPMA 3QPAA 4TQ9A 2P4SA 3AJDA 5KOJA 4R1TA 4B6JA 4CL8A 3NJ8A 2Z0MA 3EGVA 2NLOA 3MTEA 3QEBZ 2ERXA 3T38A 1OXMA 1UJCA 2OXEA 4FYMA 2VQ6A 1NI3A 2AMYA 3DKKA 5TQJA 1VQ1A 3OE5A 1YB7A 3ORHA 5BV8A 3OZSA 1Q0PA 3FWKA 3IUYA 3F9CA 4MV5A 4LZNA 5ETJA 1O96B 2XGGA 1YK1A 3PS9A 4KXUA 1DAEA 2GK7A 3WADA 2JGLA 3IERA 1M0EA 2HW8A 1F4VA 5JMWA 3IT3A 2EJTA 1FMCA 2WDPA 5BWOA 3NIBA 4OHUA 4QPPA 2DHEA 1JG4A 3EDQA 3DE0X 3P26A 5AI6A 2ZSHA 1DC5A 3RBAA 2HBYA 4EATA 4EB3A 1QTQA 2OB2A 3MD9A 5KOJB 1ATZA 1ZC4A 1HZJA 2IS2A 4IZIA 3SPXA 3D8HA 4BBYA 4EUEA 4R9RA 2X9GA 3GGCA 3E8XA 5EJ2A 4WXHA 4C5AA 3HVKA 2AOTB 1KEEA 2FW9A 3OZCA 4N8EA 1CUJA 1NLMA 2VCHA 4U7TB 1ANKA 3M4JA 1R6VA 2WYUA 5AWFC 4Q1AA 1E89A 1KI2A 1FNNA 2P8SA 3VAYA 1SCJA 5A7HA 1TUIA 1AK2A 1RE0A 4N54A 1PR2A 3AV0B 2X7XA 3LX4A 1UDAA 4R2MA 2W71A 4YAGA 1K6IA 3RM3A 3EG9B 1FFHA 4YJGB 3JYLA 1FNDA 3E5HA 2PSSA 1VJ1A 2MSCB 4BX0A 2R6DA 2XMRA 4BN5A 2HF2A 3AK4A 5AK4A 5HFJA 1C8LA 1WY7A 2C2XA 3GB9A 1DKOA 3AHIA 3IMGA 4EHBA 2C8VA 4NCKA 4Q4HB 5F12A 3EIUA 5ALTA 3UQZA 1KP9A 2OWDA 1Z22A 4HVAA 1I3MA 3SYNA 2D27A 2C59A 5FTLA 1Y5IA 4HB0A 4DV0B 1EQAA 3PFNA 2BBWA 3ZWVA 2QHXA 1Z38A 7REQA 3MWEA 2QW1A 3FZQA 1LKZA 4HPJB 4RVCA 4OGKA 4ARUA 4WS9A 1IBKC 2Y77A 4Q15A 3W8RA 1ORHA 4HDMA 4WBXC 1R0ZA 2ZT5A 2GLUA 3FF4A 4JI5B 1JW9B 5AW1A 1PG0A 5FBZA 2BGUA 3W7VA 3WWEA 4L6IA 3E5NA 4RUKA 1UOEA 4L0CA 3VTKA 1SCAA 4IDQA 1WUYA 4M1OA 1UODA 4NCAA 3IOEA 3A2KA 3DV0A 1IJKA 5MN4A 2HXYA 2A1UB 2GZ2A 2QN6A 2V6IA 3E84A 3U3OA 1PFUA 1NP7A 4M53A 1O3YA 2Q1XA 3G2IA 3AVTA 3JVIA 1P5HA 3M6MD 4XVHA 3RTBA 3SXUB 1MVLA 4WDRA 2OBMA 5F21A 1JILA 1LZLA 1F6WA 4LI0A 2ZYAA 4Z1OA 5IAOA 1OXBB 1H8HD 4JBWA 4EL5A 2F43B 1NBAA 4KXFB 1E5DA 1EFAA 4KVZA 1KGSA 4M0KA 1DRJA 4R2XA 1V11B 3CR7A 3HB1A 2OTCA 3COJA 4KIWA 4ALKA 4GQAA 5BW6B 5F78A 1SCUA 2EQ5A 1YAJA 3LC7O 2IH2A 4HTFB 1YXMA 3SIRA 1EUZA 4TTTS 4KKVA 2R85A 1CRPA 5LYJA 1KZYC 4EX6A 1NVAA 3LIPA 2XYHA 3DEAA 1EK2A 5BV0A 2VK1A 4EW2A 2Q3DA 2O19A 3L8CA 3SEZA 4DYHA 2PSFA 3ZQ6A 4EG0A 2FPPA 4DOMA 2IYNA 4HNSA 3C8UA 1N2CA 2ZBPA 2VBFA 3OZBA 4IMRA 5JDCC 1CUBA 2QSJA 3LCCA 1Q1AA 4XX1A 4P7KA 4BFZA 4BJ5A 5KYGA 3CC8A 1EG7A 3CRNA 4LFCB 4ZYXA 1S2NA 1Q1GA 3AGQA 4PEVA 3H1AA 2BHRA 2C7BA 4S3MA 4XWWA 3E5MA 5DHPA 1FFCA 1OJLA 4UTPA 3U4IA 5L3QB 4L27A 3I73A 5DYIA 1N0UA 1EIZA 3NKLA 2QYSA 4MS1B 4GYWA 1AM4D 3DDZX 4Z6KA 1MOZA 2JLYA 2H11A 1HZZA 2QU8A 1BFUA 4Q1EA 5EQJB 4AN1A 4WD3A 1H2AS 2J5XA 2H9IA 3E3LA 2AK3A 3QOYA 3HRIA 4CIXA 5BR1A 2RK3A 4TMVA 3WLKX 1Y3CE 2XRMA 4B79A 2FF5A 4AVYA 4KE8A 4EKIA 4UOEA 1DAKA 2EGHA 3AI1A 1E96A 4MZDA 1JLLA 3ZCUA 1L5QA 1D9ZA 1DFIA 1BXGB 3RTGA 1XDBA 3H16A 3PXBA 1V7PC 3G2HA 5JH7F 4OHBA 5IWCA 1R74A 4DVGA 1M6VB 2X3YA 4TWAA 5FWYA 3FCXA 4OHVA 4ROSA 3KJGA 5DV9A 3GAZA 3X1KA 1MO6A 3SSAA 2D28C 4OHOA 3AUTA 4RETA 3WWYA 1FSFA 3A7EA 4CM6A 4ENQA 3OQMA 2ZIXA 4AWAA 1Z7BA 2OZLB 5F2EA 1E2KA 1P1FA 4E11A 3ZQUA 5J2TB 4W7HA 2CLOB 4E2FA 3TD2A 2EZUA 3L82B 2VTVA 4TYYA 1K8XB 3T7SA 1RXCA 1ETHA 2QRNA 2Y76A 1GWNA 1K68A 2J3IA 2WU4A 4LPSA 1NIJA 5ALQA 1OPRA 1YT5A 2BFCA 3G9QA 4QJ4A 4EDHA 1OY1A 3V42A 3KE8A 3U3DA 1AZSC 1P0FA 1TKBA 2RGXA 3EIFA 4ZT2A 2PH1A 2E55A 5KJFA 2NT4A 5UKDA 1WXQA 2GBPA 3LS2A 1P5JA 2FETA 2V4MA 4YECA 2OQVA 4W5RA 1H8ED 1T5DX 1JA1A 4TM7A 2PUEA 3BHJA 1HR0B 2IDKA 4MYUA 3FVVA 3EAFA 4N7MA 4E33A 5L7TA 1NPYA 4EARA 1KS2A 2INGX 2P4UA 3JWEA 4BP8A 3UBTA 2C5AA 2Z08A 3ACCA 3DDUA 5A6SA 1ECJA 2HTEA 3C3PA 3JASA 4O3FA 3K9LA 2G77B 5HZGA 3ED1A 1OSNA 1WXWA 3DDSA 4QXQA 2R1TB 4PIPA 3ADPA 2G1PA 3H8WA 3L4SO 1JJVA 4FT2A 1X94A 2DWPA 2OBVA 4NYIQ 3BD7A 4DMUB 3A6EA 4O4JB 5KQMA 2FUNB 4NQRA 1GTVA 3WGIA 5IMBA 1R9JA 2A5GA 4MX8A 1AY0A 2O7QA 2AMLA 4QRIA 5KWVA 3TRFA 1JDPA 1M1NB 2X4IA 1ZN9A 4IJKA 1G1MA 1WZIA 5DLPA 4DQUA 1SR8A 4CCYB 1DJLA 1E1DA 4BECA 1GTRA 3TW6A 4FQ7A 4MYTA 2O2EA 1JG3A 2OG1A 1W4BA 1G66A 1ZESA 1ZK3A 4DCVA 1Y6GA 2EGUA 1ESNA 1PV2A 5DNUA 4RA9A 3UJ6A 5H80A 3ETDA 3FHJA 2IZ5A 3K5WA 3LZDA 4MV9A 1Z25A 1A9ZA 1Y63A 2JGJA 4ND5A 2XF2A 3A1FA 4DGSA 5DASA 4LA4A 1WLYA 2QRGA 3GLHA 4KDEA 1TC1A 3VV3A 4I1OA 3PGMA 4RLFA 3E53A 3HV2A 3SJUA 1BE0A 3ILSA 4NBNA 2RKWA 2SECE 4COKA 3TWOA 3K9CA 4EKYA 1CDOA 4C04A 1EH5A 1T29A 2VJAA 3LYLA 4CU5A 2F4VB 3L0SA 4BGDA 1T5IA 1VSUA 4MP6A 1T4CA 1IM8A 1OBVA 1WD7A 4ON9A 5AIAA 5G0WA 1YRBA 3KQYA 3LDGA 3PENA 1QK5A 4IYJA 4CKEA 3NHRA 2VCEA 3SX4A 2EEZA 4FYYA 4EEXA 5KC9A 1LI7A 1VLLA 1EVYA 3JQ9A 1XKXA 4NV0A 4UJ3A 4I50A 2I76A 3UZ0A 1ESZA 1KK2A 3DOOA 5GOTA 4RZUA 3TVDA 3M1IA 4KSYA 4NU5A 5J63A 4AD8A 2XD9A 4UQLA 1OB2A 4HVLA 3EJWA 1Y4ZA 3BAZA 4F2HA 1PT5A 2BKUA 1J9GA 3F90A 5KJ6A 3EX7C 4BNTA 5KSOA 5LBIA 1PNOA 1AN9A 4BWFB 2V7UA 3PQ8A 2P4HX 1XWIA 1KZ4A 3ICPA 4MKXA 3F8WA 2DSNA 2IYOA 5JRHA 1VLHA 2GD1O 3WBKA 5JY1A 5K8LA 1G6Q1 4XQ0A 4YT5A 1FQKA 1Z8DA 1ZJYA 5DX1A 5FTMA 2ZE8A 2O0HA 5JNWA 4XSGA 3VV2A 2C57A 3GZJA 2NXWA 2O6HA 4K6HA 2I5PO 5KKCA 2PT9A 4UM8B 5IBQA 4M8IA 3NWPA 4RK1A 5AOBA 1K6JA 1NYTA 1SXJC 4KBFA 5B1DA 1N8NA 2HC9A 3RS3A 5J5VA 3T7TA 2IUTA 1L1FA 3TVYA 3DR5A 5LQMA 2OY0A 1U6JA 4YQYA 4QFMA 3KYJB 1Y1RA 1IJFA 1AKRA 4PYQA 1ZD2P 3GLIE 1HE8B 1EFPB 1PZGA 2QMHA 3H5OA 3KYBA 4LVUA 3VOBA 1IB6A 3JWIA 3BE6A 4LMRA 1BKSB 1FYVA 3L6UA 3SYMA 4BNVA 1C1XB 3RHZA 3SX2A 3HKEB 3LY9A 2TMKA 4RSMA 5KKNB 3ZIDA 3WWDA 3BRQA 2BFNA 5IUKC 4BVHA 1ZR4A 3UICA 1E5VA 1OB5A 3H8VA 4B3XA 1VG1A 3LY5A 4BDTA 3VNUA 4A15A 1HDXA 2RH8A 3RSZA 1DRVA 1JTFA 4FUTA 2C9ZA 2OD9A 3V8PA 2ZUEA 1H2BA 2GB4A 1H0KA 2HA2A 1JNYA 4QBFA 4BRZA 2Q4EA 5A2QD 5J4LA 2N0SA 3BXXA 3GGDA 3FGZA 4K88A 4CKBA 3BQ9A 3AVXA 1YZ3A 3GRRA 4XCQA 3Q87B 3CF2A 4NE9A 2BMJA 3LXMA 3EASA 1CDZA 4J49A 4WA7A 3QBDA 5LZ2A 5BMVF 3Q88A 3ZTWA 3Q3JB 4IDGA 3CWQA 5BSKA 4HSEA 4UVHA 2WU8A 2RGNC 4X8LA 4DLNA 2WIFA 2I54A 2WMDA 1MAUA 5LMNB 3JWGA 2ZRNA 4QFBA 3L41A 3ER8A 2E0IA 4FE7A 2G28A 1U1CA 4OUDA 2P1ZA 1XIVA 3U7IA 3DOJA 2RGGA 4WW0A 1SXJE 2CMFA 1VE7A 4FU0A 5I5EA 3LM8A 4KQFA 4IIBA 2FXVA 1H69A 1US8B 2ZYSA 1PGQA 2XJ4A 3KIPA 1JBQA 3DZKA 3Q0EA 4KQ1A 1TEHA 4H7HA 4QXOA 2C8KA 1JYEA 3MUEA 3FUCA 3Q9SA 3ZJYA 2OKCA 3PI7A 2DPMA 4C20A 5C8XA 3AMVA 1VECA 5LDGA 1XXHB 2YX1A 4I08A 1SQSA 4W7SA 3KQNA 3BDIA 4RCYA 1UANA 4HMPA 3HRHA 3BTUA 3PDCA 3PF8A 2FLVA 3NTLA 1DTEA 3BERA 1K4MA 1YDFA 4JI8B 2Q5IA 3C7DB 4ZCLA 1Y0BA 1JUDA 3KHUA 3HJFA 1JPJA 3BFPA 2FP4B 3UJ3X 4F86A 4WAUA 2CCGA 2FE4A 3HN6A 1J2UA 4O25A 3LKBA 3O4GA 1U3VA 2IPOA 4KR2A 4KVAA 1VJCA 1O5OA 3DBRB 3G0DA 3LQYA 5SYAA 4Z4IA 2ILVA 2HCFA 1P0PA 1GKIA 4HAYA 5T4EA 3FKSD 3OT5A 4CR8A 3COPA 1D5WA 5EN4A 3K2IA 4BPRA 1TD1A 2PYZA 1Y9AA 1AE1A 2R6JA 3HBFA 4LK2A 3FMFA 4FNAA 4P4SA 3FWNA 4HDQB 3BJEA 4C89A 3G9UA 4N3GA 2OO3A 4J0KA 1UMDA 3AF2A 1UXGA 1KOGA 4A36A 1L5RA 1R0SA 2O8EB 1WCIB 2AUNA 1CY4A 1GNQA 4GOXA 4O02B 3KTFA 1N5RA 3FKJA 3P9IA 1MT0A 4JOBA 3FIUA 4TWIA 1YL6A 2V7XA 4BLRA 1AS2A 4ZRNA 4DR5C 2PSDA 2P6NA 2QQ0A 5EWLB 4BO3A 1V5EA 2RIRA 4NENA 4KTVE 3JATA 2ECPA 4IX1A 5EQDA 3DR3A 1OUMA 2A7QA 3WKBA 3I61A 5TPWB 2R7NA 3WVNA 2OO4A 3GQBB 3GGGA 1MO3A 5TSDA 2RGWA 2PJRA 1ZGCA 1Z83A 3R3UA 4CV1A 1BS1A 2VNJA 2XGOA 3CFYA 2C1EA 2AOUA 3JD4A 4QUGA 7GPBA 4MRRA 5E6RB 1OXUA 2OYCA 4RD6A 1CKEA 1HPLA 1QPBA 1QAQA 3QVSA 2YJNA 2Y99A 5CDFA 5TPWA 1KYZA 1RJDA 2W2VA 1B15A 2I7DA 1OTHA 3AIKA 4GEKA 2CLKB 3IX7A 4P98A 1UWKA 2PD3A 3V97A 3AR3A 4HH3C 3IKVA 3KUUA 1T9DA 2IEIA 3QBTA 2QRHA 1M34B 3QE0A 3RDPA 4DB4A 3CCFA 3NLLA 4XARA 1NXVA 3LP5A 4NPCA 4EIWA 3ANNA 3T9FA 3C14C 4RS4A 4Q03A 5GJCA 4RIEA 2MYPA 3N8GA 1FU8A 2H1WA 2A2ZA 5AKXA 2YVLA 1QE3A 3GEDA 3U48A 2SKCA 5JDIC 5C8YF 3QLEA 4ALNA 2B4TO 4ZCTA 4BMVA 3NI2A 1J1IA 2ZBDA 1XT6A 2LV8A 3B8EA 5KNDA 2QVLA 5FUWA 4B5KA 4A26A 1G9XA 1OMOA 4FYWA 3MC1A 4N03A 4XGIA 1L8LA 1PZNA 2XTNA 2E5LB 3TJZA 2YIJA 3BCHA 3PWZA 2VUUA 4BVBA 3SIXA 1ZX1A 1H0RA 3ZXIA 2PN2A 4LE5A 3E7PA 4L08A 5JNRA 4HLCA 1BFKA 3KO8A 3L6CA 1KVUA 2BP7B 2X5KO 4IGFA 4RDCA 1HZZC 3P2IA 3JAMD 1ZW1A 4M8SA 4HRYA 5F1YA 5H5JA 3QXGA 2EBWA 1N6PA 1Z3IX 1UPTA 3KSRA 2DKNA 4Y1RB 1FPQA 5E7JA 2MYUA 2P3QA 4M1ZA 1XAIA 1IB0A 4WKOA 1QV6A 2R5WA 3WNCA 1ZXXA 1CLUA 2V0CA 2BFFA 3ILVA 3KPJA 3PDIB 5MHTA 2R8RA 4QL3A 4FX5A 3K05A 4RHTA 1ZMBA 2JDID 4M98A 4B3IA 1C50A 2O4CA 2W0MA 4RDHA 4M1EA 5AM0A 2X0NA 1W1UA 4EX7A 2C04A 1A8SA 4DDTA 1NDUA 4Y0VA 1QH1B 1WPQA 4N0DA 1ZK2A 2D5AA 3PICA 3HWSA 3PPXA 1XAHA 2B25A 4OFWA 3E1GA 1XA0A 3IQGX 4WXPA 5FWXA 1KEVA 1VYHA 3L7YA 2LP4Y 4EG1A 2LBPA 2ECOA 5ICGA 2PT7A 4WFIA 3NT2A 1A98A 4YDRA 2EZ4A 1F51E 2B4QA 3SQNA 1UWVA 5ALJA 4LNUB 1KIMA 3R6GA 3HS3A 2FZCA 3WGGA 1XUOA 2I3DA 1Z5GA 5LLDA 3E48A 4I46A 4QDJA 2R00A 1ZK0A 1MR3F 3MK31 4LJ5A 4QGFA 3O2SB 4ACAA 2YDYA 4G4IA 5LXTB 3W79A 1AMNA 2CWWA 1EHYA 3U1TA 4INAA 3F96A 2AHRA 5IDYA 1QFYA 2J0UA 3OJ0A 4JC8A 5CNJA 4UXIA 1MXBA 1EUDA 1FF9A 2EJVA 1UBCA 3ZVNA 1IHXA 2V8OA 3H99A 3RWMB 4ETWA 5I9LA 1FNBA 3DBLA 3OLQA 3IEPA 3HBJA 4NCNA 3X1JA 1NDQA 1N7GA 5C46F 2H5LA 5DVZA 5IDQA 4TXLA 3UFXB 1I36A 3VU1A 4DV3B 3WGOA 3LQRA 1E99A 2JLWA 3WYCA 1XL0A 3SO4A 3C3XA 3O4VA 3MJRA 1BU8A 2FRVA 4Y9SA 3CO5A 2QUHA 2ZR0A 3AR8A 5EZQA 3VO1A 4PCAA 4BYGA 5ALHA 3B12A 4D81A 3FWYA 1BN6A 2DH5A 2OOSA 4FJ0A 1O89A 1TK9A 5HK8A 5TF4A 5JISA 2BFCB 4RDXA 1BKDR 1KVQA 1ZHOA 2VPTA 4KXQA 3BULA 3F6EX 1TO2E 5CBPA 5LDHA 1RKQA 1NNEA 1ORDA 1EJ0A 1WF6A 1XHLA 2GZMA 2DUMA 4GLOA 4ND4A 4Q1DA 4YAOA 5DGTA 5BWBA 1UJBA 3B82A 1EZ4A 2MM9A 3COVA 1Z6XA 3EDMA 1CZRA 1K9VF 3FCAA 1RI1A 3IV6A 4HZIA 3ZV7A 2M5OA 2H7VA 1W85B 2O8CA 2CW5A 3F73A 4CDRA 1GPJA 2QNRA 1QHHB 1QVWA 3UMGA 1UDRA 2P2JA 4IVRA 1L5FA 5FJJA 1DPFA 5J58A 5J4YA 1NW9B 4QOGA 3OCVA 4DFDA 3ZWYA 4ZI2A 3BMNA 3R0JA 4K9SA 4FCWA 5LCXA 4Y30A 4O4IF 4NBWA 5GVRA 1KR5A 2QL7A 1HLFA 1JV2B 4G1MB 4GGMX 1DBPA 1XN4A 2QRKA 3HXMA 3NEJA 4DCGA 5AVKA 4C4RA 1S2MA 2PXCA 4WCFA 5EP3A 3QNUA 4HLQB 5EYPB 2ID9A 3HXLA 3KQMA 3RSSA 1VXRA 1TECE 3LDHA 2IYYA 3EIQA 1N2CE 3K0CA 4NCIA 1M72A 3BICA 2VSYA 3EXHA 1VOTA 3GUVA 4A9AA 5BYJA 2IX3A 1XK7A 1ST3A 4HDCA 5EQFA 3ZDAA 1NA5A 4N9WA 3O8QA 1U9YA 4EF6A 1RQGA 2VAWA 3AM1A 1IOLA 1JQ3A 1F38A 1X7ZA 3NBYC 4WOPA 1WUHS 3GCWA 1E6MA 1GXSB 3OZRA 4U7HA 5HBGA 3PFWO 4A2QA 5C8YB 2C5BA 3A6LA 1AB6A 3W9YA 2GN4A 4EFMA 1EVJA 4TXMA 1U63A 3R3ZA 2VZ8A 3RRXA 4E7OA 1Z4JA 4KQWA 1Z08A 3PC6A 4MMYB 1NW7A 1Z2EA 3H87A 3U0BA 1CVIA 3UM9A 1MHTA 3H6KA 1ZJZA 3V1UA 1U1GA 1G7TA 5ALLA 3K1AA 4JUCA 1PVVA 1EQUA 2XI4A 4MKGA 1BS2A 3RUIA 1EK5A 3ILHA 3I9OA 2C42A 2ZPAA 5ES3A 3EFOA 4ZEWA 1OX5A 1TVMA 4XB1A 3IUBA 1D8AA 2WJPA 5JZVA 2W2QA 3DUFB 3I72A 1UMBB 2RHHA 4ML3A 3AUAA 4RSHA 3QXCA 4NBTA 4UNIA 3RNOA 4QLAA 3SC2B 5EHQA 4I0WB 1RBQA 4W1SA 5GOZA 1Q1QA 4IV0A 5LLTA 1D09A 2OBYA 3WIEA 2IHZA 1J23A 3DKPA 5FH9A 1JS1X 1XRLA 1C1DB 3CLTD 2AZMA 1IXRC 2ZM6C 2A4MA 1ZOOA 4CQMD 1TYEB 1BA3A 3QV1A 1UBEA 4JCOA 3V3TA 2EBUA 1D4OA 5CHYA 3LPNA 3PIIA 3WGTA 2N46A 1FUKA 4IGAA 1IE3A 4PVCA 3GHHA 1AMOA 1G20B 3WMWA 1QIIA 5ADHA 4TLLB 1JHDA 1WHTB 5ALYA 2D4HA 4FSHA 2XITA 3ROGA 5L40A 4TSFD 2JB9A 4UJ5A 2I2DA 4NBRA 3TZCA 2XA9A 4XIYA 2NX2A 3H04A 3WIVA 4YP0A 1R6TA 1Q1BA 1LNZA 2V7PA 2E4XA 2QR3A 3IBTA 5A5DA 2PD4A 4LOJA 4N49A 2CV1A 2I4NA 4YRZA 2WJJA 2WMNB 2X4LA 1OLUA 1HTBA 4DV5C 2Q5HA 1HKUA 4V0MA 4HEHA 1FJHA 1F5NA 2GZAA 4IH4A 3GGSA 1NUHA 2A0KA 3FVWA 2PKQO 4RTRA 4MUXA 1TO6A 4CMEA 1HT1E 1Q0SA 1U8TA 2MR6A 2RGUA 3VNAA 4AP9A 1XA3A 2QM7A 4R2WA 3WAGA 3DJFA 1GRRA 1SKBA 3KWLA 3INGA 4P7FA 4CYMA 2QQGA 4CQMB 3DBIA 2O3QA 3EFBA 4JKIA 4LNUA 2FPWA 1TU3A 2AG0A 3CSUA 3VA7A 1FTWA 2VDVE 4MYDA 3H1EA 3MFQA 1EKXA 1VLMA 3CBGA 4JQYA 4YP1A 3X2EA 4JC0A 2PT7G 3GVPA 2B83A 2F48A 1TM1E 3IVXA 3PDHA 4HADA 3VZPA 2GD0A 3L3BA 4I4TB 3KQVA 4PAGA 2YNMC 1HFJA 1RFLA 1HEYA 4ERNA 3GWGA 1GYRA 2R4UA 3OFSA 3U7EB 3RIYA 2CUNA 5KVVA 2GVZC 1RAAA 3WTCA 3ZXSA 1SULA 1O1YA 2QRPA 2VTDA 3L1JA 1FDRA 3GAMA 1CSEE 5D3ZA 4JWKA 1P44A 2E49A 1EAMA 5E6SB 1AJEA 1PQYA 4MWOA 3DFKA 4Y2PA 1T13A 1E2FA 4L8YA 4NHEA 3GARA 3MJFA 1HE4A 3A31A 3HI6A 2VAPA 2ZRQA 3JD3A 3PFIA 2GHTA 5TGTA 2XAAA 3SQLA 3WIUA 4UNNA 4CEHB 1JDBB 5EESA 4BX8A 5JV5A 2WD9A 1QV9A 1RHUA 2CF6A 3AWIA 3KYDB 1GV1A 5DYGA 1X1RA 4NE7A 2CXSA 4PC3A 4N5IX 3OETA 4LRTB 4RK7A 4M3NA 2XYRA 2Q41A 1F2TA 2KLBA 5F3WB 1O8CA 2GVNA 4QYTA 2OPLB 1P60A 2EJUA 3MVEA 4YT2A 1W36C 5LZ9A 4OLBA 1A8PA 3FRJA 4ZVRA 2V58A 5HG0A 3G6WA 5TS3A 3BRSA 2Z8YM 5HOQA 2UAGA 5H9VA 3EXHC 2R1VA 1VCNA 3ASVA 4A1OA 3G1WA 4C7MA 2DHRA 1WP9A 5EUCA 3HUFA 2Z2XA 3CRRA 3DCNA 3IULA 1JH9A 4EW1A 2PU5A 3AERB 1D9XA 2PZFA 4KAAA 2RHCA 4OP1A 5BN4A 3C5VA 2QSYA 3GL9A 3MOIA 3A9UA 1C9EA 3ORFA 3LTEA 4J1TA 4NY1A 3GFPA 3U5ZB 1H85A 4RPKA 4G4SP 4K7JA 2E3JA 2WFLA 1ZUD1 2BW0A 4FGKA 3ETGA 4FHCA 1R0CA 4D56A 3DF9A 4DBVO 1IRIA 5J3JA 3TUZC 3L4BC 3PQDA 4LJLA 4YJ3B 5KYNA 1PGNA 4V0OA 1JKJA 3OKAA 3SVZA 1R8SA 1EFDN 1P2TA 2AZDA 1XHEA 2F1KA 2RGAA 3PNKA 4LRSB 2W8BB 4P3YA 2WJ4A 3IAUA 1Z0JA 4WNYA 2XMGA 4XEHA 5HGJA 2XW6A 1JEJA 4BVFA 3WK9A 1RPJA 1S2OA 3ZNOA 4H6XA 2VR1A 2Z30A 4G24A 4OAOA 4P2BA 4PBTA 4PGAA 1GAJA 1WCIA 2ORIA 3GFGA 5E1OA 1EM8A 4EI9A 5K4HA 1CQIA 2QMQA 3ZUGA 4KHPB 1P7ZA 2I8CA 2FFRA 2J9FB 2ZW9A 1L7BA 5AVYA 1E18A 4TQGA 2AFIA 5HTOA 5ICCA 3IQDB 1GNRA 4FXPA 5CVCA 2QN2A 1SVMA 1CUAA 1XO1A 3A58B 5LBUA 1W8DA 1PJ2A 3T9DA 3KOZA 3RVDA 1Q21A 2M1XA 1XOIA 1SKYE 3UK7A 4MVJG 4DIBA 1P4SA 5E2BA 4QDXA 3T3DA 1XQXA 4BNZA 3GZTB 5AKKA 4F9EA 1SRRA 1DCFA 2W4MA 3MMPA 5JARA 3ZV3A 1GNTA 1KYVA 1OFIA 2I2FA 3FAKA 3ETHA 3VX4A 3ZZTA 5JFTA 3MLEA 3NTXA 3EXEA 5B3KA 2ZSBA 3GX1A 4H08A 1XEWY 1T6YA 2P9EA 5C2JB 2NTNA 4G1FA 1KJIA 1YZQA 1WS6A 5HVNA 3DAOA 4E15A 1MJGA 2RC5A 1HDGO 1I2MA 3M9WA 3UJHA 4DCSA 2V8BA 2YH2A 4MPDA 4PSDA 3SEQA 2FPSA 3U6BA 4TL9A 4UPDA 2Y0PA 1Z73A 1UXOA 3DHYA 1Q16A 4KUEA 3ZE9A 1RM0A 1DRUA 2HCJB 2P3SA 1NSFA 4QQNA 3T41A 3THOA 1J22A 2BCGY 2HU8A 2J9RA 2KPOA 2W6OA 4URFA 1TLTA 4C4OA 3A4TA 3UK1A 3JYPA 4KQXA 4F2PA 1T5HX 4GWLA 3NBUA 1E3TA 1AD2A 1Z28A 3ZR4B 3ZLJA 4Q9KA 3RIGA 5LBTA 3N1UA 5AHXA 1CQWA 3TLEA 3O4HA 4XSHA 1N0IA 3HO6A 4DJEC 2JZOA 1CFZA 3MCZA 1O6GA 1GHTA 1MO2A 3JR3A 2ZR8A 4MZXA 1QYDA 1M2NA 4TT3A 4QOIA 5K0LA 2D8MA 4DDWA 1V8ZA 1U1IA 1EXWA 1VIVA 4ZQCB 5B5SA 2ENWA 6REQA 2HBQA 2VIIA 1CUYA 1T3TA 2GVDC 5IWAC 3AXTA 4F1KA 2VBGA 3W5UA 4AKGA 3E4DA 2XTZA 3C4QA 3K9NA 2D5LA 1SOWA 1NRJB 2PZ8A 2XMPA 3D4BA 3EXIB 3QBVA 4LPKA 2ETVA 3WZ2A 3CVVA 4MW5A 1POXA 3ECCA 1ZLXA 3ZDZB 9LDBA 1PJ8A 1KFJB 3FOFC 3GGOA 1MB0A 2FCAA 2FXIA 7AT1A 1PK9A 2CXHA 5L6LB 3TTSA 5FNVF 4NOZA 1QYVA 2QD5A 5B58C 2FZGA 3GD5A 4LWOA 3DC7A 4YRJA 5DN6D 2BFAA 5B7QA 4DUGA 4R84A 1FJGC 3WB9A 1WDLA 3OC6A 1UH5A 1CZLA 4LXIA 2ID8A 4JR2A 1S8FA 5D87A 4J7XA 1A7JA 3ABZA 1PR4A 2QX4A 4QVKA 3UFBA 5ESXA 4IINA 1UMKA 3FOBA 5L4NA 1H3EA 2Q7XA 4W1QA 2I4RA 1ZWKA 3OMLA 2PU7A 1Q14A 2RB4A 1GSHA 3RYHA 4W9NA 3KKPA 5B3JC 2AI2A 3R5XA 3AHJA 4TWRA 5PNTA 5JI3E 1VMDA 2PKQP 1YDEA 2JCXA 2VDPB 3C3JA 3GIWA 1X6VA 1HGXA 2QIPA 2AE2A 2R84A 2ZCVA 3HVIA 3I64A 3IAFA 4YJDA 1G0NA 3D8NA 4DQ0A 3LD9A 4ESEA 1DIGA 1ODJA 1SB9A 1XZCA 2JGDA 2Q8PA 1NR7A 2WQZA 3DV9A 3FPKA 3P2OA 1TC2A 3QJYA 4YCBA 6REQB 3LTNC 4QDZA 3GJ5A 2RHMA 1LRJA 3EA0A 4XDGA 3JQRA 5KU7A 2JNVA 3N2ZB 3NAGA 5DHRA 1E2HA 1X80A 4MH4A 1ZMOA 2F17A 2YHIB 4O4IB 4RJLA 3D0KA 5IK2D 2PUAA 4J2TA 1D6JA 1I5OA 1RXWA 1W2HA 3HKDA 4C2UA 4KQ2A 1AA9A 4C0BA 1L9XA 2J3LA 1HXHA 3MCUA 1GTJ1 5D3KA 4ZU6X 3I2FA 4R9SA 3TI7A 4EITA 3EVDA 3KC2A 4LY6A 1GA6A 5CXUA 4Z2AA 1FMJA 1YL7A 3VOSA 3PUVA 2B4KA 1U28A 4JHLA 4EVQA 4E2WA 2X9LA 1XJCA 4MTLA 1NBHA 1QGUB 1VPDA 2O2SA 3BTOA 3IPYA 2RH4A 3CLTC 1VL1A 2PUJA 1SCQA 4AKHA 2PWBA 4HATA 3PNMA 4PGGA 1XCJA 4CV2A 1RCUA 2XVYA 5LB2A 1ZNZA 4ZANA 1T4CB 1ZIXA 5CTJA 3TB6A 1MUUA 3TR5A 5TVGA 1YJQA 2O2DA 3DE6X 4E2XA 3DAFA 5K8UA 1WU8A 4YJFA 5EHNA 4BNDA 2C7OA 2FN4A 4DARA 3CXRA 3P2JA 5JU6A 5AVJA 1VGRA 3NASA 2CDBA 3TM5A 3OQOA 2IZ7A 3JCZA 4H7PA 4EPYA 3IRVA 2P20A 4KXMA 4OH7A 1GFSA 1GU1A 2F9FA 3CNEA 4X5OA 4B7CA 1QHNA 3U0VA 4IIFA 2DMRA 4JYCA 3F74A 3W4KA 1P4EA 3LYUA 3UXYA 2NPFA 5K0FA 2QZPA 5TJ9A 3I83A 1W35A 2IPAB 1X7WB 2MMCA 3W0LB 1H5QA 1ZUIA 1E0JA 3VC3A 1LLUA 1KI8A 4DHWA 4ZCRA 3RYFA 4D6YA 2PY6A 4MVJH 1E77A 4G25A 2CHVA 3E7XA 3BXZA 3CRQA 3H2IA 3RFCA 2BDUA 2LDXA 1S96A 1EZZA 1Z0AA 2A92A 3CINA 3MWDA 3O8LA 4L22A 1PRYA 4Y2GA 1FTNA 3TLGA 4BGUA 5A03A 5ER6A 1QZ3A 2VK2A 1DS6A 1EDBA 3KD2A 4MQBA 4F5YA 5LQAA 1I32A 5GJBA 3R5TA 4JGBA 4FYIA 2YOHA 4E94A 2CZQA 1P3DA 2VYCA 1FXWF 1TTHA 1FVFA 2EJCA 3OCWA 3PL1A 4LMBA 1X38A 1GADO 2P2LA 4HVTA 4UQOA 5E0OA 4PWYA 3REGA 3CG4A 5IKXA 2OBNA 1SVWA 1J33A 4CCYA 4A03A 4QPZA 5F98A 2EFDB 5JS2A 3G89A 1NUUA 2CE2X 3DMTC 3OTHA 3PC8C 3QG1A 4J7AA 5AVOA 1ORRA 5AKJA 3U3XA 4V39A 3T5TA 1VKNA 3ZDYB 3LNCA 3MGGA 3IAEA 4BFCA 1H5UA 4IMPA 3GK3A 2YV2A 4Q3CA 3JQ8A 4EA9A 3B2QA 2XTAA 3S82A 1V26A 2XSZD 3AIMA 5DKFA 4PYJA 1DIHA 4Q66C 4FFBB 1TYAE 4CI0B 2CMDA 1C30B 2CB9A 2MSWA 1JTVA 2P2SA 3UWOA 4QTYA 4JSTA 2QTGA 1VIMA 1W76A 4WT7A 3IQHX 2B1IA 1JSLA 1IJBA 4I66A 4OMCA 4DR2B 4NKRA 3EEFA 1R15A 3PQ7A 1AKWA 5IC5A 3SP1A 1T4MA 3L0BA 1M8KA 1QK4A 1IZ8A 3AT1A 4YYEA 5C1BA 4IQFA 1W36B 1W48A 3BJIC 4CKCB 4NCBA 3GNLA 4JX8A 1QC5B 4GKKB 1NF3A 3KSDO 2YHAA 3PGVA 4R0MA 1CR6A 3TTXA 3KD3A 1UDBA 4DSAA 2IS4A 4E22A 4EJFA 3JXEA 2JGMA 4R31A 4RK4A 2OLEA 1E6LA 3BBPA 1M1YE 3FFBA 1D5CA 4LMPA 5GZ6A 2REXB 3ACBA 3MGAA 2YV3A 4P58A 1S8NA 2B2CA 2IXEA 2DETA 2HJRA 1SELA 4E03A 2NO1A 1UDCA 2FDXA 4ZO7A 4N01A 4EB6B 4G1UC 1KQ3A 3ZXYA 1VA4A 3FGOA 3SOPA 4X7PA 1B0UA 2GBFA 2YQZA 2OBXA 2F00A 3I9LA 4G1IA 5JPCA 3WP0A 5EJGA 1PWHA 5HCIA 5C3MA 1N8TA 3K32A 4BFYA