2Y4NA

Paak1 in complex with phenylacetyl adenylate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
428
structure length
426
Chain Sequence
PLPLEPIETASRDELTALQLERLKWSLRHAYDHSPVYRRKFDEAGVHPDDLKTLADLSRFPFTTKGDLRDSYPFGMFAVPQDRISRIHASSGGKPTVVGYTAADIDTWANLVARSIRAAGARRGDKVHVSYGYGLFTGGLGAHYGAERAGLTVIPFGGGQTEKQVQLIQDFRPDIIMVTPSYMLSIADEIERQGLDPVQSSLRIGIFGAEPWTNDMRVAIEQRMGIDAVDIYGLSEVMGPGVASECVETKDGPTIWEDHFYPEIIDPETGEVLPDGELGELVFTSLTKEALPIIRYRTRDLTRLLPGTARTMRRMEKITGRSDDMMIVRGVNVFPTQIEEQLLKQRALAPHYQIVLTKEGPLDVLTLNVEPCPETAPDTAAIQVAKQALAYDIKSLIGVTAVINVLPVNGIERSVGKARRVVDKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining a Structural and Kinetic Rationale for Paralogous Copies of Phenylacetate-Coa Ligases from the Cystic Fibrosis Pathogen Burkholderia Cenocepacia J2315.
pubmed doi rcsb
source organism Burkholderia cenocepacia
molecule tags Ligase
molecule keywords PHENYLACETATE-COENZYME A LIGASE
total genus 147
structure length 426
sequence length 428
chains with identical sequence B
ec nomenclature ec 6.2.1.30: Phenylacetate--CoA ligase.
pdb deposition date 2011-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2y4nA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y4nA01
4GS5A 3E7WA 3IESA 2P20A 3O84A 5DV9A 4D56A 3QYAA 5D6NA 3NYQA 5K8FA 4WV3A 3U17A 3R44A 5KEIA 3KXWA 2QVYX 4G37A 4R1LA 5BUSA 3LGXA 4U5YD 3L8CA 2QVXX 4RLFA 4ZJZA 2Y4OA 3FCCA 4RM3A 1ULTA 3PBKA 3A9UA 2QVZX 4W8OA 3NYRA 4D57A 2V7BA 2P2FA 3LNVA 3IEPA 2D1QA 1T5HX 1BA3A 1LCIA 1PG4A 4D4GA 4IR7A 4OXIA 4GR4A 3T5CA 4D4IA 4R1MA 3VNQA 3B7WA 2D1RA 3GPCA 3VNRA 5BUQA 4D4HA 5BSVA 2D1SA 3FCEA 3ITEA 3EQ6A 5JRHA 5KYTA 4DG8A 5IFIA 3WVNA 4RVOA 3DLPX 3O82A 2P2JA 3LAXA 5BSUA 1MDBA 1YJ7A 3E7XA 4EATA 3E53A 4M46A 3T5BA 1RY2A 5BURA 5KYVA 3IPLA 4FUQA 3G7SA 4GXQA 4FUTA 3RIXA 2VZEA 4RM2A 3C5EA 2P2QA 5BSMA 3RG2A 1PG3A 2Y4NA 2WD9A 3O83A 4GR5A 4G36A 4RVNA 3IERA 3T5AA 3VNSA 1AMUA 2Y27A 3IVRA 1T5DX 3WV5A 2QW0X 5BSTA 1V25A 3CW9A 2VSQA 4LGCA 2P2BA 4PZPA 3U16A 5GTDA 3DAYA 4E5DA 5E7QA 5BSWA 1MDFA 4RMNA 1MD9A 1V26A 4R0MA 4RLQA 4ISBA 2P2MA 3A9VA 3DHVA 4IZ6A 3WV4A 3ETCA 3CW8X 4GXRA 2D1TA 5DWVA 5BSRA 4OYCA 4DG9A 5K85A 3NI2A 3TSYA
chains in the Genus database with same CATH superfamily
3GGCA 3LCMA 1XJWA 2C4VA 1T91A 4XUCA 10MHA 1EM8B 2FSPA 3LQ4A 1E9DA 2C5GA 5F7ZA 3JWGA 4BQFA 2DHDA 1E2GA 1V4BA 2JVIA 1QWIA 1Q44A 1SKQA 2HMSA 3A1EA 3KKEA 4MUGA 4TLMB 2LZ0A 1GZSA 2VSNA 3O9ZA 4PO3X 5E3IA 5EQTA 4X62B 5AJYA 4ZD6A 5EZ6B 3JQ6A 1JEOA 2PR7A 2CJYA 1LUAA 3OLVA 3LYUA 1NUQA 1OXUA 3W2IA 1XT6A 4B6QA 2NSYA 1MH9A 4Z8YA 3WWZA 2ZBVA 4BWGA 1W0CA 2BFAA 2J4CA 3LY7A 5HIMA 3R7WA 4US2R 2Z4RA 5L6LB 1RT9A 1DJPA 5DXFA 3ABOB 1BQ4A 3M83A 4UTVA 4PNZA 1NA5A 5CM9C 1YDHA 2CF5A 3COVA 3VSCA 1E3TA 2B69A 4AKHA 1A77A 1XRAA 3C97A 3JARA 4I50A 1JIIA 3JWIA 2WKSA 1ZKMA 5H68A 6NULA 2PT6A 1RAEA 1P4EA 1XPJA 2G9VA 2OHJA 3NEPX 1CXZA 4MVJH 1RMYA 5L3SA 1G3UA 1PW5A 1A9QA 2RGAA 3A1WA 1EGAA 2DECA 3IT3A 4G9BA 4B3FX 4DLTA 4BCDA 3BS4A 4ALLA 1KO7A 1P3DA 3IB3A 1ZD2P 4PUHA 3PE6A 3D4LA 4NULA 4RD0A 1MXFA 1NXPA 1M74A 1TZBA 4UUMA 5CVTA 2QRNA 1C0LA 3LRTA 4MZXA 3ZQ6A 3M5WA 3PVCA 4Z0HO 3SM9A 2DSTA 4LXUA 4RIEA 5T4FA 3ZHTA 3U7EB 2PKRA 1I5OA 4CE6A 1X1SA 3L04A 1NLYA 2X5KO 4ES6A 5C18A 3I61A 1FJGB 1CQWA 3VA7A 1RQLA 2H63A 4CGZA 1NG9A 4YRGA 4KQHA 4BFXA 4J6FA 1QB7A 4OOFA 1BXGB 4BBYA 2G9ZA 2FRVA 2BFBA 4A0QA 1ZBDA 3VJLA 4G56A 3VPBA 3ZCPA 4R41A 1AZLA 1T1IA 4QGSA 4DMFA 3OX2A 2ZB4A 5LKRA 1HTTA 4V03A 1OIVA 3NHYA 1P29A 4UVIA 2R3SA 5EZYF 3WYDA 3LO8A 1FDTA 2BFWA 2P4HX 3PXDA 5B3JA 3WLPA 1W29A 2AGVA 4LXQA 1OZGA 4XB1A 3UTDA 3HLTA 4BRZA 3EG9A 3NH6A 3PQ7A 6PFKA 3FH0A 2QTTA 2W2QA 3P20A 1ND6A 5FFMA 4PYNA 1JOSA 2YY7A 3BSWA 4RX1A 4HHEA 1PTJC 1WETA 3TQOA 1KEWA 5FJIA 4BFZA 1JJVA 4J2HA 4ENVA 1GCOA 1R9GA 2GA8A 3QK7A 4NMXB 4P81A 3RIHA 1GN8A 4CM9D 3K9WA 2ID7A 5LZ5A 3F98A 4D79A 4PZPA 3D6AA 4F84A 4KFRA 5AXBA 2I22A 2F8LA 4EYKA 4KO4S 3QEBZ 4X93A 4RYLA 2OOKA 5JAMA 1W25A 3AVVA 1QIEA 4CM5A 4BNMA 2FWRA 2HMAA 4AYTA 5LJIA 5T8TA 5CPFA 3KL2A 2UU9B 4QOIA 2O05A 5CCDA 1FNCA 1WA5A 1VZ3A 4ER3A 3HU2A 2HMVA 4YMTA 2IH4A 4DFDA 3RYIA 3UMJA 4EI7A 1JFTA 5DHAA 3BJEA 1KMNA 3U4HA 2G17A 4URVR 1UMDB 5MN4A 4QUHA 5GPBA 3CF0A 2BM8A 1GZ7A 3FYUA 3W5DA 3KQNA 2FSVC 5CBPA 1RYDA 3S5UA 4PUIA 1JHAA 4AUKA 3E27A 3I9V1 1C3OB 3IDOA 4L5IA 4S2EA 1K7FB 4WKNA 1WW3A 3HU5A 4Q7QA 1JDNA 1JQBA 2QMEA 5JZ9A 4TMZA 1TEHA 2REOA 4P5PA 2M6KA 5K0LA 3ENZA 2P3SA 1L7AA 3FYCA 4FKZA 4IICA 4XSHA 3UC9A 2N75A 4UMEA 1IBSA 2WT8A 4KLZA 3VVLA 2NU9A 3TD6A 3WTBA 1IC6A 3EEOA 3L79A 2Z9CA 3L95X 2JGNA 3NT2A 4IGAA 4WLOA 1F7UA 1HT1E 4V02A 3O03A 4LZZA 4YJGB 5HJ5A 1BO6A 2AKAB 4ZVRA 4Y1GA 3P9KA 2H2HA 1ZB9A 2D0OB 3HM9A 1SJ9A 1YOBA 4D1YA 1H2XA 3BREA 1E2PA 4UNIA 4JUBA 4QPDA 2ZRNA 3UMRA 1WXXA 2JLXA 1AM4D 4CI0B 5E1OA 3SSNA 1VL5A 2CVQA 1D03A 1W9MA 3Q3HA 3W6PA 2F62A 4DLLA 1PT9A 2CLFB 3DOEA 3B5EA 5K51A 5A4DA 1GARA 2Y76A 1ZC3A 1WMFA 4AZ3B 1DFHA 4MH0R 4JZKA 3T7SA 1QBKC 1RRGA 4AJOA 3WNCA 3HO1A 3UEOA 1M7BA 3EQ6A 4QD3A 3U5TA 4MYTA 3WS7A 5K8LA 2R9VA 3FPJA 1VL6A 3Q0EA 1T8YA 4KXQA 2JFXA 1SCUA 1TD1A 2ZRCA 2YXBA 2VJNA 4O33A 4X97A 3OF2A 1YHNA 5U1PA 3VISA 3ZS8A 1OBCA 5B6JA 2PCLA 3R8CA 3DLTA 3OEEA 2H1WA 3EEIA 3IMLA 2ECQA 2ST1A 3KVYA 5EKUA 1OLXB 1Z07A 3SQNA 3MTBA 1HPLA 5F35A 3HXPA 1H1LB 1RTKA 4BGVA 1BRTA 1O9TA 3U7QB 1RI2A 2EHDA 2BJOA 3UO8B 5L95A 4KFCA 1I4OA 1OT5A 2OP0A 2XAAA 3HP4A 3ILSA 1EJ2A 2GBCA 1C1YA 3BIOA 3E82A 2AI1A 4RHFA 1N78A 1LX6A 4W5NA 3NU1A 3BWVA 4JI5B 3N3BC 5GOZA 4DNQA 4DR4B 4PIMA 2Z30A 1I3LA 5BMVF 4X7RA 5LQCA 1YGYA 1PT7A 2ASEA 3KUXA 3MC1A 4GWKA 4XA8A 1M6XA 3L41A 3N2IA 1E89A 4KYIB 4HS9A 1OC2A 1V1MB 3SEFA 3T3PB 3D31A 3BH7A 4U0JA 3KQUA 4DMMA 3DE3X 1UXHA 1V3QE 2FF5A 3FE2A 3GRFA 1XEWX 1IIRA 3QVWA 3I28A 5LWQA 1P45A 3CW9A 2WSBA 2XGGA 3BTOA 4RV5A 4CWAA 4GPZA 3MCWA 4M60A 3OZGA 4YAOA 4IIFA 2HF7A 1G5RA 1Y5LA 4HDNA 1IIBA 2FRDC 3AM3A 1RSZA 4RK5A 1U2QA 3DWGA 1VPTA 4D9KA 3RJ9A 1E9BA 4PANA 1I6LA 1SPXA 1H0KA 1QFMA 4H7EA 3EZGA 4L6IA 4YMVA 4DTCA 4ND6A 4JR2A 2BM9A 3WYEA 3DL0A 3KETA 4PZ0A 2FX5A 1HE3A 1FRNA 2YR0A 1VBFA 2VK2A 4RTNA 2Q99A 5HF8A 1P0IA 2WILA 3EVCA 1A9PA 3K70B 3TSYA 5K6TA 4OUDA 1EE1A 1N33B 4GSKA 5A04A 2NZ8A 3E3NA 3CJEA 3WGVA 2CEAA 3AC0A 3D7LA 3FDZA 2CL5A 4FZRA 3OM8A 4A10A 4DAOA 3ENNA 3EVEA 3GXBA 2ZCJA 4RV4A 3TE7A 1I6MA 2O3QA 1DCKA 2AEMA 3AO0B 5IT9D 2ODPA 3B1FA 3GA0A 1QWOA 3HA5A 3G5UA 1FU4A 1O03A 1Z4MA 1RKQA 1H0SA 1CUBA 1AXGA 1Q0RA 2ZOSA 3HRKA 4MMXB 1II0A 2OCAA 3FRIA 4WKOA 5BSEA 4GLOA 4I19A 4R5HA 2O54A 3AP3A 4QUJA 2O2IA 2I78A 5EJGA 4EHIA 4PXSA 3OZTA 4Q4DA 3TTSA 4J0CA 1UEJA 4P31A 2MU1A 3MVEA 4JVOA 4NKRA 3E70C 4EAQA 4FBGA 2ZCUA 3K1JA 1U02A 4JKIA 1ABBA 1BOOA 3SJCA 1PS0A 1HQDA 1OFTA 1WZIA 3JAKA 4PZUA 3VI4B 2ZTSA 4FTFA 5B1HA 1GTZA 1XNGA 2BI4A 2I6UA 2WPDA 3HSSA 4I2NA 3UAGA 4DQXA 5MF6A 4GT1A 1QLHA 1ENOA 3QI2A 4KH1A 1G4HA 2GBLC 3FYUB 1L7PA 2YMLA 3VVCA 4NQRA 4EHHA 3CZ5A 3LBNA 1BROA 1SH7A 2JDIA 5JWHA 3C7KA 4CIDA 4B2IA 5AW1A 4R2JA 5K9ZA 4RTJA 4R1MA 4E2FA 3JWPA 4NU0A 1Q3KA 1J09A 3E0QA 4RKEA 4MVJA 3HFSA 4JX8A 3DEYX 3WLRA 1G3RA 1YC5A 4RQUA 2AKEA 4XARA 3LK6A 2QL5A 3O4JA 4UBNA 3IJ5A 5BSUA 4HB0A 3W8RA 5A9TA 1N5DA 1W44A 1GZ6A 5JT1A 3GVIA 4FFBB 5LYJA 4G8CA 4DLAA 2YWCA 1FU7A 2XMZA 3IPLA 2WUDA 4LQDA 5JNUA 4P3YA 1W36B 3WL3A 5AHWA 4CLRA 2FN9A 1C9KA 3C5EA 1DKMA 5FTKA 1DU4A 1MR3F 1DEOA 3T9FA 3DZCA 1DBIA 4H4EA 1SQ0A 4LUCA 3USES 3C6KA 4HXGA 4NXMB 1RVV1 1ZEMA 1QC5B 5CH3A 4F86A 2N3ZA 3LHKA 4Q3KA 3OCCA 3AB8A 3L4EA 5NULA 3HB5X 5TQ0A 2X9VA 4OH1A 4BFCA 5BNTA 3CQ3A 4UM8B 1XZJA 1NE2A 4YT8A 4B75A 1KXJA 1KI6B 1XLTA 4LHYA 5JC1A 1TUBB 4QBIA 1EE9A 4WL0A 1L5LA 1QP4A 2XNDD 1QO0A 4D9JA 1O95A 2A58A 4ZDJA 1FP6A 1XRJA 1EAMA 1GTG1 1Q77A 3OU2A 2VHCA 5K0CA 4EK9A 3BGSA 4CKCB 3TGPA 1NQVA 1TF5A 1NN0A 4KSCA 1XMJA 2P0YA 5LLTA 1UWKA 2XUAA 3NC1C 3GJQA 5FX2A 3RAFC 1ZXBA 5CDYA 3R7FA 1LB1B 4G0VA 4WCFA 3EFEA 4R8LA 2CHVA 4PY2A 4EYEA 4EF5A 3GDGA 3OLZA 3KB1A 3WV4A 4F85A 2C1ZA 4TSKA 5JI2E 1GCGA 4J7UA 2GVNA 4R8KA 5KMGA 3WMRA 3IPAA 3RFCA 2HGSA 5ER6A 1FP2A 3GIDA 4PUGA 2AG6A 1C2YA 1MFPA 3EUEA 1P2BA 1WD5A 5CPBA 3I1FA 1X13A 3L05A 2AOVA 4P54A 4QRIA 3RC7A 4NCKA 5JPIA 4EHLA 3H1PA 4Z2AA 2BTQB 4NBTA 1J07A 2F8TA 4DKJA 1WL8A 1Y5NA 1YJCA 4IFBA 4N5LA 3WGUA 5LQJA 3J80A 4FW8A 3ZVRA 3B36A 3FJ1A 3H8WA 3KWMA 2OB1A 1UK6A 4ZVNA 2Q45A 3RANA 4PO9A 4GOJA 4L15A 3ICOA 1POXA 4D8WA 2NU7A 3O1IC 4E5PA 2P65A 4KVZA 4J94A 4Z9FA 3MB8A 2J7KA 2IYSA 1WDTA 1QAQA 2WIAA 1QQ5A 3S2GA 3I6BA 5EXXA 3ONEA 2ANCA 4XVRA 3WMFA 1R8JA 1XX6A 1K88A 1DEHA 2BZ1A 2JAQA 3WWYA 5TR9A 2XB9A 3T1HB 2QPAA 5K3SA 3JASB 2VCEA 2P0EA 5B30A 4KR0A 3ZCTA 3MWFA 3WGIA 3NP9A 2RHOA 2PXXA 3GFBA 3SC4A 1NL3A 3GUCA 1PRYA 5CK5A 4ZJPA 1U8CB 4BWYA 1NW4A 4ND8B 1OXTA 2H1VA 2PH3A 3OJ0A 5IT9A 5LUAA 1RJDA 4LRWA 1B0PA 2BM0A 2GRUA 4D8YA 3EGEA 3P0EA 1UBNA 2NNLD 3QVKA 4YAEA 2A5YB 3O8OB 1Z5NA 1H0RA 2GK4A 4AB1A 1KTIA 3J81k 3MYRA 2P0AA 2REXB 3MHPA 3L8GA 1CVIA 1GGKA 3O2NA 3LVBA 2A0XA 4BB9A 1JS1X 3FNFA 1T5IA 1OPRA 1FS4A 2VHEA 5LA6B 5HX7A 4DKXA 1QG6A 1CS4C 3FWHA 5KNCH 3ZJTA 3NEJA 1GXSA 2CUNA 1S1MA 4DCPA 5T3YA 4F8YA 4WZBA 1TPZA 3ME5A 1EFTA 2VF8A 3CHYA 3HE3A 4I1IA 4N01A 3G0HA 3OPQA 3BL8A 4E70A 5A3RA 5JZBA 4HQFA 2JW5A 2DEUA 5KYVA 4CQLA 4F5YA 3WLAA 5C8YB 3RGGA 5HIKA 4I5GA 4NJMA 2P6PA 3CH4B 1WP9A 1QORA 1Z4KA 2YY5A 1WB6A 4NJEB 2VAWA 2JLVA 4BKMA 2HX1A 2ATCA 3QWIA 3U7QA 4B8WA 1ODCA 2Q7XA 2UUPA 4CIWA 1R88A 3UXYA 3TXXA 2NAPA 5CJJA 3E5HA 4BV8A 1GPNA 2H2IA 4MRVA 4ZVVA 2W48A 3SE7A 1ZLYA 1I2MA 2VP5A 2BL4A 1KS2A 2JCYA 1ZRMA 1I14A 3AXSA 2GT1A 5K3CA 1IG0A 4YMIA 1DWPA 4JWTA 5T8KA 1BYIA 1IAVA 2A78A 3WGOA 5MDHA 4PFKA 2RCNA 4F4IA 1GNTA 4ABYA 1GRRA 3F90A 4ZZ0A 5FDFA 1JLLB 1EK5A 3I58A 3AHEA 3CZQA 1S7GA 4KXNA 3ZWWA 4UBIA 1ZD9A 3OBIA 3K71B 5TS2A 2DLDA 6ADHA 1C7RA 1Z5WA 4MUJA 4O4JB 1VZ2A 3IBTA 3GLHA 3M4XA 1JE1A 3K35A 3C4QA 3C8HA 4WFIA 5IM4A 4F5ZA 3I62A 3VJRA 5BMVA 4AECA 1YACA 4UPVA 1DCTA 1NY6A 1KAGA 2EDAA 2ZREA 4E3WA 3SO4A 1MORA 5TJHA 2JB9A 4AKTA 3JQFA 1EQ2A 5ALVA 4FJ0A 3DDHA 3EXFA 1T4CA 2VG8A 4I99A 4LV5B 4EO4A 5CFLA 1ZONA 4U7DA 3P0JA 4TS3A 4L4ZA 2JFUA 3URKA 4WK0B 1PBNA 1PZMA 1FJGC 2GKOA 5TQ2B 1X7XA 2BDTA 3QHQA 3R44A 3GRYA 2RC5A 2E6UX 3KXDA 4MUIA 4NHOA 4MLDA 4Z0TA 1BMFD 5FKJA 5KSOA 1S8AA 4KREA 2WQZA 4J49A 2F59A 4MQFA 1FTGA 4K9OA 1M2FA 2H1HA 5EWMA 3W2FA 3F9IA 3IQHX 3B48A 5F7OA 4V2IA 3I5XA 2HXYA 4QYXA 2NO6A 3HO8A 5CB4F 1RRCA 3AV0B 2Z6UA 1FX0A 1QFJA 4DC1A 5LVAA 4BO5A 2XSZD 2R87A 3BERA 4X61A 2P4EA 3RUCA 4E1VA 1BE1A 1DTSA 4MVCA 5LKAA 1GTRA 1WSAA 3IJPA 3KALA 2BY4A 2NTNA 2QN7A 3CLUC 1DJLA 3AVYA 2BCJQ 3ILHA 2ZM6B 1TD9A 2XLCA 2G40A 2FDCA 3L1KA 4ZT4A 3QVXA 2FR1A 1KVUA 3GEMA 2BTQA 4AY3A 4OXIA 1HNZC 1Q0ZA 1BE6A 1Y9AA 3O1LA 3ZY6A 5I3ZA 3GJZA 1P5JA 2O7QA 4LTMA 1CUJA 5DCWA 2F8SA 2WJZB 3IT0A 4A6EA 3PCTA 3WO1A 4C43A 3U3ZA 3OZUA 3HR8A 1BD3A 1RM4A 1P19A 2NV2B 4H1VA 4CU5A 3H2HA 3BFPA 5CYGA 2C4HA 1JKJA 3O1JC 3D6JA 2YFKA 4BNVA 4DG8A 2GEBA 1BQEA 9LDTA 1I5EA 1FUGA 4NV1A 4QNMA 1NMZA 2CMDA 4R1QA 3T5DA 3G8DA 3PRKE 4TYWA 2XRYA 2OFWA 5IC6A 3GXOA 3FSRA 3IAHA 4K8OA 1R5JA 1HF3A 4IHKA 4KXYA 1UDCA 3SDBA 3OE7D 1O3YA 1DAHA 2VQSA 3LHDA 3DMTA 4K9RA 3TQHA 1Q0LA 4O1HA 1L5SA 4IJWA 2IQ5A 3T3EA 4EMTA 3GUHA 4MIOA 4QYIA 1I9GA 2W6CX 4GYYA 3UK6A 1SXPA 3DW1X 2QLTA 3Q7TA 1NN3A 2XEDA 1P4EC 3Q7SA 4BAZA 4NZPA 4DA7A 2ZUWA 4K0KC 3EGXB 3D81A 3SX0A 5J4HA 2I6GA 5K20A 3K15A 1JR4A 4GR5A 1Z68A 1WULS 4WSOA 4BMZA 2XWBF 1EWKA 1PCXA 4UEKA 1DHTA 2V65A 4LY6A 1WSDA 1AQNA 3ENWA 5HNKA 1EX9A 3KE9A 3QUAA 2UVPA 4K46A 4JAVC 4MROA 1WPRA 4BX3A 2Q2NA 2CMHA 4CG3A 4E2YA 1BEUB 1X1TA 2I7XA 3UMYA 4X64C 2B5WA 4PTZA 1KC3A 2I4TA 1L7BA 2CCJA 4RE5A 1NQUA 4JLBA 5JMPA 1Y37A 4CETA 4GBED 3NBYC 4UOZA 4RMGA 3IAFA 3MTIA 4PLTA 1KY3A 3K1ZA 1XA4A 4Z6KA 3KTFA 5IZCC 2X6RA 4ZZ3A 3LQ2A 3MZ0A 4L5JA 5ESDA 5LYYA 1ADJA 2OHOA 1KYXA 3E03A 4FNMA 2KWIA 1N3IA 2GRAA 3HUDA 3QA9A 4Q1BA 4Q9AA 2V3VA 3P1JA 3QNMA 2Q8QA 4FILA 3H9GA 1M6VA 3DEAA 3IP1A 2P9FA 3A27A 4OVKA 1OU0A 5DM4A 3CW8X 5EIBC 1PDOA 2PGAA 2ZIGA 4Q1EA 3S8YA 2MIIA 1IPEA 1H2FA 2N9UA 4XX0A 2GCGA 4AC9A 1A72A 1QK5A 1TEXA 1C3VA 3EXIA 4R84A 4HAVA 1OVGA 1U6JA 4ND4A 5KJCA 3M8KA 1VTKA 2A5DA 1MQ9A 2YHBA 4INOA 5MFPA 1DRWA 2V6FA 2FF7A 1CEXA 1NT4A 4CJXA 5H83A 4XLLA 5LQDA 4C3VA 1YR3A 1OA0A 3AFNA 1WDWB 4P35A 1HRKA 1GP2A 2J3MA 2ONYA 1B3BA 1ISPA 5TE9A 2BGIA 3GZNB 5FBWB 4IJKA 2QNIA 4LF7C 3IUEA 4ZQEA 4EUHA 4ZJUA 2XQJA 3UOAB 4BJ1A 3B6KA 3PE3A 2JHFA 1SKAA 1T24A 4S1TA 4X1KA 2HMWA 2TRSB 1O90A 1S3FA 5AJVB 3SHVA 3WOVA 2UZ4A 3ZJVA 2R65A 2DTEA 2ORED 4FMBB 4DXDA 3KU1A 4OG2A 2VLIA 2JD0A 4PG4A 3UATA 3JALA 3O9VA 2HK8A 3DVSX 3H6GA 3ZE0B 2I71A 3PK0A 4I55B 2VDQB 2CVHA 3D2BA 1FSFA 1WXWA 3GNLA 3C45A 1V35A 2QR3A 4BV2A 2G88A 3OTIA 1CZHA 2IKSA 4L95C 4NENB 2JI9A 1UOOA 4AULA 2WWFA 2XVZA 1XN4A 1Z39A 2IBMA 3GEDA 5CW2A 1GKIA 1YDGA 2H16A 2VNKA 3B5IA 1GQYA 1DAEA 1NM5C 1L4UA 1LDMA 1XP5A 3COSA 2FFQA 4CM8A 2A1TS 4O3MA 1O58A 1Q12A 3N70A 3RFVA 2AFHB 4ICIA 4EJ0A 5JRJA 2O9JA 2G1AA 2WTAA 2X4IA 4IQ8A 3ND9A 1EA7A 1MX9A 1GL9B 5LDGA 4ZC1A 3TTWA 3A1VA 1GKUB 1S9HA 3BULA 1NIPA 3DQZA 1R0ZA 1L7RA 1PYGA 1UF9A 1TLTA 3B8HA 3JSAA 1SBYA 3K0AA 4FYWA 4X63A 3ZIDA 3AETB 4JI1B 3SE0A 1E6CA 3WXBA 4D41A 2VQFB 1FLVA 2QN8A 4PPNA 5FTWA 4CL8A 4D46A 2G63A 1Z5UA 5JH7B 2GF2A 2DHMA 4CMCA 3O8LA 1FEZA 1PL8A 1TMGE 1E6UA 1WTCA 1C3LA 1X15A 3IVMA 4GSYA 4QJIA 4BU0A 5JD3A 1W5BA 4XGKA 1GLNA 2IYNA 2IZ7A 4JYMA 2WYIA 4XVQA 3E8XA 5E6UA 3RKUA 4G1BA 1H3FA 2P3OA 5LCXA 1C4XA 1PDVA 4J90A 3L8HA 4O4HF 3KKLA 4KN6A 4V2UA 5K3FA 2RAPA 4MVXA 1PTKA 2HRCA 4UQLA 3HA3A 1UPCA 3KTAA 4UDYX 1EGMB 3ZZTA 1HT3A 4CKBA 1JJBA 3G49A 1IY9A 3HJNA 4K3UA 3C1AA 3NRJA 3ORRA 4DPLA 4K9QA 3EFHA 2D1FA 3LZDA 1BOFA 1LS6A 3CBQA 3HY3A 3NPDA 5ECWA 1UBCA 4NXMC 1BKYA 1VHWA 1WB4A 1JUDA 3KEGA 5F33A 3V9AA 4ALNA 1AV7A 1QG2A 4B3JA 1MC8A 4Q3NA 5HF5A 5HSGA 4QAJA 4Z3DA 3HM2A 1UXGA 1YJ8A 2CCKA 4XPIB 5BQ3A 2IDMA 2PQ2A 4PYKA 3TNDA 2EVWX 4LQ4A 3SF0A 1Z2AA 3K5PA 4MULA 3MUFA 3CX7A 4MUAA 4QIHA 4U2KA 1EGHA 2ZQZA 3ONDA 4RADA 4Y6PA 1CNFA 3BGDA 4MKGA 2VJYA 4U7FA 5HBRA 3L77A 3RUFA 3EPLA 3ZGOA 1S3GA 5LCIA 4TVBA 4ERNA 1QPZA 5TB5A 3AR9A 2WHXA 4LC0A 4PYJA 3SS9X 3CEAA 5HP4A 3EZNA 1PJRA 1XD2B 4KSBA 3C8ZA 4DG9A 5AKZA 3VNBA 4PG5A 1JEDA 5C7LO 3WQBA 3LNOA 1W6UA 1TXGA 3UA4A 1I7LA 2P8SA 3QE0A 4QG7A 4DWOA 2R2GA 1JB9A 1Q22A 1L7DA 2ZXFA 3GH1A 4A0GA 4EJFA 4TSFA 4ZN6A 2X22A 3TTYA 1SVUA 1E3DA 3FWNA 3PDCA 1T3ZA 4DVJA 2NQ2C 3ER6A 1JEQB 3A1NA 3C6ZA 4TL7A 2AN3A 4TRJA 3KYCB 5M3BA 1V7PC 2H4YA 1P0CA 3D6TB 4HATA 4CL2A 5FB3A 2HJWA 4KXXA 5EHNA 4PS1A 1W0KD 4QOGA 5KTMA 3R8FA 1GG2A 2DHRA 2HF9A 3HDYA 3KT0A 2ZE8A 1M1ZA 3ICCA 1M8PA 1U7HA 2Q6OA 4MGZR 2WA1A 4QBFA 2Y1OA 2JJYA 2OFXA 4P4SB 3AOGA 4A8TA 2X0IA 1DCFA 3B9RA 5JSZA 3BGOS 4FFSA 3S2FA 1HTBA 1YGPA 4R9NA 2UVDA 4AO6A 1GA6A 3KYDA 3NJ8A 1A9XA 4ARZB 2QM0A 5BQOA 5H82A 3D7NA 3RTAA 5KYYA 5LP1A 3I3OA 4LX8A 2DHCA 4CDRA 1IM2A 1DMSA 2EG9A 3MINA 4KMRA 1ZK1A 3OY2A 3PFGA 2ORVA 5DOZA 2WFLB 2ZWOA 1H5UA 3W8EA 1B16A 4JZYA 2A9KA 2D0DA 4G0MA 2IHJA 3S70A 3ADBA 1A7KA 3PC6A 3TX2A 3BDVA 4KQCA 1A82A 3QLUC 2O5CA 2JVKA 1JPUA 2O8CA 2C96A 3HEAA 4MQUA 3BIXA 2H6EA 1F7VA 3GLFE 2FJUA 3TXYA 5C3UA 2XGJA 3JRXA 3LF2A 3LPMA 3UUEA 2B30A 1WXHA 3W3AA 4GUAA 5DF1A 2YJGA 1ZL0A 2R8XA 1NJGA 5LU8A 1GQFA 1A98A 4O2BF 4ENQA 3AEQA 1DBWA 2PEZA 2ETVA 3NWOA 3QMMA 1U7ZA 1JLRA 3CLUD 1J70A 2BC9A 4FWIB 1NATA 3E9EA 1EBFA 1RYMA 4D99A 2DQZA 4YJ3B 5B58C 1H22A 4WKGA 4Y6QA 1GUBA 3AY7A 3W6OA 1V1JA 2J3KA 1RMQA 4AVYA 4JLMA 1EVKA 5DGTA 4CM8B 5BR4A 3T06B 3QITA 3DCJA 2R1UA 3KB2A 2YZGA 2GHRA 4XEUA 2XUIA 4MQ4A 3R8XA 2C0CA 1N5RA 3PC2A 4C7KA 5LMNB 4IXTA 4YAJA 1J8MF 1T3GA 4U9IS 4CLEA 4R7GA 1E77A 1V8ZA 3PNSA 3U3XA 1GGHA 2JCXA 2P6OA 4RH3A 5LQAA 3ZE7A 4ZXPA 3JYHA 4DBLC 1M34B 4CEIB 5AKLA 3JWEA 5EE1A 1NJ6A 3OD1A 4WXMA 3E22B 4RMIA 5HUHA 4KRFA 1SC3A 3E2MA 3ICQB 1RRVA 1P75A 4XJXA 1OI3A 2I2BA 5AM5A 1O5TA 3ESDA 2P9GA 3GGPA 3F5DA 2X41A 1CHNA 4JP5A 1EFAA 4YWHA 1TQHA 2PO5A 3EVFA 1MJGA 4UCWA 5JTTA 3EPJA 4FM9A 2ANBA 2EFYA 2BKLA 2QN6A 3HFRA 1X1DA 2GUWA 2PBFA 2FPGA 4KMSA 4XZ3A 3RS8A 5IJ9B 5LL6P 2VP2A 3VH1A 2FMUA 3DC2A 2V4MA 3EYAA 3RR2A 1VB5A 3Q7RA 4EG4A 5JVDA 3SYNA 1G2OA 1K5GA 4DM3A 4HLNA 1V8OA 5F73A 4UZFA 1JNXX 1GSAA 2MYTA 4KK4A 5IEJA 4GO1A 3VYSB 4DLSA 4B7XA 2HTFA 4H4CA 3OEHD 1DDGA 2QU7A 2YJ3A 3CISA 2A35A 3N5KA 1CFZA 4GDMA 4E1AA 4PLYA 1IUOA 3WLLA 5JNVA 1SELA 3NGMA 2EZ9A 2FFAA 4YC7A 5CA0F 2DFKB 3CZPA 1QLWA 4RS3A 2IXBA 3G1WA 4F06A 3HB4X 1BXRA 3OPYI 2Z0MA 1FFXB 1AN0A 4UXJA 2YX1A 1MA3A 1QHYA 1E63A 3EGIA 7ADHA 4ZCRA 2VJQA 4CBVA 1NVDA 4UAUA 4GDFA 4IFEA 4NZOA 1B76A 3NWEA 5CHEA 3HWX1 5KNBA 3BEDA 3AVUA 4RESA 4UVEA 3VOAA 1C7QA 3ZEIA 2HSEA 2OILA 3GVPA 5IAGA 4BB5A 2JASA 3PZRA 3MLAA 2I62A 3U7JA 4CMAA 2HB6A 5FOXA 5G0TA 4MLZA 4A3SA 1SUWA 1CE8B 4OHBA 3OIUA 3RSSA 5IDQA 2QMUA 1REQA 4O2RA 4PG7A 3CF4A 1IJKA 5DNAA 1W36C 2FFJA 5JC8A 3DOFA 5J2UF 2IW3A 4JC4A 3L7LA 2DUJA 5D3KA 1VG8A 5DN6D 3TK1A 4RA9B 5AKJA 1SHUX 3I45A 3M5PA 3TR0A 3WO0A 4AKEA 2Y2VA 3WKDA 2VSXA 5I8ZA 4LFAC 3DDZX 3QVSA 3O8BA 4TZ0A 1AUXA 4IHJA 2Q5CA 1VIMA 4DV1B 3DWEX 1JAHA 2P9YA 2VHQA 5KHOC 2VNJA 2IZZA 4L0MA 2VZEA 3Q8KA 4ZIRB 3DJFA 3PUKA 5C35A 4IF4A 4AN1A 5BN5A 4LF9B 1YE8A 4RVSA 1GT91 4CMEA 1G38A 2PA0A 4R1UA 4WNIA 3Q8LA 4UUQA 5AT1A 3ZU4A 2YFHA 4G67A 2QM3A 1AXEA 4BGEA 5SY6A 3IEVA 2ISSD 4FFRA 4ER0A 4ZZIA 1XZNA 1P9WA 1KRHA 1ZUNB 4FIZA 4ZYXA 2ON6A 3HN6A 3NIDB 4CDMA 3I0ZA 4PWZA 3T38A 1F2UB 1JIKA 1JQLB 1IZYA 1T3HA 3HFJA 5EMJA 1APBA 4H18A 3DEKA 1PV1A 2EYUA 3K8ZA 4KV9A 1RPTA 3BWBA 5BVGA 4UNQA 1PL6A 2AC7A 3M4NA 2H8GA 2XADA 4NEHB 3WL4A 1GG9A 2B7CA 1EG2A 1HDIA 3U16A 1YMUA 2W71A 2ZPAA 4N3NA 4YAGA 5E7QA 2AR0A 4PRYA 3GLGE 2ACEA 2WF8A 2BONA 4YR9A 3EBLA 3PUHA 4BVGA 5J3JA 2V3WA 1XZMA 1QVWA 3OZFA 3GO4A 1W2HA 2IELA 3NVDA 4ZT5A 3ZLBA 3VDRA 2H59A 3CRRA 3QUTA 1T4CB 5CLJA 2VSYA 1XTIA 5LOVA 3RRNA 1CQXA 3P9RA 4HPWA 3CSSA 1E96A 1T35A 2A0WA 2A92A 1XZAA 2WK1A 3I73A 4XQ9A 3EPKA 1UM8A 3T9EA 4OLBA 3FRJA 5HJ2A 4ARVA 2X0JA 2PZJA 4L7VA 4JBNA 5ECDA 1E1CB 4QDXA 1I1OA 3RU9A 3RVQA 4HNTA 2YWDA 4K9SA 2B36A 2IYWA 3AM4A 4UHKA 4E5NA 3FRHA 3GJTA 3T1HC 3EC2A 4RH0A 3K94A 2SCUB 4PYMA 1M73E 4M8LA 3C24A 2QTBA 1A4RA 2YTZA 1KYTA 5IASA 1L1QA 3K9CA 5ERXA 2A84A 3DUWA 5DULA 1QCZA 1AHNA 5JSYA 3RVBA 1XCOA 3MS4A 5DJ5A 5CB4A 4TMFA 1Y4DE 3Q6MA 4MUXA 4GXTA 1BGXT 2J07A 4UPDA 3I6YA 2PUCA 2VH2A 5BSFA 4B17A 2BTOA 2PKYX 3HEMA 1CLEA 4GOND 3AVWA 1C1HA 2C97A 2PZBA 1A4XA 1PEKE 4QOHA 1W88B 3ABQB 1QCCA 1UDXA 3ZGLA 1NZDA 3RJ5A 4EGCB 2AZXA 3MGCA 4W9NC 1E5VA 1HH2P 2OBFA 2RGWA 3I9JA 3WFIA 4MEBA 4BZXA 1U2DA 1BH2A 2GPNA 1CZRA 3LT4A 4QT0A 4P0PB 5JVDB 4MIEA 4BMOB 1PVVA 3KKNA 1YJAA 3WZMA 4TPKA 3HRHA 1EP3B 1KORA 3HCEA 4RHCA 3TQFA 2EP5A 3U80A 1INLA 2AZTA 2RIPA 3IAUA 3PWZA 3UJPA 1D0VA 1GJRA 2RGUA 2AS0A 4RFLA 4BP3A 2O2XA 2LRHA 4ESOA 2XYVA 4PNEA 1JF8A 1FMJA 4FE7A 5ESWA 2I5PO 4QU8A 3BMOB 5FLEX 5IC4A 4A0FA 3GUVA 1ZCBA 1E58A 5D85A 5AI9A 1P81A 4FKBA 3LCCA 5CYFA 3T34A 3E9DA 5I9SA 1NAIA 2CV1A 2HW8A 1IN5A 3R7AA 1WO8A 3CT6A 3EVNA 3AESA 2JC3A 2PX3A 3NBUA 1Q15A 2VCYA 1K1EA 1O6CA 2FSIA 2QXTA 5HRUA 4ZJYA 3OQMA 3ZZNA 2AOTA 1SQGA 4I46A 5DNWA 4B82A 1LQUA 3STWA 2R1VA 1E9VA 4R6WA 3GVHA 4UNNA 4KO8A 5BSMA 2BH1X 1R5NA 4HAOA 4URYR 5IXSA 3EEFA 3FW1A 4NBLA 4CUKA 1LY1A 1DIHA 1AUQA 1Z62A 1Z63A 1ZQ9A 2EZUA 2WD9A 2XBLA 1G60A 1GLGA 2O5RA 4RDXA 4MP6A 1KKLA 3B5JA 4GBGA 3F9CA 2CD7A 3AMVA 1AO0A 3R3HA 2YV3A 1SMKA 1M0TA 2HHHB 1OILA 4LJ9A 4YCDA 4KPYA 3K30A 4MW4A 1I1NA 3BWEA 1SCQA 1JALA 1E7WA 5JCPA 3W0LB 2XCQA 2X14A 4DZZA 2HJRA 5DYYA 2R7KA 1WHTA 2B1RA 2XE8A 4U02A 4XWOA 2Y0CA 3UT5B 4LZNA 3RSZA 4ZREA 3IKLA 4ESHA 3O3MB 3PUYA 1P0QA 5DBHX 1BCRA 2CKMA 3ETOA 3UHFA 3DCNA 3PITA 3WLKX 3M9XA 4GVPA 4O59O 1DQNA 3IR5A 5DI9A 4E14A 4JCOA 1AT1A 3TRFA 2ZR0A 4BVJA 4ER5A 1OVMA 2BISA 4AURA 4TWRA 1YB1A 2E18A 4DCTA 3L2OB 5TF4A 3N54B 4B3XA 4DR1C 2VRWA 2ZJ8A 1ZM7A 3AP1A 5IN4A 1IUKA 1QO0D 1V60A 1QZ3A 2X8JB 2ZT8A 2ZJ5A 2NU8A 1KNQA 4DV2C 4IJQA 3JATB 5FA6A 4KTVE 3ZNQA 3FBWA 3QJYA 2HV9A 1SNYA 3K0CA 1UWLA 1V1MA 3L7NA 3E7WA 2OM6A 3MRVA 2J7PD 4RTKA 2OBLA 4IIJA 4JLUA 2QKYA 3L0IB 4LZLA 4X95A 3NUZA 4XIJA 4JGBA 5E7JA 3JVUA 3DMHA 2L82A 1UMDA 2DE0X 4MVYA 3ZWYA 2JHAA 1QP0A 1VKNA 1I94B 2QTLA 4GM4A 3LGXA 4N0DA 3UCXA 2X6QA 4CM4B 3NORA 1X6VA 2NIPA 1HQKA 3VOBA 4CDGA 2EG5A 1MRNA 1EGVB 1R6UA 3S27A 2UYHA 4N40A 5KVAA 1EUDB 3NYRA 5C34B 4J0IA 3EIHA 4ABTA 2IXAA 4RJLA 1QHHA 3J80D 1Y82A 1OX5A 4G8BA 4HTAA 4OL0A 4Q6WA 3JRWA 3KM0A 4MPPA 4O8CA 2IS6A 2WFZA 8ADHA 3RRJA 3RVLA 2OFPA 3ZLTA 4DREA 1ZBQA 1Z2PX 1S8FA 2PQMA 2R60A 2R7NA 4GPD1 2MHCA 4C4YA 1F48A 2QBYB 3H11A 5FWAA 4EJSA 1GGFA 2YN4A 2CFSA 3RTGA 1P5ZB 3H86A 1XMQC 1WUYA 3LP5A 3SY8A 4C5BA 3GA7A 4MHTA 3GGJA 1VA5A 3D4PA 3O8NA 3ZVLA 1QVAA 3HKCA 4AM8A 4F46A 1KDRA 2G83A 4TZTA 4RKYA 3DMYA 4B32A 1M5TA 2G04A 3H4VA 3SYTA 2I55A 4ZT3A 4FC6A 5F77A 4EKDA 2YWGA 3ZW9A 4C6SA 3W7BA 3AR8A 1ZMOA 5ITZA 3Q6IA 4MI1A 4AZ3A 1E9CA 3UT6A 2H7VA 1H9AA 1ZPDA 2ZTLA 4RIFA 3SLKA 3T7DA 1UKBA 5CGZA 1GQ2A 3CUSA 4NZYA 1YDWA 2FQXA 4NABA 3PIRA 4XXHA 4C7OB 1FYDA 5TPZD 1BQ3A 2HK9A 1YUNA 1Y5RA 3O4GA 4MCIA 5D51S 5DHQA 2IY9A 3CO0S 5LQNA 4XWGA 4BC9A 1JJIA 4GXQA 2VJMB 3VHRA 1X70A 5I01A 1QH0A 1KYVA 2WAYA 2FZEA 4LAFA 1JEAA 2GNOA 5CM8B 2XYQA 4JBXA 2Y1LA 2NNWB 5F98A 2ZCVA 2PJUA 1OZHA 4V0SA 3WKCA 4E2XA 5HQTA 1VPEA 1ZAYA 1DG3A 1QM4A 1HSZA 4KOAA 4P86A 1G2QA 3VR4A 5D01A 1YS4A 3MMNA 4HN2A 4Z5XA 1V0JA 5T5QA 5CAEA 4OSPA 3PNPA 3IUQA 1OYYA 3H4MA 5TF0A 1G8SA 4CIAA 4CNQA 5U9CA 5F64A 4MRNA 1XCLA 1EH5A 2I76A 2AK2A 2FB9A 2M98A 4B0PA 5LQMA 3DFUA 3IRVA 4KJZA 4AJ9A 1N36B 4PW0A 2YV5A 1FTSA 4H1HA 4PX9A 3RS0A 5JDIA 3I6IA 3N2KA 3VC2A 1J0AA 1DHRA 2WG2A 5AESA 3I12A 5TEWA 3E5RA 1LI5A 1LLFA 4H7JA 2Q5QA 4M9ZA 4CV3A 4TN5A 2H08A 4R2IA 3CVUA 1G5TA 3B9BA 1LTKA 3M6UA 2XCUA 1Y1RA 2AWNA 1EUYA 4AROA 1E3SA 3MT0A 1XVLA 2VQ3A 3P4UA 2ECKA 3GLRA 5AVSA 4YHBA 5KTPA 1XKQA 2HU7A 3AG5A 3P4XA 3LWZA 5AVJA 3HQ4O 5AKIA 4R16A 2HDHA 2PLFA 3B2EA 4KO1S 4Q3AA 5FLXD 4D8UA 2V3CC 3HPQA 1QGUB 3S7TA 4WZAE 4KR3A 3SNHA 3K9FC 5JMWA 2Z83A 1W87A 1UXIA 5TY0A 2E8CA 1WW2A 1KEKA 1PR4A 5G0UA 3EZLA 1ML3A 1JHRA 4WZAA 1FRVA 1U4OA 4U7GA 3OUZA 3N28A 4P4SA 4PSDA 5AO9A 1TF7A 3EG9B 2H3HA 4Q3EA 3UMCA 4BBAA 1YT5A 4DQLA 5C1OA 4OX9Y 1AUOA 1SXJE 1XIVA 4LQCA 1E1RD 2VRCD 1V1RA 2JIPA 4LVNA 4ZRDA 1XYVA 2JJ1A 4YQYA 5EUMA 1X92A 5SV2A 1JR2A 2Z8YM 3W2HA 3OCYA 1XU4A 2Y9MB 5AE2A 4XDHA 4EUNA 1K9SA 4DDTA 1PR5A 2I3ZA 1N2XA 4PLPA 4IDDA 2GZ1A 3BQ9A 4ZZ2A 2AQHA 4DCOA 2BGRA 1TO1E 1A8QA 2EFDB 5A5EA 2HA0A 4L0QA 4R1OA 2HPAA 1S3SA 2BT4A 2IYXA 2YZ2A 3O2QB 2A9VA 5A1GA 1E6LA 1N8NA 1T3SA 2JEZA 3V4LA 3VNRA 1OUMA 3I1JA 4C3OB 4P4LA 1CBUA 3JX9A 1Z0AA 4HXFB 1LVUA 4PC3A 2WJ6A 4OHCA 1N7JA 1X1EA 2B2XA 3SOZA 5KX5B 4N6GA 5TEVA 2UXBC 1WJGA 3KV1A 4M76B 4XOIA 3RVDA 2ECOA 521PA 3IOMA 2GZMA 3PNOA 3EVTA 1FUUA 2C8JA 1CUFA 2O1WA 3WYCA 3ZHYA 4C0JA 1M76A 1XZPA 1F0KA 1U04A 4L73A 4W6ZA 4WFKA 2HDNB 4JJIA 4HJRA 1RTTA 4O4IF 2R62A 4JY7A 4QX6A 2Z9BA 3WFJA 2XMDA 4JLSA 3ZWAA 1WV1A 5EE3A 4YT2A 1NLFA 3CWCA 1XAJA 2PS9A 3MOIA 3W4IA 1KI1A 3KJNA 3I30X 4FUQA 2FEAA 4HNRA 4JBLA 4P33A 4CCWA 3Q1LA 5B1YA 1KF0A 1MX5A 5JXHA 3OQNA 5JYEA 4D5EA 2PX4A 3EH2A 4PZDA 5DYIA 4H7PA 2G4VA 3FCUB 3IDFA 1T5SA 1ZX1A 3HKBA 3IEIA 4S1PA 4EJSB 4C14A 4JI2B 3T7AA 1V71A 4Z86A 4MWOA 3V4PB 1Q1QA 2IZOA 1AD2A 4BNKA 1VJDA 1JLMA 2TYSB 1O54A 3ABRB 4LXYA 1DINA 2FEOA 1ECBA 3WBFA 2H2AA 1GG8A 2ENUA 1MVLA 1VLAA 2XNCA 2Z2IA 1X8LA 2Q0HA 3RFUA 1P1JA 5LC1A 2QG4A 1VMAA 2QZ4A 2II6A 3FUUA 1ZAKA 1J49A 1JQAA 1NN1A 3H9QA 4M7PA 5LZ4A 1Z18A 3GG2A 4Q9LA 2EWVA 2GRJA 4EHKA 4L5AA 3LQFA 3W90A 1QU2A 2QQEA 3VPDA 1MGPA 3GY0A 3PPWA 1P9NA 1YRQA 5C8YA 4KHPC 5BMOA 1ZH0A 3EDCA 1WPXA 2VJMA 1Y1TA 1NVGA 1YCFA 2R66A 3AW8A 4HFRA 4MJ7A 4X85A 1E2BA 2ZANA 1WVIA 1ZLXA 1FE8A 2WKPA 2OPBA 5FD8A 3UTCA 4KPFC 2PPLA 3N39C 4UUNA 1PZNA 4AZ0B 4EARA 2X0FA 2EKBA 1GL6A 1W46A 1GZ5A 5DWVA 3KELA 3M4ZA 4DV6C 1LVHA 1NM5A 1KAHA 1LPOA 1UXKA 1VGQA 3IOEA 3GGDA 3QPAA 4LRSB 4MICA 2CVZA 5JG7A 3A4IA 4O2AB 3WXMA 2NUAA 2BFCA 3FMGA 1PEAA 3L07A 1GZUA 1IFXA 2XPCA 3ONNA 2FSUA 5B2EA 4J4TA 3MTAA 3FHTA 4DF3A 3JATA 2FDXA 1K6MA 2ZVPX 1EXNA 5E0KB 4X66B 3BD9A 4NFSA 2WSLA 4KTTE 2CNWD 5JJCA 4D8VA 2Q46A 4LF6B 3IUNA 3SJUA 5JLJA 5JCZA 3P9YA 5AXDA 1YCDA 4RLFA 2FUNB 3M6AA 1VE3A 5CDHA 2EC5A 1C7JA 5EIFA 4EBFA 1VE7A 3BKXA 3MT8A 2XMPA 4HAUA 1E3EA 1E2DA 4JB0A 5EINA 1WKVA 3R7NA 3HXOA 3ZXSA 1QRTA 2PRYA 1GPUA 5BMVB 1SR8A 1GV0A 3WY9A 5CFRA 3DW3X 2KW5A 4PZYA 5DBGA 1OC4A 1VI6A 3ZGNA 4B8ZA 5FLXA 2VPPA 1W96A 1Y3HA 1XZGA 4OHMA 4UASA 3SQMA 3SC3A 2XA2A 1Y34E 2VC2B 1UJNA 4R1PA 3GLTA 1WF3A 3NVKI 4PLFA 2XDWA 2XOXA 3TGWA 3TW8B 1C8BA 3CH5A 3EVGA 1P2FA 1IWBB 3I5AA 3KUDA 4WESA 3IAEA 1MAAA 3OQPA 5EJ5A 1N4DA 4ZU6X 4D6YA 5B3LA 1W2WB 3QHAA 5K8UA 5L3SB 4N76A 1PFQA 1J8VA 3EN0A 3GGGA 5IZ4A 4KYUA 5BN3B 4F2GA 4DNXA 1ONNA 4LF5B 4JXXA 3K6SA 3FTDA 3UAOA 1ZYUA 1HOXA 1XJCA 2ATIA 2CY0A 2V6IA 3QXCA 2CLCX 4J43A 4OXYA 3FPGA 3SVTA 5HG0A 4CQMB 2M5OA 1QH9A 4HWPA 4PTLA 3QFTA 2GXAA 3FAKA 2XTAA 1A96A 2RK3A 1N9GA 4M46A 1PFGA 4UNPA 1HDOA 1XDGA 3A1FA 3HJFA 1EWRA 3H2GA 1R0WA 4LWOA 2O8NA 4ZEOA 4DEVA 1B4DA 4BV9A 3GLIA 3M81A 2SICE 4FUTA 3ORYA 2RKBA 1NBMA 1C1XA 1Z16A 1Y3BE 3I2JA 3KKQA 1QGED 2PZEA 1HDXA 3MWEA 3GDFA 4EY7A 3C8UA 1W7AA 5CA1F 3Q5GA 2LP4Y 2D5IA 1Y1PA 2VWPA 2QSJA 4W63A 2C03A 4OKIA 5P21A 2FZKA 4FBLA 3NC0C 1Y8QB 1UEIA 4BASA 1VJ1A 5MN6A 2MOKA 4S12A 1S2IA 2H0AA 4BLWA 5CA0B 3IXQA 1RWOA 3DT9A 3UB4A 5KTKA 4PQEA 4DGQA 4Q4HB 1Q0UA 2NOAA 2HD4A 4IYJA 4LTDA 3DDWA 2O7VA 4MNTA 3MMXA 1MVNA 1RWVA 2SKDA 1BEZA 1ORHA 4FI3C 4E32A 1JVNA 1PJZA 2BHSA 4NBRA 1NSTA 1TJPB 1C9NA 2PYZA 4C0SA 2HSGA 5LD2B 1R15A 1U9ZA 4MA5A 3PJEA 5JS2A 3B53X 5A71A 4WDQA 3ZDDA 3QVLA 5EQJB 1VHJA 3H11B 5MFZA 1V95A 3C6XA 2QHXA 1XB2A 1K7XB 3HH8A 3CU5A 4ZT2A 3AVTA 3U4MA 3RV3A 2H52A 1W35A 3K9GA 1EZZA 1E1MA 2EATA 4LYDA 3HUUA 3BF8A 4ZAGA 5FPHA 1VP9A 5B7QA 1Z8DA 1GLVA 2YWHA 3HVKA 3OURA 4XAQA 3E81A 4AQYC 1JHXA 3NBKA 4YQEA 5EJFA 3BL5A 1PQPA 2ZSEA 1OSNA 3G3EA 3W1WA 5KNCA 2PD3A 4URXR 1JV2B 1IK6A 1A9OA 1KR2A 4JQYA 2WM2A 3CUKA 2FW7A 2NZWA 4CV1A 2XX3A 4D56A 2AFVA 1CDDA 2GM3A 5AUNB 4MS4B 5F2KA 1BWQA 3GJ7A 4M3NA 4UJ3A 5D7NA 3F8WA 4M37A 5E3JA 3TB6A 2VYFA 2WVJA 2D0PB 2CCGA 4K3VA 1ZWKA 3HFGA 4MMZB 1L7NA 2WTNA 3NONA 3VTAA 3WISA 1UPFA 2GX6A 3E3AA 1ZVVA 2FE4A 2C3PA 3ZDEA 2I9KA 2BEUB 2RGCA 3EQ2A 4JT4A 3K0FA 1V4NA 3B51X 1GAXA 1GRVA 2AUNA 3PNQA 2E8FA 1ZCJA 4Y6LA 3U3MA 5FAKA 1TO6A 1E0JA 1OCEA 1SXHA 2YYSA 3OLCX 3LX4A 2PZLA 2QMQA 4L3OA 4OQEA 4PQYA 2A0UA 1A2OA 1OLSA 1JMKC 4I5DA 3TFOA 3FMOB 1T5HX 1LJUA 2ZUFA 1H2YA 4X3OA 1W4LA 4MTNA 3I9LA 3KAQA 3G0OA 1DT3A 2RGGA 3M4YA 1XXHB 4FDAA 3SS8A 3AJEA 2MMAB 4QJ3A 2PRZA 4A27A 1QRSA 1RYZA 1OREA 1WU8A 1H4SA 2Q9CA 1VDMA 3VHLB 3RBXA 4UOEA 1ZH6A 4S3MA 3OA2A 3ED1A 3JQCA 4JIGA 4OHVA 2VBGA 1VBKA 2W6JD 3DH0A 1QIGA 4DR5C 2PUVA 3NV9A 2ID9A 2OECA 1JFFB 2Y93A 5AUPB 3EGWA 4L6AA 3OZDA 4BPBA 2VJCA 3BXEA 5BW5A 2GXQA 3KHUA 3JQGA 3TSOA 2AXPA 1JI0A 2R5NA 2YVUA 1P1IA 4I1UA 2VDLB 1Z4IA 1P39A 1KHTA 2PUWA 4HWSA 4JGGA 3HZRA 4NL4H 4YUWA 5TIIA 2XDAA 4CT4B 4LY9A 4QTUB 2QPTA 2ZZKA 1UK7A 5DLDA 5DNYB 5HTOA 1XZCA 1HNXB 1TYAE 3ROKA 3RV2A 1G5FA 3MRTA 1NMSA 1IQUA 2FPPA 2ALJA 1CQIA 3HADA 1XEFA 1D1TA 3C5HA 1R0YA 2ZRBA 3NHBA 5FLYA 5KYXB 1T2NA 4LE1A 4P22A 5EGSA 3SQWA 1YK1A 1N8SA 3P0FA 5TV2A 1Z75A 2B2CA 4Q4LA 5FUXA 3W78A 2DERA 4D26A 3JAWB 1PK8A 3WAGA 5TNXA 4JLNA 8ATCA 2G7MC 5JFTA 1NX6A 3Q88A 1ICIA 4BQPA 4JLAA 1IHDA 1BS2A 1Y6QA 2UZ0A 4P83A 2F9LA 1SEVA 4OI1A 1PV4A 3KOZA 4RIHA 1NR5A 1LPAB 2QIPA 4RJIA 4YAWA 3SHTA 3WRYC 2JLYA 3EMDA 4ZCIA 2GCIA 3BMNB 4AZVA 1RJ9A 2POQX 4C7MA 1KMHB 2PUDA 1O0BA 1T2FA 1UC4B 3UG7A 4AP5A 2IIBA 5HM8A 1SOMA 2IWRA 1RQGA 2DBZA 2IYPA 3CSUA 3U9LA 2O2JA 3TEMA 4C30A 1MU0A 3H3JA 3RVJA 2VYQA 4D9MA 3LX5A 5LZ9A 1L5YA 2Z04A 2H4JA 2NO1A 3JU3A 4HDKA 2BGGA 4MWBA 3C3MA 3D5EA 1NF2A 3K16A 4NCJA 2NQTA 4IIGA 1ISGA 2BRUA 2Y0EA 1DAGA 3H1TA 5DO9A 4LF4B 4R2XA 4P38A 1STOA 2C84A 2XKBA 4ARBA 3LY5A 4KNYA 2ZGVA 3OFND 1AQ6A 1Y1QA 5BOSA 2D2VA 2LPMA 3AJDA 3VTFA 4LXGA 5B12A 1VLVA 4EA9A 4TWIA 1X8XA 4NONA 3QBVA 1EIZA 1KI3A 3Q72A 4MVJD 4EM6A 1DKQA 1NJ2A 1R6TA 1XA3A 2ODTX 3RUPA 1SM4A 2GKGA 4ZOLF 5I6DA 1A5TA 1E3WB 4CNBA 1TNDA 1U7WA 3WMXA 1T6ZA 1L3BA 3A0RB 1MA0A 1M0EA 2LDXA 1D1PA 2O8BA 3Q2KA 4D4GA 3TOZA 2VSOA 1DIRA 2ZDQA 3BRCA 3GLVA 3ZU6A 4ATNA 4GUDA 2Y8EA 3EMVA 4RU1A 3LDGA 4F3RA 1A4IA 4O4JA 2JFFA 2FLVA 2QVBA 1II8B 4OMDA 3C4JA 4OJMX 4UTOA 1CY6A 1U2EA 3EZYA 3NJRA 4KB5A 5EPUA 2V98A 4IYRA 5KU1A 5HS4A 1YQ9A 2ASBA 4E5KA 4ZMSA 4K8RB 4QU9A 1M5RA 5KVSA 3CIOA 1KZYC 1FSPA 4MUBA 3EF3A 1AG9A 4WCFC 2QRLA 4JI1C 4OHFA 2IHNA 2O3RA 2B8WA 2WYOA 2VZ9A 4LXTA 4MUEA 4I4IA 2W6QA 5A02A 3ENKA 3UH0A 1GCAA 3KZCA 4Q12A 3T5BA 2HPHA 4Q1AA 3VZQA 3QBDA 1KQ3A 4FC7A 1O95C 5HS6A 4QFBA 2QPOA 2JZOA 4MR8B 2WF9A 3SIRA 4A03A 3U4IA 3NALA 2JJ1D 4G25A 4K9MA 4A0HA 2X7JA 3IKTA 4A6PA 3GHYA 1OHHD 2JATA 1XDZA 3PHJA 5CAEB 2ZAGA 3JQ8B 4EEXA 2ZG6A 4BPRA 4P2BA 3URMA 5KQPA 3W7VA 2H51A 1TTPB 3CX3A 1J8DA 1EQAA 3ND6A 3IVAA 2MR5A 4JQSA 1H69A 2X0NA 2WJIA 3FSGD 3L8MA 3X1DA 2JAPA 5JXIA 1MOZA 2VPQA 5BYBA 3KT6A 2DHQA 2GZDA 5EGNA 2PWYA 2X9GA 3I5YA 1ZGHA 2DWOA 5A2QA 1TI7A 3ZI4A 2DUWA 4JB8A 1Z5OA 2GLTA 3RS5A 1IHOA 3RWMB 2WJJA 2FPSA 1I3NA 4CT0A 9MHTA 4U2CA 3USCS 6REQA 5AD1A 3F49S 1HH4A 3J7TA 3DP9A 2YHUA 5AMXA 3KQVA 3TBHA 2O14A 5FOQA 4HDOB 5C81A 4G5SA 5H9WA 2CYBA 4AZTA 1ADFA 4WADA 1Z26A 2YNMC 3KYBA 4LCEA 5G40A 4A8HA 4LE2A 1BVHA 2Z8YA 3WL7A 1XTQA 4KQ2A 1JFRA 4QATA 2HAEA 2ZYVX 5AQ1A 2QTMA 3ZBQA 1X39A 1JPNA 2VSFA 1WCIA 3I04A 1FFWA 3VYRB 4FB4A 3EBPA 3V6LA 4CM9A 1R8XA 4PSAA 3V46A 2H1RA 2YXLA 1K27A 3I6ZA 1S2OA 3KJIA 3M1AA 3O84A 4YJFA 3TDMA 3QKUA 2QLNA 3O2SB 1LFAA 4HDMA 1JG2A 5BVHA 2HFKA 4TSFD 1H1DA 3IXLA 3MLBA 4Q5IA 1GZVA 2WIGA 4TS1A 1M8GA 1DNPA 4B6OA 1QYIA 3G2MA 4G37A 1J42A 1S3IA 4C4ZA 4RSGA 3OQBA 5KQSA 4ZJZA 2JFGA 2BI8A 3BBPA 3X3HA 1QO9A 1KZ4A 2B92A 3WK8A 1K75A 1Q7RA 1K8YB 3STTA 3LMKA 1BDJA 1CY0A 4ND3A 3TLMA 3FPEA 3JYQA 1F60A 1HFEL 3QZUA 1SBNE 2X42A 5ETJA 3VPXA 1A4UA 1XD9A 2ZUUA 3RVMA 3PC8A 1GR1A 2OV1A 1VLQA 3BJIC 3MAJA 1F06A 2CHGA 2JI6A 3F8TA 4WH0A 3MBIA 3JVVA 3NOQA 1XS3A 4BVFA 4J0QA 3N5CA 3M3HA 4PHCA 1JIQA 1AB6A 4KDEA 3ZK7A 2PGDA 2JJ2A 4GXNA 1S0UA 1CF2O 1L5GB 4MWTA 3RVOA 5GV7A 5A9RA 1U0SY 2Y0DA 4L22A 3ZWVA 4S04A 1NKSA 3RV4A 5DFAA 2CMKA 5GM1A 1QK3A 2OG1A 1I1QB 3PHCA 3PPVA 2C5BA 5ESXA 1HZZA 5BWOA 5AW8A 2KLHA 5HFNA 1AGYA 2IIQA 3F7MA 1NVUQ 3DAGA 4TXJA 5E4FA 2RJNA 3IHKA 1F3OA 4NBNA 4EZBA 1VXOA 2H1OA 4X20B 3E7XA 1BX0A 2C3OA 3DBLA 1M6NA 1TVKB 2OV3A 1KEVA 3JZFA 1CYDA 2Z58A 5CXUA 1D07A 1HNWB 3PCRB 5DMXA 5JPDA 1P2GA 2QX8A 5E2BA 1AE1A 1I7PA 5IW8A 4A2WA 5K6AC 1PLLA 2NSHA 3NTRA 4WZBB 4XX2A 5J5AA 5JUWA 3SYKA 3RI3A 3FETA 1JEQA 4OREX 2TSYB 3W5AA 2PRKA 1EFPA 1HI9A 3Q15C 3VUEA 1FFHA 2PIAA 2Z6VA 1JX6A 1IMOA 2H1IA 3NZEA 3VR0A 3PNYA 3D2AA 4UHEA 4ACAA 4M0CA 2HUNA 1WBJB 2RONA 3QOYA 4L2IA 3ZHBA 1M5UA 3ZWKA 4WA7A 4CLXA 2X76A 1N36C 2WLTA 5JD5A 2WU8A 4O5OA 3QNWA 1M83A 3BMCB 4ANFA 3S44A 5T57A 3IVRA 3MGGA 4ROTA 3RLFA 3TRIA 5KYYB 1DIAA 2I9PA 2YQZA 1GEGA 4HV4A 3LNTA 1T1JA 5DU2A 1YTUA 3MTEA 2CT8A 1J7KA 4MKHA 1CEYA 3DLIA 1QV9A 3GVCA 1LK0A 4MRPA 3UK7A 1G8MA 2VDJA 4X1YB 4KIGA 1EJ6A 2BMDA 2JAHA 3THXB 5AUOB 3PD7A 1FMFA 4LJ6A 4YFVA 4EF4A 3TW6A 1QU3A 2EKZA 3IT1A 2JI7A 4HXEB 3ITNA 4NDZA 4PNHA 4RF5A 3ZE2B 4AWXA 4V0QA 3SXUA 3EE6A 3HU3A 3OJCA 4MUHA 3WGNA 1UANA 4JP2A 4FFNA 3Q5EA 2LDBA 2NUAB 4ZDWA 4EGJA 1MOPA 1BFKA 1Y89A 1EZ1A 2NVUA 3FUCA 4CQMA 4COKA 5BSRA 5EC8A 7REQB 2EAUA 2WJGA 2KYRA 4HUJA 1OF1A 2PAAA 2DWCA 2O3JA 1DARA 5CR9A 2PYIA 4ZT7A 1ZJ6A 2PZMA 2VTVA 3DOUA 2VJLA 2QYOA 2G5TA 5FOUA 2G67A 4RZQA 2WU0A 2GSDA 2Q3CA 3EF1A 1FBTA 2GVZC 4WV3A 1O8CA 2WM9B 4GMDA 1CUYA 3WBJA 1N34B 3GVXA 1XKXA 2J45A 2ZT6A 4P7KA 4ZHQA 4GGOA 1TO2E 3LL7A 4EKGA 1ORTA 3BRQA 4PLZA 4JVNA 1QHNA 4LYFA 3PI6A 3A0UA 2VNHA 3LUGA 2OORA 5J2TF 4ZDKA 3BMQA 4BQRA 4GZLA 2QM8A 1U1DA 3KQQA 4KOEC 1NTRA 3V42A 1MFZA 3FI9A 2VFAA 4RFSA 4NBKA 1E99A 4H1WA 2EBFX 5LOVB 2L69A 4PCVA 3FDXA 1A5SB 1G66A 3TZLA 5AVRA 3GLSA 3AX6A 4HPVA 2EOAA 3MEQA 1CSEE 1QK4A 3BYZA 4N5NA 1C5KA 1FX0B 2H1CA 4E46A 4GBJA 2R11A 4QODA 3DV2A 4ZT6A 5BN3A 2PS3A 5CBKA 4DR7B 3OFJA 2UXBB 4S35A 5FQOA 2BMAA 1V6AA 1YSCA 2JPDA 1IXZA 1NWCA 4JJEA 1GXSB 3AV3A 4WT7A 4YRKA 4W9MC 3H04A 2BEWA 2RARA 2OCBA 4RPLA 1SU7A 2O8BB 3TDNA 2Z8ZA 4GIBA 1LSUA 3FPSA 4M8KA 3NT4A 5L51A 2N42A 4KXMA 4TXHA 3ANYB 2ZWMA 2F00A 1NVTA 4JC8A 5CW1A 3WB2A 1G8JA 1R4MA 1A69A 3JRNA 1PR2A 2P2ZA 3MMPA 1H85A 3G9XA 3W4KA 1A2KC 1SZJG 3MPUA 3IEUA 4RS4A 1D5WA 3L7DA 3HY6A 4L51A 5AM0A 4W5TA 1BCSA 3K5HA 4OB7A 5F76A 5GY7A 3WL8A 1XKTA 3H8VA 3I37X 1KP2A 1EWVA 3KVRA 2NUTB 3UHPA 4BNUA 3RB8A 4ER6A 4HQKA 2M5HA 4X8MA 3TQRA 1RHMA 3JQ9C 1JAXA 1M1UA 5C31A 2J5BA 3F47A 3TUZC 3OTOC 4MW9A 4PAQA 2WP0A 1XMOB 2CXUA 1E2HA 4Y98A 1JSCA 3JD1A 4MCAA 4MRMB 4RNCA 3CWZA 1EFKA 2OB2A 3MCAA 3C1OA 2PCJA 4JYCA 2ZM5A 2AEEA 5FL3A 3GFRA 5I45A 4LW8A 3FPFA 3T5GA 1HR0C 1Q17A 4EY3A 3ELBA 4DDWA 3CZ9A 1F4PA 4TWZA 4H7KA 1C4KA 3OKPA 3T4XA 5DK6A 1QQBA 1B8VA 4HFNA 1XQYA 3O75A 3RSQA 2ZU0C 4MQ5A 5A0FA 2RE8A 2EZTA 5COBA 4WVLA 1JHVA 4JUAA 2OBXA 2TS1A 4FD2A 4AX8A 2B3TA 3OP4A 4YK7A 5JCJA 4DDHA 2YFQA 3GBVA 2FG6C 3IX7A 4RTLA 1D2GA 2ZS9A 1GNVA 2GPYA 2HBZA 4AF8A 2AN1A 1HSOA 1N2SA 2PHZA 4K0KB 4DMCA 4NCHA 4PHGA 3T0GA 3BDAA 3ASUA 1O9GA 3COYA 1VI2A 4B3HA 5AVUA 1D2HA 4G0YA 3M70A 3ASYA 3T3HA 3VR6D 2GLUA 4FFWA 2CL0X 2P8JA 4GRDA 5L7YA 1R5BA 4AIRA 4BB0A 1HBJA 3K72B 4EYOA 3RYHB 2FWJA 3WGZA 4JXZA 3EG5A 3GFVA 1GO2A 5FNVA 5TSDA 2OAEA 4TKZA 2P9JA 2BSAA 1DKRA 2DRIA 2QT9A 5CHYA 3CF4G 5IUKC 3MAAC 4D2IA 5EKDA 3LVRE 4Y6RA 3W1EA 3ZGZA 2RK6A 3PR2B 3V2HA 1WXQA 2Y1DA 3LDHA 4FMPA 4MR8A 5KWSA 1M8KA 1RLUA 4UREA 1LWNA 1PWZA 2QP3A 2YOHA 3GNTA 4MINA 2IVZA 1KAMA 3V34A 4Y2PA 4BQNA 1W85A 1TADA 3H2YA 4ZI3A 4ZEWA 4KPUA 1EVLA 3R5TA 1NUAA 1E2QA 4XDGA 3LE8A 3VYTB 2BFFB 3BJMA 3ESXA 1BSVA 1U4NA 2GXSA 4R68A 1W4CA 4E13A 1Y7PA 2B2NA 3WNBA 3FMVA 2VAMA 5G53C 1RFGE 2GESA 2A67A 2ZRGA 3DQPA 4G0PA 1CZKA 3Q9SA 5FL7A 4IXDA 1NTOA 2H5IA 1S6YA 2IF2A 1A2BA 4M0FA 3QXHA 4UE3S 4YDQA 4D8TA 1PG4A 3FAZA 4INZA 3FUTA 1CG6A 3SEZA 3TX6A 2WHQA 1X1QA 3VAAA 3ZQJA 1PQUA 3FBGA 1ESZA 3YASA 2B94A 1J5PA 1JHOA 3LRPA 4HX2A 4HZIA 4EUKA 1NI4A 3N05A 1IEQA 2D1RA 2AXEA 2DH5A 1LBTA 5ALOA 3I39X 2O7NA 3OLQA 3WADA 1CUWA 2W6PA 4FDMA 4PPYA 5AWFC 4B3IA 4EKEA 4YV0A 2ZJ2A 3WK6A 5K3OA 1YFJA 5CZXA 4ZPJA 4Z8XA 3LC1O 5BUCA 1WNFA 3O8QA 1FJ2A 5EHZA 1ULHA 4JS0A 4JBGA 3ZD9A 3CZAA 1DBPA 3GFFA 4YJDA 3SC2B 4CKEB 2VT3A 1CDEA 2GCOA 3K7EA 1Y9ZA 2WYHA 1I3CA 1WOMA 3TIXB 3I4CA 4CRWB 2WIKA 2XD9A 5BW4A 2R751 3Q11A 2Q5EA 3HDGA 4L1KA 2AFIB 5FPQA 4BZPA 2NACA 3LXXA 4ONEA 5IG2A 1PTJA 2N47A 5D87A 4GW3A 3I9NA 4ZCLA 5HRAA 4DIBA 4X5OA 3LJKA 2FZLA 1J24A 1EM6A 2NUPB 3Q41A 4OPMA 1PG3A 4IUCS 2HK6A 4D6PA 5I7VA 4NR0A 3B20A 3SFVA 5L45A 2XUDA 3ZE8A 1GAEO 1XV5A 2Q3MA 4RBNA 4N3CA 4BVAA 2AH5A 4Q4AB 3SQOA 2XBMA 2MSLA 3O0TA 4UVHA 4WIAA 3HB9A 4KG7A 5E8RA 5LP6C 3WE7A 3SYRA 5I4CA 1E8NA 3TDKA 1OR8A 5EMNA 3FGZA 2GN8A 1XMXA 1AJEA 4F6LA 3WJAA 3ZEAA 3AZOA 3WRVA 3CVXA 4DB4A 1I7DA 1CFJA 2GASA 1J1UA 1V7QA 3EVAA 1M1YB 1OGIA 1AHHA 3H2JA 4O4IA 4XUEA 3CLHA 2JCVA 5CT9A 2X9NA 1UZLA 3EW7A 2RG7A 1UWDA 3TM5A 1RQ7A 3THWA 2ORIA 1OE0A 2WT4A 5BYKA 2OVFA 5CG2A 1NP3A 2XUZA 4KKXB 4N7MA 2Q0SA 3DZGA 3P27A 1E18A 3HJRA 3P0IA 4NZ9A 1VG9B 1ST3A 1T6XA 2M9MA 3C1UA 3F97A 4O2AA 3I5MA 3OF5A 5IMSA 1KRWA 1Q5PA 2R7LA 2EHJA 1FNDA 2IF0A 2WJAA 3ULKA 1I24A 2MSEB 3SSAA 1LU9A 4TLLB 5ECYA 2YUIA 3RU2A 4QFDA 4GKAA 5FOVA 3ZDZB 1F2DA 3G0GA 3GZJA 1UL1X 1ZVKA 4WBNA 2OBMA 2L42A 1Q7EA 3GFSA 4HH1A 1K89A 2AG5A 3CKKA 1YQGA 4I0WB 5GZ6A 3S28A 5BPFA 2G8NA 4RK7A 2GO1A 5KTYA 1IXRC 3CLSD 3GEIA 3HMKA 3MXTA 4E22A 5L40A 2W70A 2Y1KA 1GVHA 5ALZA 1RXWA 3DL7A 4MH4A 3PA6A 4Q18A 3KXLA 4W1QA 4DCUA 1NOJA 2JLAA 5JI3E 3ZV5A 1NVXQ 3HL4A 3DGEC 3IOYA 3GJYA 1U0BB 3SQLA 3I1IA 1OI7A 3D3WB 4Y2SA 2XUOA 1AC5A 1ZDMA 4DQ0A 1W2GA 2DOKA 2IUTA 2J4FA 3NP7A 2Q1TA 4HGYA 3UV6A 3CVYA 4HNHA 1ONPA 4M83A 1R16A 2O0KA 4GPBA 4PN3A 3QKIA 2ZI6A 1D5CA 1LRKA 1Z0UA 2V6BA 2AFRA 1OJLA 4GG1A 5ICFA 2ZRFA 1FL9A 3RYHA 1QPGA 3IQWA 3KVOA 4JXKA 2QX4A 1MT0A 4MS3A 1IATA 2QG6A 3TAXA 5EPOA 4L8YA 1Z35A 4RZ2A 5KHLB 3KFVA 4MS1B 1F17A 3SR4A 2QSYA 5HKAA 4PX5A 3B13B 3HVHA 1RWKA 2PDAA 2M2IA 3VUFA 1SVNA 1ZL2A 4LDAA 1DPFA 1Q91A 4EI8A 3HDQA 4EYQA 3VNQA 1M8JA 2QD5A 3A2MA 1RM5A 4FGKA 4NI5A 5AJXA 1VHLA 3AETA 6GPBA 1GKYA 3ROZA 2C9CA 4YPOA 1TUGA 1UFKA 1YKGA 4D98A 3LY9A 2QBYA 3CX6A 4W82A 2B6HA 1CB7A 4MA0A 3OPYB 4MAAA 4Q7JB 4UTXA 1KFCB 2GJAA 2M32A 2ZT7A 5CIQA 3VNUA 2I6XA 4HPJB 3DC7A 3PI7A 4TLBA 1V1RB 3HCNA 4I9FA 4HAZA 1R0BA 3FFTA 3ANTA 1C80A 1E1NA 2VWGA 3CLKA 4HQ6A 4O0LA 2PK3A 4AG3A 3PUWA 1DS6A 4EWLA 5EKTA 1AGXA 3H2SA 5M04A 4Y7CA 4D45A 2QRVA 4DLNA 5CXQA 1XA0A 1T25A 3S4YA 1JT9A 2WVAA 3DZBA 3OQIA 1QM5A 1M2EA 1B6TA 3O0DA 3QKSB 2P2QA 1EK6A 1K8ZB 5F2EA 2Z2YA 4M88A 4EQZA 3I4LA 3CKMA 3RS7A 1O96A 3CO5A 3VVBA 1PG5A 1Y98A 1DOAA 3IQEA 5JRZA 2CNOA 4N49A 5FUWA 3BD7A 1U11A 4KKVA 1OYVA 3RK0A 4PSKA 3C8MA 3PJDA 2WTUA 4TT3D 2EWMA 4IDFA 3UWKA 4DL9A 4Z7JA 4TTSA 3MMZA 1CJMA 2XZOA 2HQSA 4QTZA 2QUKA 3T7RA 1GVNB 2A2ZA 1XNQB 3OZIA 5J63A 5I9LA 1Q7BA 3H75A 4ASUA 3HXKA 5C5DA 4B3BA 2EJVA 4HAIA 1BRMA 3UMFA 1R0KA 4CUJA 2DUMA 5BXQC 3OZEA 1MO5A 1X8JA 2CLOB 4BMPB 2MMGA 4NPAA 1JILA 1O92A 1VSQA 4YTEA 3TKLA 2B35A 2IIVA 2J9RA 1WEKA 1SPBS 3NMUF 2D7CA 2ZJ4A 3Q2OA 2DPXA 3KS9A 4EVRA 2B78A 5TGDA 2ZTHA 3EZ9A 3ETCA 4LG1A 2OZLA 1OX6A 4IZOA 5IJXA 2WG0A 2XGSA 3PHHA 2WAOA 2WHRA 2ZJ1A 3FTNA 5KX5F 1RHQA 3JS5A 4F3TA 1RHRA 4CODB 5LZ8A 3NVAA 2OO4A 3TOVA 1H5NA 3HJBA 3P2IA 3V1LA 5HF9A 3TIVA 4B1FA 2HO4A 3LDFA 1WTAA 1UM9A 1UJMA 2WNIA 3R0ZA 5CRIA 1KJJA 4X71A 1H2WA 4FLEA 5HEKA 3LWDA 4TVSA 2P30A 1HM5A 1BHQ1 1GSOA 4HRVA 1G1AA 2SBTA 3WQRA 2Q9UA 2D2IA 1ESEA 2ETXA 4K9LA 4HSGA 5AI8A 4RVCA 4JKYA 4P92A 4UCXA 1YBFA 1YQDA 4X1IB 1PR6A 4KN9S 1RXYA 1W59A 3HKDA 3OHSX 1H4TA 2EX4A 4ECEA 3UKOA 3BCSA 4ZO6A 2XUPA 5DGXA 5EPEA 4ZAZA 1SVSA 3I76A 2PV0A 2J3IA 3P7MA 4OATA 4OQZA 3MINB 3L9XA 3PUZA 1IN4A 4G8JA 4G0WA 4LZOA 1BHJA 1DAPA 2BFFA 5E2IA 3U13A 4Q05A 2IP4A 3TZBA 1B15A 2CC2A 4N7BA 3VR4D 4JENA 2QR5A 3P2JA 5IUNC 4X44A 1RKUA 1SC6A 2QN1A 1H93A 3H42B 5T64A 4BE7B 4UU8A 2WV7A 5K4HA 1EXVA 4MQBA 3W8DA 1I2AA 2QRPA 5F4ZA 3RE1A 2HNAA 2W2OA 4H08A 2IODA 4ARIA 3TQQA 1TT7A 3BBLA 3U1VA 1IG3A 4EF6A 4JJ8A 2CL7X 2AEJA 2PM8A 1ZI8A 2E55A 3V1MA 2Q6LA 4M1EA 2H92A 4X1KB 3WVNA 1ECJA 4BAGA 4MPJA 1AURA 4PXYA 4YMWA 1V43A 4ZQIA 5FI3A 2AMFA 4D3FA 2H18A 4TN1A 4U6QA 2YFYA 3F67A 4DXHA 3E5MA 4YRRA 3OLWA 4AN0A 1IXKA 3PLRA 4DJDC 1AKYA 2P5YA 1WQ3A 3IAXA 4JYZA 3DEZA 3E7DA 5FCDA 1L5ZA 2WC1A 4UAGA 3TECE 4RPJA 2R8RA 1NNEA 2AFIA 1SUFA 2IIPA 1LBIA 1UP4A 2NV6A 4HLUC 4DPKA 2H8KA 3NRBA 3OIDA 1J25A 1Z22A 4DT1A 2FKNA 1JBEA 3C85A 4G36A 1F2VA 1TX4B 1H23A 5K7SA 3OQVA 1QHHB 4J2OA 2O57A 1QZUA 5LJLA 3OJLA 3WDSA 3BD8A 3WR5A 1M1YE 3W79A 3ZZUA 1UJ4A 3VU3A 2CXOA 5ALTA 2FEKA 4X1YA 1W93A 1KMHA 1MJ5A 1SKBA 3IALA 5ITWA 2C4WA 5KTNA 1KO8A 3RO7A 3U31A 1QIFA 1WX1A 5E1MA 1FYXA 4RTOA 2XLBA 1JDBB 2I29A 4ZYZA 2ATWA 3OJOA 2SECE 2NW6A 5DYWA 1JWAB 5BP7A 1F5SA 2MSCB 3PLAE 4HAXA 2HHLA 3RU7A 1HETA 1T9GS 3GPDG 4BEVA 3O38A 1SUEA 3GFOA 3FB4A 2H57A 2NZYA 4XEHA 4F7DA 1HNWC 1VJGA 2M6SA 3MTJA 3QWAA 5CLGA 3WHLA 1Y1KE 4PG8A 3CUYA 3Q8MA 3WRXC 5I3CA 4S1WA 3SJ7A 1TYZA 2Q3FA 1N2ZA 2PX6A 2XWQA 5BW6B 1P4JA 2PGOA 1UFQA 2GCNA 2UZ1A 2YDXA 3MF4A 4IHQA 4MJLA 2FE1A 5FBHA 3CRVA 2FNAA 4RANA 4KE8A 3NQ41 3ROTA 4EPXA 3E1GA 3U4CA 4YCSA 4LFCB 1JHPA 3FZEA 3I4FA 2ZETA 1R74A 3E05A 4LWZA 1QQAA 4H59A 4CLDA 2HCBA 4OQYA 8LDHA 2YVLA 5DSTA 2XRMA 3TPZA 4HC4A 1T2AA 1D4ZA 3JR7A 5COAA 3ANLA 1MG0A 4EB6A 3U7IA 3BILA 3G0BA 3PDIB 3KT3A 4UE6A 1LLCA 3PWKA 5LMNC 1SVIA 2PANA 5GV8A 4MRMA 3O4FA 4EKNB 5F4BA 1DKNA 1TQ6A 4DG5A 3PPYA 2WYVA 3I01M 4P7FA 1E3LA 3VPFA 1DAFA 4RHEA 3U3KA 2AN9A 2PXAA 3B6ZA 1IOLA 1JHZA 1GPYA 3AI7A 3UJCA 1ISRA 3LX6A 4EPTA 3L49A 4TYQA 2F1RA 3GT4A 2TMKA 2AT1A 5IVHA 3SKVA 5CG1A 4POAA 3C0KA 3JWJA 1WBDA 4QUEA 1KR5A 4L72A 4M53A 4MWZA 3KJFA 5EEHA 1DIGA 2I8AA 5MHTA 3AEUB 1I80A 3D6VA 3N1UA 1CHDA 1VRWA 2HA4A 4HGRA 3NUQA 1WKBA 1RCTE 2YZKA 3CXRA 3NXKA 1J2RA 4G3XA 4HH4A 5DM0A 2DBYA 3BG5A 4TTIA 2OHXA 3QV1A 2OMEA 5ITVA 1KU0A 3NHWA 3W5HA 2AHOA 3RRXA 5IBQA 2G7ZA 4W7IA 3ES9A 3WX0A 4DV4B 2GXUA 2EX0A 1JJAA 1ZN2A 4TV8A 2W0MA 1TF2A 4UTNA 3FTFA 4C03A 2GZRA 1FOEB 1FBNA 3UIEA 4B34A 4FHGA 1MZVA 1NLMA 1YH3A 1HFJA 3G2QA 4FZVA 1ATZA 1Z37A 1H8ED 1WLYA 4B4OA 4G5GA 1D2RA 5EQDA 2VQ6A 3ESBA 2YBDA 1KPGA 3LOPA 4X92A 1AGNA 4ENTA 3ZDRA 2V6MA 3N9IA 3VKFA 2XOKA 3B70A 1EUCA 1NW9B 1IZ9A 3DE7X 2AE1A 3EODA 2RKOA 2NCLA 4A26A 2XSZA 4B3MB 1RDFA 4KNWA 2Q6VA 2GWHA 3UBMA 4B3TB 1XTTA 4EHDA 3JZDA 2YC2C 2PSFA 1NX9A 5E6RB 4D0SA 1Y6GA 4MWCA 1A7AA 4C0WA 1P6UA 1Z6YA 3R4CA 1RRFA 2WJVA 3OY7A 3ZKAA 4RLSA 1TKBA 3EEQA 2ATVA 1G21A 1RWNA 3QYFA 4UUAA 1XU9A 2VT7A 1E2NA 3GBPA 3HBFA 5ANRB 4BLUA 4AUNA 3F73A 3A9TA 5CFMA 4QO8A 2FW8A 3B78A 2PKWA 3F5FA 4E21A 2ZROA 4BTVA 2RI1A 2IKQA 2RK4A 1JZSA 3HU1A 1U1IA 5E7IA 4C7JA 4YMGA 3GLGA 1OHHA 3EIOA 1UJ6A 3MYYA 5DNDA 821PA 4WAUA 3AM5A 2J6IA 2C07A 2GF9A 3LUCA 3TW8A 1EXMA 1WIWA 3VR5H 1A8IA 1KVQA 3R6LA 1SA0A 3W8NA 1MDFA 4F5EA 1P2SA 2Y6VA 1A04A 2QAIA 3FYDA 3UW3A 3JAMD 3HUFA 4RHYA 3D8TA 3IDQA 4HJXA 4UBLA 2OXTA 4EB0A 3STXA 4ZTZB 1P9RA 3EA4A 3AKDA 1P1RA 4EPYA 3CR7A 1LF5A 1UJBA 4LS3A 5KYWB 3EXHB 1U0HC 1G8GA 2PZGA 2WYWA 3ADOA 1NVMB 2HOQA 2IUYA 3B1KA 4Q9NA 1GFIA 1KBQA 2HLHA 4DIUA 1NVAA 4FOLA 2VBIA 1KY2A 2PKQO 3GPIA 5HCNA 3RBZA 3SNKA 5F12A 5ULLA 1KWKA 1BS1A 1ZMRA 5JVDF 1KEUA 1XRSB 4G1MB 2GEJA 4OU4A 2ONFA 1XQ6A 3FDJA 4JI3B 4OXRA 1XDWA 2QVXX 2FLWA 3ELDA 1VLJA 1IYZA 1VP3A 1YJXA 2PKEA 3LC0A 1QJCA 4I6GA 4RYDA 4BLOA 1DBSA 4CG2A 3KR0A 3AF5A 4YRIA 1CJUC 2JCSA 5LUBA 4E08A 5F9FA 1H5QA 4RIIA 1YZYA 4WN9B 3P97A 3KT8A 4YFYA 3SHFA 4W7HA 1YB2A 1CUIA 2ZI9A 1Y9EA 2BWJA 5T4BA 1XRMA