4DCVA

Crystal structure of b. subtilis enga in complex with gmppcp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
434
structure length
402
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 130
structure length 402
sequence length 434
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcvA01
2ZQ5A 2B6HA 2QM7A 2ZE7A 2Q9BA 5KDDA 3T1QA 5EXXA 4JBWA 5JECA 3EIQA 5FH9A 4RD4A 1OFUX 4LBWA 2J0UB 4G01B 2F1HA 4L16A 3M0EA 4IFEA 4RZXA 2FG5A 2ZXUA 3C16C 3VHXA 2EQBA 3HDTA 4PC1A 4H9GA 1V43A 1XD2B 1KNQA 1XMJA 2A5GA 2IYWA 2CHQA 2FZLA 1VPLA 2QAGB 2YINC 1H8EA 2HT6A 1GNRA 2O8FA 5AJZA 1DG3A 1U9IA 4NZYA 4DDTA 5EP2A 2EFCB 4GZLA 3F3YA 1UKKA 1PUJA 1TX4B 1M8PA 2D7DA 3BC1A 3AKYA 4IDOA 4DUZC 4R2IA 1E1RA 1XXHB 3DEFA 1Z0FA 2GNOA 3B13B 2ORVA 1CR1A 3LXXA 3LFUA 2QSZA 4ZI2A 3U7HB 1E0AA 2IYLD 3MWJA 1KSFX 1TUEA 3K53A 4HATA 2NG1A 2XNDD 1TQ2A 1CR2A 1T5IA 1XPRA 3X1ZA 4W9MC 5HR5A 1X1RA 4JZKA 1R4AA 3A6PC 2J3EA 2W83A 4BZPA 3NBYC 1VIAA 1ZNZA 4MRRA 5HE9A 3ONWA 1ZD8A 1Z8FA 4KJZA 5JEEA 2F6RA 3T1VA 2IUTA 4Q4HB 3V9PA 5JSZA 1XPUA 2LCFA 2BJVA 2ZANA 2IX3A 2XJ4A 1AZSC 2R6AA 4H1UA 4NBSA 1S8FA 2ZRBA 2HXYA 4X66C 3UIEA 1W36D 1RE0A 2BMJA 4DLWA 1BIFA 3BS4A 3HPRA 4PHGA 2FGJA 2OE2A 5EQTA 3R7WB 1P9NA 1HQYE 4DUGD 4Q4JA 2ZEJA 4C0LA 1JQJC 3QVUA 2IW3A 1CP2A 1JXMA 1BYUA 1G7TA 5EUMA 1NL3A 2KWIA 2QBYB 4JJKA 4MYTA 2GJ9A 4IDNA 4US1R 4MYHA 3JVVA 4EAQA 2AL7A 4DEXA 5SZIA 5JI2E 3TUIC 1KO7A 1QG4A 1YZQA 3PV0A 3QKUA 3CF0A 4JL5A 4JLDA 1NVUQ 1N5LA 2IBMA 2A5FA 2Z5FA 3AF4A 1E4YA 3LDAA 1N25A 3HYTA 4IXNA 3I4LA 3QIAA 4R2HA 3B9PA 3RYTC 1USPB 2F1IA 2ZROA 1S96A 1T4GA 4LBZA 3VU9B 4JKYA 4TL8A 2C9YA 5FPSA 3Q5EA 1F2UA 4MGYR 4OHZA 2WJVA 4JLJA 3RRZA 1ZUIA 2GILA 4N0DA 1E0SA 2ZR7A 2BCJQ 721PA 4URXR 5KDLA 3GPLA 4FCTA 2ZRCA 2ATXA 5FOWA 1UDWA 4URYR 4HLDA 4RVCA 1JR3D 3HU3A 1KSJA 1O87A 2ZVQX 4Q66C 1N6NA 3CR8A 3FMFA 4F4JA 2C5LA 1NJFA 2NMVA 2PZFA 4XH9B 5D3QA 4URUR 2FFAA 3QUSA 1OB2A 5AJVB 3SEAA 4AG5A 3LAWA 4DIDA 2AFHE 1W48A 1X3SA 1H65A 3E70C 1P4SA 4NYJR 4TTRA 3RDPA 5JZVA 5FBWB 1KZ7B 2BJOA 1II8B 2QGNA 3CM0A 4ERNA 2FSIA 2I3BA 3NWJA 4NE2A 1XTQA 2ZJ5A 2AN9A 1DE0A 1XMVA 2DWQA 3V4RA 1E1QA 4LV8B 1ZYUA 4KFTA 1KO1A 2WV9A 3QXJA 4HYYA 1JEEA 2YWHA 4NH0A 1MT0A 1BO6A 2GXUA 2WMOB 1COWD 3SJZA 4U5XA 5FBLB 5AWFC 1QHSA 2XEXA 2QTVB 3REFA 1MR3F 1XNRC 2JMPA 2YV5A 1LFDB 2VQEC 4HB0A 3TAHA 4O2RA 4ACBA 2J0SA 2IT1A 4PQFA 3NVAA 4HAVA 5TMPA 1XD8A 1VCNA 4IVQA 4F38A 4DCTA 1IXSB 3QXCA 4M1TA 2R6CA 3TLXA 1OKKD 3FFAA 3SOPA 2QNRA 4NYIR 5DI9A 2QZ4A 3CX8A 1N6KA 3LUSA 1N33C 1JB1A 2ASEA 4DT1B 1YR7A 2QE7A 4LHXA 1W4RA 2VHTA 4Q02A 3WMGA 1DARA 2QEQA 3AH8A 3MMPA 2CLSA 1XNJA 3GLFB 1Z83A 2A3RA 2RMKA 1ML8A 5EP3A 1GKIA 3ZD7A 4A1FA 2JCSA 5D3MA 4MYUA 2IYSA 2OFXA 3AKEA 3RAPR 4B73A 1NG9A 3AGPA 2RGDA 3O47A 4BRWA 2OAP1 1DTSA 3SS8A 1Z2CA 3AF6A 2F9MA 2P6NA 3LXRA 1G4AE 2FE4A 3K0EA 2WAYA 2ZSBA 1G41A 1E9DA 1JPNA 1VDZA 1X1SA 1FP7A 4LYHA 1WMSA 2VTKA 3QG1A 5A0FA 2GVZC 1I4DD 4EDHA 5SZKB 1G18A 1G8HA 3DMNA 4HUTA 1GRQA 2GEDA 5DNYB 4JV5C 2ZJZA 2CCJA 3SBDA 4LZZA 5HKKA 2VQSA 2W6JA 2O8FB 5JRJA 4R71A 3ZLJA 1FFHA 2ZRNA 1GDDA 4EIWA 1ZM2A 2X1VA 3B7GA 2OCAA 3U2QA 2IUUA 3HWSA 2WMNB 4LI0A 4MITA 5CM8B 2P3SA 4DV7C 1W2HA 1OIWA 2QG6A 2HYIC 2HJGA 5P21A 4W7SA 4MH4A 2H7VA 3A1UA 5FR1A 2PT5A 3THOA 1FUUA 1ZW6A 5IRCD 2FH5B 1Z08A 1S0UA 1ESNA 4OHXA 4V0OA 4ASUD 2XTZA 3FMOB 3WBKA 4WIAA 1QHIA 3SFVA 1VECA 3IPXA 3VNUA 3KXIA 3LH5A 2PN2A 3FYHA 4FMDB 4JI7C 1AKYA 1COWA 2ZR0A 4KFUA 621PA 4II7A 4TQAA 5ANRB 2H18A 2X77A 3OAAD 5JSZB 1GSIA 1OHHA 3KJEA 1DAEA 1MO5A 2RGGA 4UJ5A 4DLRA 4Q1AA 4NHOA 4RJLA 1ONBA 4C3ZA 3U6BA 4LPSA 4BLOA 2ZR9A 1CIPA 4EPWA 3QI2A 2VSOA 5CJ2A 1OKKA 2WPDD 4C30A 3RS3A 4F7WA 4DWJA 4ZDKA 5J4LA 2ASBA 1JI0A 1G20E 1MOZA 1GKUB 1KDOA 2DWOA 2OZEA 2QQEA 2J41A 4BEJA 1ETUA 4QJ5A 4AYWA 3PEWA 4Q4JB 2JIZD 3KKMA 1E9SA 2Q3FA 3DZ8A 3ADCA 3LQQA 4MQBA 3D6TB 1L4YA 3CPJB 5IF9A 3T1YC 1PUIA 4BFUA 4QOSA 1FX0A 4TT3D 4UQOA 2QA5A 4TLDA 2DYJA 4HB3A 3SQWA 2EFEB 1P60A 4UNPA 3J81D 4NXMC 2QPAA 2WWFA 4A8JA 4QBHA 4YMTA 5TDHA 4QJ4A 1NVVR 4V03A 1YQTA 1MO4A 1AM4D 1GL9B 3GLIE 1TTTA 4XSGA 4MUAA 4ITRC 1NY5A 1G8GA 1TU3A 2WOJA 3B1ZA 1JAIA 3RRNA 2PT7A 1LY1A 1JJ7A 2ODWA 1F2UB 4GOXA 2ZRHA 1F2TA 3PUXA 4BRUA 1CS4C 4TMKA 2C03A 2BC9A 4WOPA 3H2YA 2XOKD 1UDXA 2ZYTX 3VFDA 1R0YA 1E2PA 2OLKA 5CM9C 2QM8A 2OAQ1 1NI3A 3VAAA 1UPTA 1JXOA 4M1OA 4QNMA 3ZIAA 5E4FA 4X65C 1HH4A 1NBME 3AB3A 4V0MA 1H8HA 2XAUA 4M0LA 4TSFA 2CK3A 3BXZA 1RVDA 3T1OA 4JKIA 3OFND 5JRZA 4TLEA 1UKZA 4M21A 1P75A 1UBGA 2YKGA 2QENA 1NYEA 1II9A 4DHEA 4S35A 4QJ3A 4GKKC 1UEJA 5AR1A 3VKGA 2V55B 4EQ6A 1KO5A 2CY1A 4R9UC 4A4DA 2NPFA 2R65A 1S1MA 1Z0JA 1PLKA 2HF9A 4B2IA 1KI1A 3CZPA 3MAAC 2DFTA 3C8UA 3QNUA 1AS3A 3B78A 1CJTC 4UNSA 5KTYA 4MKHA 2YOGA 4KVGA 2Y8EA 3LVRE 1ZRHA 3B1YA 3GJXC 2A5YB 3FB4A 2ZM5A 4IDHA 1VG8A 1QHGA 2D7CA 2C77A 2C9OA 3TMKA 2CMKA 2IC5A 2JIZA 4L9WA 2DFLA 1UFQA 3ADDA 3M6AA 2R62A 3SI7A 1KYIA 4K46A 2JLXA 3AEZA 2B92A 2A5JA 1UKYA 3WHLA 5TY0A 4HB4A 3NHAA 4Q21A 4MUBA 3KKPA 2EU8A 3CF6R 3T34A 3ZVNA 1DPFA 5D3MB 4Z8XA 5J40A 1N3BA 2BIFA 1XDBA 3LW7A 3Q8XB 1G8YA 1Z6XA 3B8HA 2RGXA 2GBLC 5L8VA 3ZVLA 4PZZA 1NN3A 3QQ5A 4U02A 2VSXA 2ZI3A 3LX8A 2HDNB 3DHWC 3MFYA 4DSNA 3VR2A 1SVOA 2W2TA 4BFYA 4QG7A 2YVUA 4BASA 4JT2A 3P26A 4PAQA 3RSLA 5JFGA 1FQKA 2GVDC 3TUZC 2YC2C 3QBTA 1N0WA 3T61A 1GILA 4ZKDA 1EG7A 2G1KA 2IS4A 4M1MA 1BMFD 5IK2A 4BFZA 3DOFA 4E07A 3R8CA 2WJIA 4Q1DA 1XU4A 2YYZA 2QPTA 4DDWA 2CLDX 2P5TB 4TYYA 2QQ0A 2REBA 1ZJ6A 5BR8C 3VX4A 1NIPA 2LWIA 4BSZA 4IVRA 4LDJA 2ANCA 4B76A 4RD0A 5IT5A 3ZD6A 3KQLA 5GJWC 4KSCA 1SVWA 1U98A 3PQCA 2C04A 4IXMA 3W90A 4C0HA 2O8BA 1IN5A 1ODFA 2H17A 1LF0A 1JBKA 2HLDA 2B21A 3ND8A 4TTQA 3DMDA 3B1VA 4GI7A 1GRRA 2VHJA 1KOFA 4JBYA 3U5ZB 3HR7A 1W0JD 1JOSA 1RYFA 3WRYC 3KQKA 1ZNXA 1G7SA 3EWAA 1B0UA 2CXXA 1SXJE 2G1JA 4D81A 5EP4A 2OG2A 4Q1BA 2IYQA 3DVLA 1G3MA 2E8EA 3IIJA 1JNYA 2P65A 3CBQA 3H1TA 5IT9D 2REXB 4OI1A 1YJ5A 1EFRD 2GCOA 1Q57A 2VHCA 1J5EC 2GZHA 3C15C 2YOFA 2GJAA 4TQ9A 1UKVY 2JA1A 5KU1A 3O8CA 3AGQA 4PSAA 3BFKA 4LHYA 2GAAA 2A30A 2ZUCA 3OE7A 1IXRC 3NTUA 2XTMA 5L3QA 1C4OA 2EYUA 2GZDA 1VYUA 1XEXA 2IYYA 3KKNA 1Q1BA 3L8YA 4I1VA 3TQFA 3U3KA 2O8DB 2FFBA 1G3QA 3RHFA 3U3MA 4JS0A 2OLJA 3KQNA 4X8MA 5JJLA 2BMFA 1GOTA 5HZKA 1FX0B 1NSTA 2ODBA 221PA 3HR8A 2O8CA 5E7IA 3S1AA 1HURA 1BS1A 4GFDA 3CX6A 1HNZC 3GCGA 3DOEA 4A8JB 4LV5B 4PPNA 2H16A 3JZMA 1M2OB 3HPQA 1GKYA 3MWLA 1XTSA 5G3YA 1W36C 2BJWA 3EW9A 3PCRB 2J7PD 2OUKA 3NEYA 4QHTA 3R8FA 2R6GA 2ZI4A 4G3XA 4KITB 5BXQC 4GBMA 4X8LA 2NGRA 1XMIA 1NBMD 3QXHA 2BBOA 4OK3A 4LGMA 2O52A 2J0QA 1F2TB 1Q21A 1K6MA 2G77B 2QPOA 4A82A 1VG0B 3QPWA 5LBIA 1KY3A 4WZAE 2WZQA 4TMVA 1XJQA 4NDZA 1QZXA 4XSHA 2W2VA 4PFSA 5AJWA 3U3RA 3K70C 1N6LA 3FFBA 2QT0A 4B3BA 4IVPA 1M34E 3IIMA 3THWA 2ZI5A 4QM6A 2PX3A 2HYDA 1DAIA 1K5DA 4M9ZA 1G6OA 3MJRA 1D6JA 1W7AA 3G0HA 5FR2A 4D0NA 2XB4A 2XZLA 3G5UA 4TWZA 2VP6A 1SGWA 1K5GA 3HJNA 2NO0A 1T8TA 1OH6A 2VPPA 4WZBE 4TN1A 1RRGA 3U6KA 3L82B 2EFDB 1SZPA 3CWQA 1NLZA 3ZVMA 4RCYA 4M22A 3I3SR 2BV3A 3EASA 5J5CA 1ZU5A 3ZJYA 3MSXA 5JCPA 4ESVA 4YC7A 3W8RA 4EQ6B 1DAHA 1Z0KA 2YHSA 1OPXA 4PQRA 1I2DA 1UBFA 2ATVA 4RZUA 2JLSA 4YXWD 2AKAB 4BE7B 2YWGA 2VEDA 1EFRA 3T35A 1J7KA 1HH2P 5CIWA 3X1YA 1KY2A 4EJSC 1RW4A 1AA9A 1R5NA 1T0HB 2QAJA 4HAXA 2XZOA 1QWIA 1OV4A 3C7KA 3JVUA 3CKLA 4P3YA 1P5ZB 1RZ3A 1Z5ZA 2WICA 3VTKA 2KBFA 4KFRA 3GKUA 2ZU6A 1NKTA 3H86A 1RFLA 1XMOC 2P5SA 4I1SA 3UMSA 3CPHA 2YZ2A 1NP6A 3RS2A 1J2JA 1KJZA 2Z4SA 4ILEA 2JDIA 5FTKA 3O8RA 5BN5A 5KSZA 1OYWA 2C98A 1ELOA 3WMFA 1CXZA 1T91A 4X64C 1E2LA 2ZS8A 5FUVA 2CNWA 2ZI6A 1LW7A 3L0PA 5EE9A 1G9XA 3C41J 3EC1A 1OIVA 4FW9A 1QVAA 2VA8A 2KE5A 1US8A 2ZS9A 3LQRA 4O2LA 2PZGA 3CRW1 3OIUA 5FOSA 2IXEA 5TXGA 3EPHA 3GJ7A 3VR6A 4F91B 2ERYA 5EE1A 4D80A 1PLLA 2J7KA 3U44A 2V3CC 2Q3HA 4UJ3A 1ZUNB 4LHVA 4OQLA 2W6IA 3FKQA 1NNEA 2NIPA 4DC9A 3X1DA 3MJHA 3RRMA 1OYYA 1OXTA 3CNLA 4AKIA 3PUWA 2CVHA 3RNLA 2PCLA 1P2VA 3Q85A 3MLEA 1SXJD 4OL0A 1TAGA 1VMAA 4QNRA 3THXA 2QP3A 1OH8A 4Q1CA 2O8BB 3GJ6A 1NG1A 2MSDB 3AKDA 5B30A 1R0ZA 2ZITA 4L4UA 1XF9A 3QG5A 2F1JA 4HAUA 3C4JA 2QL6A 1TEVA 5J4HA 3T1TA 3R20A 4DLUA 4P4TA 3UMFA 5CB6A 4MRPA 2L0XA 2H92A 4JLPA 1IJFA 4G1UC 1N6IA 4OYHA 1IN8A 3H0KA 1XZPA 2DHRA 1XBTA 4V0NA 3VHLB 1RRCA 1TUIA 1ZM9A 1CJKC 1YR9A 3FHOA 3GJ0A 4U00A 3KXLA 4XWKA 2ZTSA 3QEOA 2LKDA 5GJVC 2NO6A 3GEEA 3N70A 2GCOB 3GLGE 1E9CA 1P9WA 5EXPA 5FUYA 3L2OB 4TMXA 2IHYA 4JL8A 3GFTA 4YMWA 1HA3A 4F92B 2D2EA 2WWHA 5CITA 2QTFA 1P72A 2WHXA 3WYGA 1N0VC 1SQ5A 5KO2A 1K8RA 2O5VA 4CEHA 4MRSA 1E2GA 4HSEA 3BH0A 5L3QB 4I99A 3VMFA 1Z29A 2F9LA 1QBKC 1XEXB 2F3RA 2V7QA 1IN4A 3EIEA 3IO3A 4GPTA 1IY0A 4GT1A 4UXJA 1ZAKA 2YWFA 4XD7A 3CLVA 1S9DA 2AHOA 3KJGA 2JLYA 2FFHA 4OI4A 1LV7A 1VG1A 2QROA 5L3RA 1WF3A 2O8CB 1OH7A 1WA5A 2GTPA 2BKUA 3IKJA 3S1AB 4DSUA 1R0XA 2GJSA 5CLQA 2Q9CA 2IA5A 2ZAOA 1CJVC 4F4CA 4RD3A 1L2TA 4P32A 3QKSA 1M7HA 4LFCC 2AFIE 5LDDC 1ZBDA 1C9KA 1HE1C 1MRSA 4HZUA 2FV8A 2VP4A 1JECA 2W0MA 4B3MC 3HYRA 1CBUA 2WKQA 1AS2A 3BE4A 4CGZA 3FDIA 2DCUA 2C8VA 5E7MA 2OFOA 2VO1A 4TL7A 5FL7D 4KODA 3WNCA 1XCMA 3ECCA 4OHYA 2H5EA 5KNDA 3K9HA 1AN0A 1UAAA 2WJGA 4M1KA 1E98A 4FN5A 2XITA 1XMQC 1GG2A 4HB2A 2ZJYA 4D4LA 4Z1MA 4I81A 3R9IA 3THWB 3LRPA 3PUVA 2IYZA 3LBNA 1G5TA 4Z8YA 2KBEA 2NO7A 4AK9A 1PVOA 3PIRA 4WXRA 3PITA 1E2HA 3BGWA 4ON9A 4RZ2A 4KBGA 3AF2A 2V6JA 4TTPA 3KB2A 4IHQA 1U8ZA 2ZU0C 4KAXA 5KSPA 2CCGA 4JI3C 3A37A 1YZTA 3GJ3A 4D6PA 1GTVA 3K70D 2WSMA 2QUZA 3DO6A 5JHHB 4AD8A 5A5GA 4M8NE 4QBFA 5H1YA 3NBFA 1VG9B 1G17A 5FLXD 3UWKA 1CEEA 1AIPA 3W8NA 3CH4B 4YMSA 3X1XA 3NG1A 1AQUA 1N2FA 1XCPA 3EIHA 3EPJA 3PEYA 1GVNB 1W5SA 1DAMA 4NKRA 1WBBA 3BFXA 2ONJA 1KKLA 1P2TA 2F3TA 1F3OA 2V1XA 1U8YA 4XWOA 5KSYA 5G53C 2KB0A 2NZJA 2FEMA 2WIAA 3TRFA 1Q12A 2ZM6C 4A0FA 3FMPB 1T3LA 4NU0A 4GZMA 2C78A 1TQ4A 4CVNA 4Q9LA 4W5JA 4MA4A 1N6RA 1LF5A 4Q9KA 5CB8A 5CK5A 4CW7A 4PSKA 2BWJA 3EX7C 2JJ2D 4JLKA 3H4MA 3UG7A 2R2AA 3TK1A 3U7GA 1NVWQ 4CF7A 3IEUA 4HDOB 2I4IA 3LA6A 4UXIA 1CF4A 1BKDR 1W49A 3U3OA 2XNDA 5IHPA 1DADA 1DAFA 2ZRKA 3AV0B 3QBVA 1AK2A 3K0FA 4TQUS 3EA5A 3QPVA 4OX9C 2VP2A 4B32A 4DR2C 4IKEA 1ZC3A 3WMEA 1BOFA 1E2JA 4PPQA 3WHKA 3IHWA 1R0WA 4Q1EA 3P4XA 1US8B 2NQ2C 3OHMA 4LFBC 2W58A 1GL7A 4LV6A 1P73A 3QE0A 4LWZA 5JJKA 3FOZA 4PC6A 1WXQA 1YVDA 1T8UA 4BUJA 2ORIA 4MKFA 2J5XA 1FZQA 3U44B 3EPLA 4B3GA 1YU9A 2CXCA 1N6PA 2DYKA 5BW8A 1X8JA 4GDFA 2HF8A 2RGEA 3CZQA 4G5OA 2E5LC 4JLAA 4JLVA 3B1XA 3OIYA 4B3SC 2NZ8A 2WSSD 1IAQA 2KZFA 2GESA 4DUGA 4WVFA 5AUPB 2OO7A 4LUCA 5FFMA 1W5TA 3CRVA 1U8AA 2UUAC 2G83A 2FA9A 1FMLA 2BBWA 1Y3AA 4KXFB 2OBLA 1VHLA 3SYLA 4AWXA 3AVQA 2ZE6A 3GMTA 3THXB 2HUPA 2AD1A 5ELXA 4BLSA 2P67A 4OQMA 1E9RA 4CRWB 1F5NA 5A4JA 1S1CA 1KDRA 3DKVA 4URWR 3P4YA 4HEJA 1GP2A 4B48A 5KOYA 4B75A 4R7ZA 4D0GA 3P20A 2E9SA 4RKEA 1EFTA 4BFVA 4BZXA 2ZSEA 2OT3B 2HT1A 2ONKA 3K9GA 1E79D 1U0JA 4B3DA 1K0RA 5J4KA 5F9HA 2ZRMA 2G9NA 4CIDA 2ZRDA 2MSEB 2XSZD 4DLVA 2VBCA 1ZIOA 1IONA 3W6OA 2VHUA 2RHDA 1PZNA 3K09C 4DLZA 2O8DA 2GKSA 2X2EA 3K1JA 1M7GA 3NC0C 2JLWA 4ZCIA 3L0OA 2H8KA 5CDFE 4IW3B 1XMSA 1NN5A 3AVYA 1B23P 1JR3A 3Q3JB 1Q20A 2J9RA 2PEYA 4UNNA 2EYQA 1YR8A 1W0KD 4DV0C 1LB1B 2YJTD 4CEHB 2JLUA 4JIMA 4EJSA 2VIIA 2EGTA 1QHNA 1XXHE 2RGNC 4HAYA 4ACAA 1JJVA 1Z2AA 5GJBA 1KI6A 4OKSA 4YQFA 2JEOA 1CTQA 1S3SA 4JVMA 4O3MA 1IOZA 1G7RA 1SVLA 3MWKA 4YDSA 1WE2A 2VF8A 1IXZA 4M1WA 3NKVA 4POAA 4XVRA 2ZYUX 4ZCLA 2UKDA 4ESHA 6Q21A 2EVWX 4B74A 4EFNA 5H70A 1AZTA 1Q44A 2FNAA 1G8PA 2GJ8A 1C1YA 3GLHA 3QKSB 4L8GA 4KSBA 4Q48A 4RSGA 4UKDA 3W6PA 2IF2A 4FINA 2A9KA 3SBEA 4KLNA 4KFSA 4WXPA 4B44A 3HU2A 4DV6C 4HZUB 3UATA 4A0RA 2WAXA 1XNQC 3T1HC 4PXAA 5SZHB 1GZSA 4KYIB 1UADA 2FSFA 5EXTA 4QGAA 1GRNA 4LJ8A 3CH5A 2GXSA 3SDZA 4LF8C 2ZJBA 5JS8A 4W5WA 4ZDIA 2Q9AA 1MH1A 4LY6A 2RGBA 4D2IA 1OT3A 1EESA 1ZVQA 2B8TA 1GWNA 2CLCX 4D4JA 1GNPA 2VP5A 4TL9A 2PH1A 4K81B 3H84A 1S9HA 1KK1A 3K8YA 2V1UA 3OEED 4PSVA 2ZI7A 1G3IA 3UG6A 2WIBA 2XGJA 4GMXA 4LJYA 4RZ3A 4DKXA 3W3AA 2R6FA 2JJ8A 4ABYA 3A1TA 3M4YA 1VYVA 3CUEF 1R8QA 3ASYA 3NIBA 4X8OA 5DHFA 3CO5A 1XCGB 2Z0MA 4Q4LA 3EARA 4C0JA 2ZSFA 4JSTA 1Z3IX 2GCNA 3UANA 4TL6A 4DB4A 3TE6A 4D0LB 2WM9B 2ZUDA 3NC1C 1RRFA 5F98A 3A36A 1KZGB 1Z07A 2D06A 3AF0A 2ODNA 3FGNA 4MKIA 5HE8A 3ZS8A 1XEFA 4Q4AA 1HYQA 4EPTA 2ZI9A 4YDHB 1SVIA 4HLQB 2AWNA 3EG5A 3Q72A 1P62B 3SFZA 4QKQA 4US2R 1E69A 3C5HA 4LF4C 3QSYA 1Z28A 3SJBA 2ZIAA 3O8BA 2G6BA 1GL6A 5TVKA 3BK7A 2EWVA 4JBXA 4ASUA 3FKSD 3B85A 3K0FB 3BB4A 2RH5A 3NXSA 3AF5A 3ZQ6A 4CDGA 2O8EA 2A5DA 3VNVA 4V0KA 4NL4H 2MMCA 5DN6D 3IQWA 1G6HA 4LYFA 5KPJA 4FD2A 4P0TA 4L9SA 3K0CC 2W00A 4QRHA 5K8LA 1I2MA 3PEUA 4L5BA 1Q3HA 4B3TC 1KK2A 3KX2A 3OAAA 3GJ8A 4LSGA 3QF7A 1TQ6A 2CL6X 3CJEA 2A78A 3T06B 5K8TA 5GADl 2JLZA 1G291 2VYFA 2AX4A 4B47A 1QG2A 2AXNA 1W36B 2WPDA 3D3QA 1NMYA 2ORWA 2ZE5A 1HT2E 2QT1A 3U60B 4JI4C 1TF2A 3Q7PA 3W3ZB 1U2RA 2GETA 3E5HA 1E2IA 1R8SA 4YLGA 5FBQB 1U9IC 5BQ5A 4A92A 2PJRA 3AVTA 3MCAA 1EX7A 3D31A 3GLFE 1ZB9A 2D4HA 4TT3A 2F4VC 5GJCA 4JI2C 4C4PA 3A4MA 4RY2A 2JJ1D 4JYAC 3E2IA 4QL3A 5BN4A 1NMZA 2FZ4A 1ZCBA 3QPUA 3K70B 1A5TA 3IILA 3ICQB 1DELA 2BM1A 1YRBA 2Q6TA 4FWTA 4DV2C 1HNWC 3FHCB 4JMPA 4MGZR 3CONA 1U0LA 3I07A 5HTKA 2J1LA 4WW0A 5EZ6B 2VRWA 2GK7A 5L3SA 4D4KA 1KMHA 5B64A 2UXDC 4LBVA 1GM5A 4ZKEA 4D25A 1T3HA 3AUXA 4NPHA 2PLRA 2PMKA 3DM9B 1SXJC 4PZYA 1XD9A 2IL1A 3BB1A 3BRWD 2P6UA 1KDTA 1FNNA 2XOKA 2G3YA 5SZJA 3TBKA 3PXGA 3KKOA 1P7CA 5FTMA 4HI0E 4NP6A 4ZO4A 4C0SA 3QKTA 1G7CA 4MTNA 3LY5A 3AQ4A 2OILA 1ANKA 1ZIPA 3TR0A 1FQJA 2PLFA 1U81A 4EJSB 3KKQA 1E9EA 2AKYA 3TAUA 1HNXC 1DEKA 1KI6B 4XX2A 4DCUA 3OFNA 5C1BA 5AK0A 1HT1E 4PHFA 2YOHA 1WBDA 1MV5A 1Z47A 2BEJA 1LNZA 4YMUA 1G1MA 5KDOA 2CJWA 2WWWA 2V54A 1I94C 1E96A 1HQCA 821PA 3WYFA 1MRNA 2HV8A 5C2JB 3PUZA 1ZB8A 4I4LA 4S2EA 2O0KA 4MGIR 2HEIA 4BZQA 2FDCA 3GLHB 1RIFA 1SKYB 2O0HA 1YKSA 2QMOA 3CWZA 4F4IA 1G4UR 4OBEA 3A1VA 2DPXA 2OEPA 1CR4A 3A8TA 2IS1A 3CNOA 1LQLA 3QF4A 4P31A 4UNQA 2FPLA 1XTRA 3ND9A 1E3MA 3K9NA 8OHMA 3AVPA 2G88A 4LF7C 1WQ1R 2PEZA 4AY2A 4BEBA 2NO9A 1NVXQ 2DBYA 5EE0A 3TW8B 2ZAMA 4E22A 2D74A 2REOA 2TMKA 1I4LD 5DLQC 2UUCC 3AP1A 3NEJA 3T5DA 1NF3A 1P2SA 3GQBA 4LJ5A 1CRPA 2JJ1A 2WKPA 4N1AA 2OV2A 2CL0X 3HP1A 4DR6C 121PA 1CULC 1N32C 2J0VA 4PC3A 5DH9A 5DGXA 4LF5C 4CEIA 3NDBB 3TGPA 1E2KA 2BKEA 1FUKA 5LPNA 2NO1A 1OFIA 2ZSDA 4TMZA 1GUAA 1IBRA 1ZCAA 2ZPTX 4LF6C 4D26A 3EA0A 2IYVA 2KSQA 3KZ1E 4PR0A 2BOVA 1EWQA 1QRAA 2ZYWX 2WBLC 3MGCA 4PX9A 4DV5C 3OEHD 4DSOA 4PC2A 1F6BA 3RS7A 1BMFA 4JT4A 1EXMA 4LYAA 1I4TD 2GDJA 3V00A 2ZRPA 1IBKC 1A2KC 1DAGA 4NYMQ 4EUNA 5AJYA 4BFSA 2WVJA 5B2ZA 4DR1C 4Q4AB 5EE3A 1Z6GA 3RABA 3K09A 5HCIA 4C0KA 2EW1A 3I61A 2VQFC 4LC1A 4HZIA 4OQFA 1CLUA 3QXSA 1E94E 4G5QA 4B2LA 4PPGA 2ZRJA 1CR0A 1IQPA 5GVSA 1AKEA 3D8BA 2H57A 1HV8A 2NOAA 1SVKA 3RWMB 3I8XA 2F43A 4AQYC 1EX6A 4TLBA 4BLRA 1SKQA 3KFVA 3LBHA 1N6HA 2O8EB 1F48A 1W0JA 1XJCA 2Q3MA 1G3UA 2HCBA 2BVNA 2RGNA 1Z63A 4Q18A 4PZLA 4CZ2A 1Z0AA 1KAOA 4IDQA 2R44A 2QGZA 4BLQA 3U7EB 2X19A 5DYIA 1U94A 2FMXA 3LLMA 4GP7A 3W6NA 2BM0A 2IK8A 4ZI3A 1N5JA 1Q1EA 2AD5A 4JJZA 3LO5A 4DR7C 2HJVA 2PBRA 3RVBA 3T12A 3ZYCA 5KUTA 2GK6A 4ZDWA 1PA4A 4DSTA 4LJ7A 1KMQA 2WWIA 3LX5A 4KU4A 3ZS9A 4V02A 4JI6C 3CRRA 2FOLA 3CW2A 4DIEA 2DFNA 3TSOA 1AQYA 5LB2A 1D8TA 5EZ5A 4WA7A 1FMJA 4B2PA 3ETLA 4XWAA 4BLTA 3GLIA 1Z6YA 1LS6A 1KI2A 5JWRA 1QHHA 4LHZA 4WBSA 3IDQA 4LBYA 5DHAA 1TU4A 5BYKA 3DDCA 2R6DA 2G0NA 3B1WA 1GIAA 3RANA 5LMNC 2ZJ8A 1J99A 2ANBA 2Z83A 3TH5A 4BPBA 4MRVA 3UPUA 3ADKA 4ARZA 2UVQA 5JHGB 3B5JA 4HAWA 3T15A 1IY2A 2J7PA 5JWOA 4N0EA 5L3SB 2Z6VA 4GP6A 1KMHB 1NBMA 3PG5A 1T6NA 3TIFA 4KYUA 2GRJA 4AIIA 1W4BA 1P3JA 3AKCA 3F5FA 4LJ6A 2OFWA 1E1RD 2J87A 2FN4A 5CLLA 1DVRA 3PVSA 2F55A 1XTKA 1OJLA 4DXAA 4U7DA 3OTOC 4KBFA 2BMEA 3UXMA 3ZVRA 1AGPA 3P27A 2FJUA 5JBQA 1ZD9A 1EK0A 1X6VA 4DLSA 4OK6A 2QP4A 4XTCS 2ZRGA 2EWWA 4B34A 2WOOA 1HTWA 2IEZA 5FPYA 5FL3A 4DDUA 5DIFA 1N5IA 2JAQA 5JWHA 2KJQA 3QJYA 1UJ2A 5HZHA 3BJIC 3NBXX 1W44A 5IDVA 4TZ6A 4TZ0A 2ECKA 2CJWB 2EFGA 4I1UA 1D5CA 2H1LA 3P1JA 5HCNA 4F93B 4A0HA 1W4AA 3GLHE 3WNBA 4EFMA 1T0JB 1ZM4A 2IWRA 1VCOA 1OXVA 1Z6TA 1Z6AA 3ADBA 4YXWA 2UU9C 2ZETA 3KJHA 1SVSA 4M1YA 1JALA 3FHTA 4QGHA 3KDSE 1J70A 1Z22A 2VL7A 1G5RA 1OSNA 3K0CA 3QF4B 2PL3A 3N5CA 3ZGXA 1ZP6A 3F0TA 2RKOA 2N46A 2N1BA 2RAPA 5E95A 5EJEA 5CYOA 4GNKA 1HY3A 2C9CA 3U3JA 1IN6A 3AF1A 3SN6A 1VHTA 3I1FA 4D82A 3V4FA 2WKRA 2XB2A 4M9QA 1TQDA 1NSFA 4JVNA 1KTVA 4JYCA 1L8QA 1M74A 4EPVA 3LV8A 3EAQA 4NXNC 1UEIA 1A1VA 5A2QD 1FW6A 3FTQA 3C14C 3GFOA 4EKDA 3RRYA 4CEIB 4YONB 3I5YA 2BHRA 2V8OA 4GOJA 1A4RA 4IOMA 4CT5A 4GRAA 1R5OA 3BAFA 3U61B 5C4MA 4DCNA 5KYKA 3TKLA 3GJ4A 4B3CA 3X1WA 1RYHA 5KHOC 2VP9A 1DS6A 1G3RA 1FTSA 4DR4C 1VKJA 4HAZA 2D2FA 1IBLC 2GBLA 1YZNA 3X2SA 4FIDA 4JVLA 4NCHA 3GP8A 4LC0A 2J45A 4C7OA 1R6BX 4BFXA 4JI1C 3BWDD 3CNNA 2BBTA 1VTKA 2OBNA 5EXSA 5DYGA 2MSCB 1Q0UA 1E1QD 2QI9C 3CIOA 1SXJA 2JLQA 4V0ME 3MRSA 1J8MF 2I1QA 2A2ZA 5FTJA 3E1SA 5F9FA 5KSOA 3FVQA 4A6XA 3SE0A 4NMMA 4GKJC 5JI3E 2IYRA 1E9AA 5LB4A 4IEEA 4BECA 2F43B 3N2IA 5FBVB 3HU1A 5DE3A 4B33A 1WCV1 3SC3A 3CX7A 4HLUC 2RB4A 1E2FA 4Q03A 2P2LA 4P4UA 5J4YA 2IS6A 4RD2A 1ZD1A 1GFIA 2ZYVX 1ZU4A 3BB3A 3B2EA 1X86B 4DZZA 5K8UA 2VLIA 2E8FA 3NBZC 1YHNA 1A2BA 4OI2A 1QVRA 2NTYC 5FI0B 1FPMA 4C0QC 4Q7MB 1R7RA 3U4QA 2QE7D 4G0NA 2QMEA 4CYMA 2RGCA 4H1VA 3EZ7A 2QP9X 2QY9A 4HDQB 4PO9A 3SR0A 4B6EA 2KI5A 1UBEA 1DOAA 4LJAA 4JLMA 2QMHA 1KO4A 1AS0A 1KO8A 4JLBA 2CCKA 2XXAA 1W47A 3BH6A 5LD2C 1E99A 1NJGA 1D2NA 2YCBA 1N36C 1XP8A 4AURA 2CL7X 2QN6A 4B6FA 2AK3A 1EWRA 1XEWY 2ZS7A 1EFUA 1WP9A 2HCJB 3BOSA 1OXUA 3WP1B 1OB5A 5EP1A 5L3VA 3GLIB 3G82C 1QHHB 4P4SA 4P33A 4R98A 2GWHA 4NOZA 1BYIA 1KI4A 1V5WA 2GXQA 4M1SA 2B7BA 2Z4RA 1YRAA 3F8TA 3I8SA 4MKGA 2I1VB 4XIGS 3TNFA 1OF1A 3FMIA 4Q1FA 1N2CE 3BD9A 4DR3C 1FP6A 3O8DA 3KUDA 5HKKD 4J0QA 1G5PA 1NIJA 2W6JD 1OW3B 4ARZB 1EGAA 4LHWA 4QBIA 2Z43A 3A4LA 4URZR 4IOJA 4TYWA 4KV9A 1E2DA 4D4MA 1L7VC 1XX6A 1WH9A 1S3GA 4MGKR 5J47A 3Q9LA 1E9FA 5B58C 4B3RC 2ZRAA 4EPRA 4YMVA 5FL7A 2C95A 4B43A 1G64A 1AGRA 1U0HC 1X8KA 2V6IA 3TQCA 1Q1ZA 4AKGA 3CPEA 4AKEA 4A36A 4RCZA 5G41A 4FWIB 2QAGC 4IFBA 5UKDA 1ZMXA 2J59A 3M1IA 3LNCA 2B7CA 1E9BA 1XB2A 4OK5A 1D2EA 1E2QA 3RC3A 3QENA 3LD9A 1P6XA 2AXPA 3PR1A 1OHHD 2X2FA 1YZGA 3AVWA 2GJKA 2R8RA 4IEIA 1IN7A 3SHWA 4CEJA 5DO9A 1SULA 1RRPA 5FI1B 2DR3A 4IRUB 2GEVA 4BGDA 2V4ZA 1MO6A 3WYAA 3RLFA 2ZJ2A 4IJMA 1MABA 3JZAA 3OZXA 4M9XA 2VF7A 1D2MA 2AWOA 4DCSA 2GAOA 3VR4A 1BH2A 1YZLA 2E1RA 3Q5DA 3VX3A 2JLVA 1R5BA 4PAOA 3PFIA 4L15A 5GVRA 2PX0A 5JEDA 3PEVA 1G8FA 2XR1A 5FOXA 1VCIA 4PPFA 3CB4A 4A15A 4TMTA 4DJTA 2IYUA 3NDPA 2OPLA 4FCWA 2GXAA 1NN1A 3T5GA 2ODEA 1ZNYA 4QGFA 3DKPA 2JJ2A 3ZQJA 2FSHA 4C9BA 5FOUA 2IXGA 4LJ4A 1EFCA 3I92A 4M53A 3OF5A 4M2LA 4OQNA 3UKDA 3UMRA 2VHQA 2JLRA 5FOTA 1F60A 1XPOA 3KL4A 3AF3A 2GF0A 2J46A 3TVTA 3R9XA 4V0LA 3W5IA 1KIMA 1R2QA 2QRNA 4E03A 1OH5A 1YR6A 5E7JA 5JCZA 1W2GA 4DV4C 4PO1A 2FX3A 4EPYA 3L8ZA 1J8YF 2C99A 1E2EA 4LX0A 3A1WA 2FSGA 4PAMA 3IBYA 3D7MA 1A7JA 1KI8A 4HLCA 4B35A 2ZRFA 3ZIAD 3GEIA 4TMWA 1H8HD 4TSFD 3EPKA 2CK3D 1KSGA 2FFQA 1Z06A 1MO3A 4URVR 2RHMA 4C7OB 4NYMR 2GF9A 4Q9IA 2WSSA 4JLNA 1NRJB 4TYNA 1XJ0A 2CVFA 3PENA 4LPKA 2F1RA 1HUQA 3IHLA 4XVUA 4K8OA 2FGKA 1XRJA 4X8HA 3BORA 1KJWA 1SXJB 1UKEA 4FI3C 4BQSA 1PV4A 1G16A 1CU1A 1OE0A 2E7GA 5DI3A 4FMCF 3SYKA 3BIFA 1ZUHA 4I1OA 2JATA 3LWNA 2XZPA 3RS5A 3QXXA 4M9SA 1GNQA 1RC8A 1TPZA 2C96A 1M7BA 5F2EA 3KTAA 4BWYA 3GLGA 1LS1A 3A4NA 1CRQA 3VKHA 4NCJA 1IM2A 5G3ZA 1KI3A 1E79A 3ZZUA 2CBZA 2IHBA 1SHZA 1X8LA 1JAHA 4DUYC 2XSZA 3ZH9B 5J4VA 3U4QB 2ZREA 3EWSA 2PMDA 4Y0VA 5CYPA 3TVDA 2PZEA 1M6NA 1WDTA 4A0GA 4QGGA 3AM1A 4KO8A 4A6PA 1CKEA 1KSHA 1W46A 2FF7A 1XFAA 3A58B 5C18A 1KK3A 2AR7A 2XXAB 4KCGA 5K8IA 4XOIA 1E0KA 1OFHA 3AP2A 4JL6A 4Q19A 1W0KA 3LBIA 4Q7JB 3PUYA 2QL8A 2RCNA 3SHFA 1VCMA 4Q9HA 1E4VA 1DBSA 3WP0A 3FPAA 2JASA 1T3SA 1UF9A 2Q21A 2PT7G 3I32A 4P4SB 3QKRA 1KHTA 2VP0A 3J80D 1IBMC 1D9ZA 2GEUA 4Y0AA 2X8AA 5DSZA 3NHBA 4IOKA 3AVOA 2ZUBA 3AUYA 5IK2D 3IO5A 4RKFA 5CIQA 2FU5C 1E2NA 2E87A 3I73A 4MDEA 3WRXC 2FPMA 3MWYW 2ZJOA 1OLOA 4NCKA 5FTLA 5JLJA 1HE8B 1KI7A 2ZRIA 1NLYA 1Z0IA 3KQHA 4E09A 3SQXA 3VR3A 1NN0A 4ZCMA 1DO0A 1A82A 1YZKA 4E5UA 2OSBA 4C0AC 2DY1A 4ZIRA 3IUYA 5EUQB 4Q47A 421PA 1PLJA 4AYTA 5KPDA 2RGAA 3QOFA 4M4SA 2HLDD 4OI0A 4LJ9A 1P2UA 1OFTA 1KKGA 1XTIA 3SJAA 1AJEA 4YHHC 4MH0R 1IHUA 3GD7A 3R9WA 5E3HA 1ESMA 5BN3A 1XTJA 2E8CA 4QXAA 3J81k 1E2MA 2WJHA 1WB9A 3FE2A 3EZFA 2XJ9A 1NLFA 3RS4A 4OQXA 2UXBC 1J90A 3OEEA 4B3FX 1U99A 3RC8A 3EERA 3ASZA 1FNMA 2IF0A 1RJ9A 2MMGA 3U7FB 3K0SA 3QEJA 2QTHA 2YNMA 1QDEA 1R10A 4CEJB 4ZV4A 4OJQA 1VYTA 3TSWA 2IEYA 3B9QA 3L43A 1II0A 4GSYA 2XX3A 4PO8A 4AI6A 3SJCA 4KHPC 2LKCA 1MABB 2WJYA 1QF9A 1HR0C 3OE7D 4LRWA 1GAJA 1KK0A 1SVMA 4HLUA 4RD6A 1IJEA 4NYJQ 2PJZA 1NMXA 3K0AA 1OXXK 2YWEA 4RFVA 1E0JA 1Q3TA 2OCYC 4MYCA 5TV2A 1KDPA 1SHKA 2OXRA 4RFSA 1KI9A 5FUWA 4BFTA 1KGDA 2EFHB 3Q7QA 2OPLB 4WZ6A 5AUQA 2CHGA 4PHTA 2IWHA 3TSZA 2ZSAA 3QVVA 1TF7A 3IIKA 3SU8A 1N0UA 2XTNA 1ZC4A 2OXCA 3KUCA 2P6RA 4AYXA 4EFLA 4LCBA 4GMDA 5C4GB 3DPUA 4JI5C 4NTZA 3BFVA 5KNCA 3THYA 1FL9A 3FKSA 1T5LA 5FPHA 5F3WB 2BMDA 3GJ5A 2HXSA 3BBPA 3OIVA 4JVSB 4HUQA 2FWRA 5DN6A 3C5CA 3WBJA 2IYTA 1TF5A 4NYIQ 3BERA 3CRQA 5FTNA 2OCPA 2ERXA 3RSOA 1RPZA 1OXSC 3EZ9A 5EE5B 2F7SA 4DBLC 4HDCA 2DFKB 3ICEA 4OHVA 3KJIA 2G0TA 1VLAA 1LVGA 1G21E 3ZDQA 4Z51A 4BLPA 4FXPA 1G19A 5CJPA 2VH5R 3W9YA 2HHHC 2NPIA 1IY1A 1ZM3A 5C46F 1P9RA 4JI0C 2VSFA 4PQYA 2CDNA 3P32A 1NKSA 2GHIA 2ZJAA 1L4UA 3UWOA 5TARA 2J0UA 3KQUA 1UM8A 5DI3B 4CT4B 1QHXA 5JJIA 4FMBB 4DVGA 1XD2A 2QAGA 2ZRLA 3DM5A 3SZRA 2D3WA 2WWGA 4DR5C 3KTAB 3A1SA 4US0R 1S2MA 5CDFA 4JI8C 3VR1A 1M1YE 5TB5A 3GLGB 2ZVPX 4Q7KA 4Q9JA 3MG9A 4FCVA 1Q22A 3SNHA 3EXAA 4UNRA 3I62A 1DG1G 1HEIA 3W34A 1FOEB 1QHYA 2GA8A 1XXHA 4O0MA 1L2FA 3NH9A 5H8WA 2O0JA 3RWOA 4A9AA 4B3XA 4OHWA 4DRZA 5LMUC 5FPTA 4QM7A 2ATWA 2WTUA 2QRZA 2JDID 3SYNA 3N2EA 5AJXA 4C2TA 1NY6A 3CRMA 5G40A 4EPXA 2K5UA 2Q0HA 4C2UA 2CNWD 3EC2A 1ZNWA 4XJXA 4AKHA 4RD1A 2CHVA 5FUXA 3B60A 5BWMA 1TEXA 1KAGA 1CJMA 4QBGB 1N6OA 3JAMD 2QMUA 1YE8A 3L0IB 3NH6A 2OCBA 4Q4HA 2WWXA 1Z0DA 3QKRB 4ZDJA 3WNDA 4DB2A 2PCJA 4QC2A 2DB3A 4BFWA 4A2PA 3LVQE 5FBRB 4B71A 1JQLB 2V9PA 3OIWA 1U90A 2W6ID 5HPYB 4NONA 4PTLA 5IWAC 3VR5A 2ONFA 3AVUA 3R7WA 4DLYA 2UUBC 4K0KC 2AK2A 2A7QA 3TJZA 4TLCA 1O3YA 4DV3C 1YZUA 1MKYA 1ZINA 4FMCB 4NCNA 3TW4A 4DDVA 4IOLA 2WWYA 3AVVA 4JYBA 4A2QA 3LW8A 2QBYA 1W1WA 3DL0A 4Z54A 3PJRA 1RKBA 5FPKA 2D62A 3ZZTA 4G5RA 4XTRA 4QHSA 4TLAA 2JGNA 3REGA 1FJGC 4ZIRB 3WY9A 2OESA 1XEWX 2DWPA 3LLUA 4KHZA 2UXCC 2GCPA 3EZ2A 1OIXA 2SHKA 3RS0A 1NVVQ 4LFAC 3VQTA 3GFPA 1USPA 1WRBA 4O25A 4TYQA 4G5SA 4A2WA 4YY3C 2CEAA 5H68A 1JEDA 5B57C 2W0SA 4KI0A 4ZPXA 1LTQA 3FWYA 3IQXA 4JSYA 3VU9A 1FTNA 4PHHA 3DZDA 1D9XA 1XWIA 3IPYA 1N34C 2FPKA 2ZE8A 1T9HA 1DAKA 1S4QA 3UK6A 3WXMA 1W4CA 3MUFA 4Q01A 3VKWA 1RJ9B 4IDPA 2UZ3A 4AG6A 4PC7A 4WAUA 1H8ED 2FEOA 4DV1C 3IGFA 2C2HA 3CR7A 2QU8A 2CE7A 4DLTA 2IYXA 2OHFA 2IXFA 3AVXA 1DO2A 1EFHA 4LK2A 3KFXA 1CJUC 3OEHA 1Y63A 4TYPA 2BEKA 1Q1QA 4QHYA 3W5JA 3TUJC 2V7QD 1P61B 2IUSA 3GEHA 2YC4C 1II8A 2WJJA 2P0EA 4W5HA 2QSYA 4XD7D 4GL2A 3B82A 3K0AB 3AP3A 3OESA 5M04A 4Q00A 3L0SA 1JR3E 5KNBA 4DEYA 1GITA 3IEVA 4MDFA 4RFSB 4N3NA 4NCIA 5JS7A 2BBSA 1TL7C 1KKMA 3I72A 2OM2A 2XNSA 2BDTA 1KJYA 1TADA 3MD0A 3ZZ0A 1E32A 3IBGA 2D7VA 1N5KA 5LD2B 3BH7A 4LYJA 4XVQA 2W2XA 5BYJA 1UBCA 4G5GA 4DLXA 3THYB 4JLOA 4PANA 4AC9A 4DCVA 1KNXA 5DISB 1VIYA 3EZ6A 5JMTA 4LF9C 4HUQB 4KVAA 4QFMA 3I5XA 4C0BA 4Q7LA 1E6CA 2B8WA 3KXKA 3K9LA 2CE2X 3B6EA 1TMKA 4KLZA 3CF2A 5FOVA 1ZM7A 4OJKA 4DT1A 1SKYE 4A8JC 4Z1MD 5CK4A 4X62C 2N42A 2QORA 4FMDF 4GOKA 2IS2A 1TNDA 2GZAA 2UZIR 3KB1A 3GLFA 3TR5A 2R9VA 5AUNB 4LOAA 4UXHA 3QY0A 4MRNA 2BCGY 1JR6A 1XZQA 4Q5IA 5AUOB 2OBMA 1PJRA 1JPJA 521PA
chains in the Genus database with same CATH superfamily
1VXRA 1NXOA 2I4OA 2ZQ5A 5A1TA 5ENVA 2INGX 1EEHA 3QOWA 3RVJA 3T1QA 1MTZA 4OXKA 2VJQA 1EYZA 1G2QA 2XF8A 1P4JA 2PV0A 2X1MA 1PJ3A 4KQJA 2MSKA 1QXSA 1PG4A 4LBWA 1U0NA 2F1HA 2PIDA 3FCYA 4H31A 4I9FA 4KAFA 1JFFA 2XTAA 3OQ1A 1LBTA 4IS3A 4KPYA 4LS3A 1PFWA 3E9ZA 3QU9A 1YB7A 3C1OA 3HDTA 2PVCA 4H9GA 4PC1A 4JCCA 1Y1LA 2H8GA 1XMJA 3CQ1A 4M0FA 2CHQA 5KYYB 1ZIDA 2IELA 2HT6A 2RHRA 3BWCA 3JATB 3M6VA 5AJZA 5T41A 4Q3EA 2O8FA 2F3QA 3OU7A 4CKCB 2QR5A 1WR8A 4DDTA 3FSEA 2EFCB 1VP3A 2EATA 4GZLA 4JP1A 1G5IA 1XQ9A 4X1KA 3GMIA 4ILKA 3IVXA 4EG0A 1E1RA 3VAZA 1YULA 1ONNA 1UL1X 1LPNA 1XXHB 3DEFA 1U3VA 4C78A 5TIIA 2B3DA 1CR1A 2AEFA 3F9RA 2QSZA 4X1YA 4G09A 4DQDA 2A0WA 2IYLD 3MWJA 3QGMA 1DKMA 1TUEA 2VJLA 3I2GA 3K53A 4N03A 4MP3A 4NPAA 4E21A 4D56A 2V58A 3GH3A 2NPOA 4BZWA 1OPRA 1UJMA 5EAIA 3TM5A 3GARA 3NW9A 1B8UA 2J3EA 5KYWB 1J9ZA 1VIAA 1TCVA 1CUFA 4AJOA 1MOPA 5EQFA 5HE9A 3ONWA 4KJZA 1ZVKA 1YI1A 2F6RA 2XUKA 2IUTA 3A6JA 2OK7A 3FN4A 2CDBA 3BEDA 3KVVA 2DVMA 2Y2VA 2ZANA 3R7NA 4DANA 5LWHA 2XJ4A 1BDIA 5HGXA 1MIOB 1Z7WA 4FSXA 4H1UA 1V5EA 4GHWA 3B3AA 4QQKA 5I7OA 2HXYA 2UUOA 1CJSA 1WZUA 3CEMA 1DKPA 1YK0A 2P2YA 3I5MA 1BIFA 3K9BA 3CISA 2POQX 2Z2IA 4PHGA 1ZI8A 3HJRA 2OE2A 3ANYB 2ZJ6A 3NIFB 1HQYE 2FMKA 2OQ2A 2ZEJA 1JAYA 2IW3A 2PZJA 1K2WA 4PZEA 1G7TA 3OE4A 3PC6A 2KWIA 2QBYB 3H8VA 4L76A 4ZU3A 3T0GA 1P7ZA 4MWSA 4INPA 3ZHRA 5JQWA 4YT5A 4CL0A 2GLXA 3JVVA 3FSGA 3VNSA 4URFA 4P81A 4Y7CA 1ESEA 3TXAA 3JR3A 3NJRA 1KO7A 3D02A 3QKUA 2KLBA 4JL5A 2W2KB 2Q0QA 3R7DA 2VDMB 1PG0A 3FDXA 4HGYA 3HKDA 2JIOA 3SS7X 5CCBA 2C83A 2Z5FA 4Y2UA 3LDAA 5DV9A 1N25A 3HYTA 3I4LA 4IXNA 3VM6A 2ZROA 4FHEA 1MJHA 1Z16A 5CG2A 1I6WA 3V1NA 2ZWVA 1MC4A 2EV9A 5FJJA 5IYZF 3PX3A 3BZUA 4JKYA 4UOQA 3FUTA 1O4VA 3RRZA 2WJVA 4EBBA 1WUIS 2ZR7A 2R0QC 3G8CA 721PA 3A6FA 3Q8MA 2PX5A 1QFYA 4RF5A 3FFTA 5TSDA 2ATXA 1XZIA 1UDWA 3DPSA 3HU3A 4TROA 3GGOA 4RELA 1GJRA 5L51A 1N6NA 2I78A 2Y76A 3FMFA 4F4JA 4PZ9A 1L1RA 2C5LA 1NJFA 1DNPA 1V1JA 4G07A 4H16A 3TNDA 2JD2A 4Z4HA 4URUR 3HV2A 1U63A 4KGZA 2O5EA 3PLNA 2Q3CA 3IALA 1NXWA 3LAWA 4BIMA 1X3SA 1BRMA 1WCYA 4X54A 1P4SA 1FUEA 1UJNA 1L4KA 2JFZA 2Y66A 4PGHA 5JZVA 2QRHA 4BZZA 4EY8A 4XIYA 3JVIA 2FVYA 1QE0A 1EFVA 2DTDA 4WZBA 5LQDA 4NE2A 4NAUA 3T7TA 2ZJ5A 2M32A 5ENZA 2DWQA 2QG4A 3DA8A 1XE3A 3ENKA 5KNDH 4U7WA 1WXWA 2NAPA 4KFTA 3DCNA 2PRIA 1U4OA 3LHKA 3VPBA 3LFHA 3W8FA 1YONA 1IY8A 3PHLA 1COWD 3I6IA 4U7JA 4RNCA 4U5XA 1RXSA 5E0OA 1T35A 5AWFC 2XEXA 4AJ1A 2V5UA 2VHZA 5CVDA 2I8AA 3BGOS 3REFA 5IFLA 3ZJUA 1WXEA 4XX0A 5FBKA 1LFDB 3CB2A 3TAHA 3DYVA 4M9RA 1RPJA 2ODAA 2JFOA 5B1HA 2W6CX 1ZEJA 1PD1A 4RQTA 4IIVA 1CUCA 5TMPA 5A5EA 3QX9A 2Q28A 3B70A 4MKXA 4UHJA 3TLXA 1V8ZA 1IUPA 4BB9A 3SOPA 3HXQA 2QNRA 4D92A 3SZ3A 1WO8A 4RMNA 3PX2A 2BT4A 4C7JA 1N6KA 1N33C 1TTQB 2C5GA 2V03A 3L46A 1RZRD 1IBMB 1YR7A 2CUZA 3CUKA 1F1JA 1KJJA 3MLAA 4RV4A 1E66A 1TJ5A 1XZAA 2B5VA 3RJTA 3ZJ4A 3LAXA 2B9EA 3AH8A 4LY0A 3MMPA 4ZRDA 4C04A 4C0WA 3GLFB 5IFKA 2A3RA 1P31A 1ML8A 3GRRA 2VSNA 4A1FA 3ZDZB 4M1EA 4O5OA 4FXOA 4G81A 3VJMA 2OFXA 4B73A 4CU2A 5IZCA 2R1ZA 2BHLA 4JR0A 3SQMA 2R66A 4DBZA 8MHTA 4Z4IA 3SS8A 4HRVA 1EDOA 2F9MA 2I22A 2P6NA 3O2QB 4N7BA 3TWOA 3WTBA 2AC2A 2WAYA 3AZQA 1NYLA 2JAUA 1AKUA 1G41A 4EDFA 1F12A 4O0LA 1J6UA 4P2BA 4QELA 1INLA 3V2UA 5JC1A 1WMSA 5K0CA 1RHUA 2GVZC 1I4DD 4TUYF 2JZNA 4YASA 2IBSA 2I7DA 1JFFB 2YUTA 5SZKB 3A4YA 3PIIA 3OPQA 4LE5A 1VSQA 1GRQA 3K4QA 1QP8A 2Z58A 1L5YA 2JI9A 5JT1A 1AKMA 5AKZA 4G41A 2OGTA 2V6FA 4XCQA 2VQSA 4MR9A 4UHEA 5FI5A 3R76A 2JH9A 3NAZA 5KOIA 2W6ZA 2O8FB 1FFHA 3PXCX 1PT9A 1XI2A 2Y4NA 1ZM2A 2XKJE 4M1ZA 4KRFA 3U2QA 3HWSA 5FEMA 4JI2B 1A72A 4X1KB 2UXBB 2H4WA 2EP7A 4JYAB 4DV7C 1L5OA 2PXXA 3JTMA 3LWZA 4CM8A 1GHTA 5IHXA 4IO0A 4JHXA 3GY0A 3HDHA 3IBFA 1BW9A 4N76A 4E13A 1X7GA 3NFRA 2DHEA 1E7SA 4MH4A 2H7VA 1WXIA 3DV9A 3A1UA 3PJEA 2PT5A 2V74B 4W7SA 4X1YB 3WZMA 1HNWB 3OZUA 3VNBA 4LCEA 4H7KA 1QH1A 1XDGA 4ZTBA 5IRCD 4EK9A 3L7AA 5F77A 3WBKA 3MJEA 4QU0A 2EHJA 1VECA 2IRWA 3VNUA 3LH5A 2PN2A 4FMDB 4RTQA 2R8BA 3PFHA 4U2GA 4KFUA 621PA 1COWA 2ZJ0A 1SD1A 1SUPA 1D7AA 1YA6A 2H18A 3MUNA 4J16C 2DT8A 4OBXA 2BFEA 1GSIA 5JSZB 4G67A 1DAEA 1JH8A 2EBHX 2XODA 4HNRA 4KUEA 4MVYA 4UJ5A 4DLRA 5K3OA 5FB3A 3GCWA 3VKHA 3EFOA 2HMWA 1QS0A 1EJ0A 3DFIA 4YJ3F 5DBIA 1UPAA 3QI2A 1TAUA 3Q4GA 3OE1A 4JY7A 1JTFA 4LI3X 1XK6A 1GKUB 4HGZA 4XDZA 2PL1A 4JZYA 3CV3A 3K96A 1QU3A 2Q3FA 3AEYA 1OZGA 2QY6A 2Y9PB 3DZ8A 4D8UA 1N78A 2YBEA 3CPJB 5I7VA 2M6KA 5CT5A 5AJTA 1DQYA 4BFUA 3TKYA 4CCYA 2DYJA 2GZSA 3ZK8A 3SQWA 2GO1A 1XT6A 4IXDA 1HFWA 2WWFA 3VNAA 3PGVA 4QBHA 4A8JA 3HKDB 4V03A 1YQTA 2FLVA 2O57A 4I50F 4BO2A 5KTMA 4W5OA 3NBQA 1ARZA 1VRCA 1TU3A 4U8HA 4YCDA 1A77A 5BT9A 4R1PA 2EWMA 2QX7A 3RRNA 3Q41A 5J4HA 2P2ZA 2NP7A 2IKQA 3VJKA 1QGAA 3LT0A 4D46A 1JHAA 2ZRHA 4QRDA 3ZWAA 5MGBA 3PUXA 4U7HA 2C03A 1Y7PA 4QUGA 2OK8A 2PH3A 3AUTA 1JAZA 1E1KA 4AZTA 3QE2A 4KK3A 5KTOA 1I4WA 2R3SA 2XOKD 4XPZA 1Q7BA 4DVJA 4FJ2A 5CM9C 1BXKA 2HHJA 4TZKA 2CFIA 1K8XB 1RAFA 2A9RA 3U7FB 3OCUA 2BGLA 4WCVA 4M1OA 5E4FA 1VLLA 1HH4A 1NBME 3DTTA 3FUVA 4EHDA 4DR6B 1WZ2A 3RRFA 3ZGZA 1N32B 2AF3C 3GA0A 2XAUA 4RANA 3T3DA 2CK3A 4MVJH 3HHEA 3WL7A 4LF5B 1H3NA 1IOWA 2FZVA 2WHPA 3QWFA 3TVYA 5KWSA 1GPDG 1O4WA 1OROA 3OFND 3VUEA 4YV7A 4KREA 5ITWA 1EFVB 4FYKA 4WZBB 2F17A 4M21A 4KMOA 3RE1A 3TZCA 3WBBA 4EAAA 5KTNA 1EX1A 3NJ4A 1ORDA 3L7NA 4S35A 1SCJA 4QJ3A 1UEJA 4MPJA 4QQ8A 3VKGA 3C48A 1BDJA 1FFCA 1KO5A 4EQ6A 2CY1A 1RWWA 1EAYA 1U7OA 5AK6A 1Z13A 2R65A 2F59A 4BMDA 3CC8A 3F6RA 1Z0JA 2I2XB 1CUSA 3H9UA 4UEOA 4BNXA 1IBKB 3C8UA 5EHNA 1W96A 4HH0A 4OOFA 4JU8A 1Y6JA 4FE4A 1TZMA 3LVRE 4XX0B 3LIIA 1ZRHA 1M8JA 2P4QA 4EUHA 2BUAA 1E64A 4OQQA 2WJ4A 2P2GA 4FN4A 3MFQA 4WLUA 1POWA 1QHGA 2VQFB 4XEHA 1RQLA 1SUAA 3RAJA 3RC9A 1K08A 1UMDA 1LLCA 3TMKA 2ZIVB 2HPVA 2IC5A 3D2AA 5AKLA 3L93A 5DM1A 4YX9A 5IN4A 3ADDA 2PD4A 2Q9UA 1SUEA 3DH0A 1TAQA 5K0BA 2J3MA 3EK2A 2LRHA 3L6EA 3Q5GA 3V7YA 1A9SA 3LQYA 3SF8A 5TY0A 3WHLA 1VHWA 2ZIZA 2AHRA 5ABPA 4MUBA 3KKPA 4NU5A 2EU8A 2JRLA 5HMLA 3T34A 1DPFA 3ZVNA 1A50B 1B73A 4EY4A 1O8BA 1WTAA 3WV4A 1N2CA 2RGXA 3TB6A 2I6SA 2GSWA 3HDJA 4N01A 5BQ3A 3EMVA 4X6XA 4FFNA 4LKRA 3N2ZB 2QVZX 3BSYA 4KFCA 4DSNA 2EGHA 1UOQA 3VR2A 4KR7A 3F71A 3HCOA 4QG7A 4BASA 4DOMA 4DYDA 5LQNA 1XAIA 1YR3A 3P26A 2XUQA 3ANTA 1FQKA 3NHFA 1FFEA 2YC2C 3QBTA 1GILA 2H2HA 2XYRA 4PEVA 5HUJA 1Z0SA 3L9WA 2QZ9A 5K3FA 4ICIA 2IS4A 3WGTA 1BMFD 5A1JA 5A5VA 1JTEA 2YDXA 4E07A 4LFAB 5AD1A 1B6GA 2WJIA 1FJ2A 2VR1A 2YYZA 9LDTA 5GZ6A 2Q29A 2P5TB 4MR9B 5ED0A 2REBA 4XASA 3ETCA 3BTSA 1ZJ6A 4JDUA 4Y2QA 3ZZMA 1O9HA 3AI1A 1NIPA 2LWIA 4EJMA 1APBA 4BSZA 1L5FA 1QH9A 2X6RA 2WIJA 4H7HA 4MCJA 4RD0A 3ZD6A 2X8WA 4KSCA 3JQ8A 4P86A 2PE5A 1UXOA 1MBZA 4CG1A 4CM8B 2NZYA 1RWQA 2BMVA 3Q0IA 4RUKA 1JHOA 3QYAA 4Z0HO 3VRHA 3W90A 1BW9B 1M5RA 1LF0A 1PWXA 1FLNA 1ZJ5A 3IOEA 2FMIA 3LP8A 3ND8A 4PLZA 4TTQA 3HH8A 4NU6A 5ELLA 5GAJA 2QRVA 4ZC1A 1Z8NA 1QH1B 1E7WA 4GI7A 1BX0A 2SCUA 4M0DA 2H0AA 3NASA 1W0JD 4QFCA 3WRYC 4TM7A 4EL0A 1UBHS 3SZMA 4ZYXA 4KPGA 4A23A 1KJNA 4Q1BA 3U09A 2IYQA 3DG9A 5I6DA 3DVLA 2UYYA 1PEKE 1G3MA 2YTZA 3IIJA 3WGLA 3ZHQA 4BBPA 3UYLA 2XVMA 1TK9A 1IE3A 3H1TA 3N58A 2BFEB 3PQEA 4YHBA 4WS9A 1YJ5A 4L22A 5B6IA 3EFOB 3TM4A 1J5EC 1H1DA 1QS0B 3OQ6A 4ZYWA 5HTOA 1REQA 3TOZA 1ZI6A 1UKVY 4P9NA 3C3DA 4IQ4A 3N2QA 5KU1A 2CC2A 1LA2A 3WIDA 3CLSD 4LZJA 3WLPA 3B7WA 1XDWA 3OOSA 3SK0A 4UOEA 3W1WA 2E55A 1Q1BA 1GPWB 1GTJ1 4W99A 2MOKA 2FFBA 2G72A 3I9NA 4GR4A 4JS0A 4OB6A 3RHFA 4PY2A 4RIIA 4LF9B 4TTAA 1GV0A 1CE8A 3V3TA 2BMFA 1GOTA 4CCYB 3ZXXA 1SU4A 2P91A 1NBEA 5JZSA 1DIGA 3X43A 2CXNA 2Z8ZA 4GFDA 3KVOA 4NULA 3DOEA 4A8JB 1K68A 2H16A 3HPQA 4Q0MA 2UU9B 2FEKA 3VH3A 1W36C 2NTJA 4FNAA 2R6ZA 4BKOA 3EW9A 3PCRB 3CMMA 2J7PD 1CZHA 4WOBA 4IUYA 4LSZA 1QCCA 2ZI4A 3EF3A 3N2KA 4G3XA 4Y3UA 5E8RA 3UVEA 4GI3A 2NGRA 4I6GA 4AL4A 4C3VA 2BBOA 4IDBA 3BE6A 4XDGA 5SYAA 4FT2A 5BNIA 1G8AA 1TZJA 3L7OA 5KTSA 4DY4A 2HWWA 3TL6A 4YUVA 3WADA 3O2SB 4JB8A 2V0CA 4WZAE 3FNHA 1XJQA 2CKDA 3DKIA 3PUJA 4PFKA 5ILQA 5C1IA 5DNAA 2C9ZA 4DG5A 3T95A 1ENOA 1T15A 1VI5A 3CCCA 1N6LA 2JFVA 3K70C 1SY7A 2Y2UA 4CLOA 2VHVA 4DRXA 1NUAA 4NXNB 2W6MA 3AHEA 4PFQA 4TWBA 3G0HA 1D6JA 2WKWA 3ASVA 4RSHA 4HGQA 1W7AA 2BY4A 1OV6A 3KNZA 3G5UA 4TWZA 1C29B 1QCZA 1LBHA 2VP6A 1K5GA 1CPYA 1I24A 1I0LA 2WHPB 3REQA 1AHNA 4I14A 4WZBE 1FXSA 3GDWA 1NUTA 2ZSJA 1FBNA 1M6EX 5JTUA 2DBVO 3IP8A 4L4XA 4YROA 3I3SR 4HXEB 5ALHA 4QT4A 3ZJYA 4G97A 2BGJA 4DUZB 1Z4MA 3O4HA 4IR7A 3H16A 4EQ6B 3NWOA 4JVOA 5IXYA 3FVWA 3V9AA 2FPGA 3PF8A 3C3XA 5KSWB 1KMIY 3GT4A 1A1SA 3BDAA 3HCCA 2AKAB 4YWJA 3V2GA 1J9EA 2YWGA 2FN8A 4BNMA 5BNWA 4J2TA 4HPVA 3VPDA 1UZMA 2VBIA 1PGQA 2FP4A 2J6CA 4N18A 4AJEA 2E1PA 2YIJA 3VKFA 3BRQA 3KM0A 3IHTA 1I5EA 4W1RA 1MB9A 5LZ7A 1V6AA 2O1XA 5AP9A 1QWIA 1CIVA 1E62A 1OV4A 2R7AA 3C7KA 3DOCA 1FTQA 1TECE 3FI0A 1P5ZB 4P3YA 5K2OA 1N77A 1UMDB 1E7RA 3TOVA 4P3XA 3VTKA 1BWRA 3NTLA 2X3FA 4GKJB 1T5HX 2P2BA 2WFLA 4EABA 3H86A 4W5RA 1OBHA 3I9MA 1XMOC 2P5SA 2JBWA 4I1SA 1XA3A 1KBZA 5E9JA 3E4CA 5AVUA 3IVMA 4P4LA 1IOVA 3QLJA 4J4HA 1KJZA 1BJKA 4QPNA 4WPGA 4QTYA 1ULZA 3O8RA 2ZUFA 2C5FA 1GDHA 3SG0A 1OLUA 3PI7A 4ALJA 1M6YA 2R6R1 4QD3A 4X64C 1E2LA 2VSQA 4FBLA 1B76A 1N2CB 2CNWA 3UA4A 3I42A 4QFDA 3WK6A 4FW9A 4RXTA 3U7JA 2P6PA 5HA5A 1ZVMA 2Z9CA 1NASA 3QVKA 4O2LA 3CQ9A 2QUBA 3OIUA 3P5SA 3JSXA 2IXEA 3EPHA 1AURA 3VR6A 5IJXA 3CQ2A 2ERYA 4D80A 1EJBA 2J7KA 4O3FA 5K3FB 4UU1A 1PE0A 2LV8A 3LQ2A 2NW6A 4OQLA 2WE8A 5AKHA 5H3CA 2VT2A 3PFBA 1RP7A 2F3SA 5FQNA 3S81A 1V37A 4NPCA 5TT1A 1C1XA 4G36A 2YHAA 3USCS 5LU9A 3OZIA 3CNLA 1V2HE 5YASA 1O89A 1RJGA 3PUWA 4FEAA 1DZIA 4JOQA 1WB6A 1P2VA 1QZ3A 2FB9A 3TE7A 5F7OA 3JQ8B 2R1UA 4C7BA 2DFDA 1SXJD 4OL0A 3U4HA 1HX7A 2QTZA 5ALSA 2D0PB 2FCAA 4GOLD 1YRQA 1NR1A 5IG2A 1T1JA 4IJ5A 2XV1A 1FLAA 1MCZA 4F9TA 1UWVA 4HZGA 4QX6A 3VHRA 5LXTF 2XUOA 1IBCA 1T13A 3ITEA 2QRVB 3C4JA 2Y3IA 1YCHA 2BMAA 3GG9A 3KCNA 4G4IA 2QL6A 2SCUB 4MW6A 3ACCA 1RM3A 3ZWYA 2O3UA 4DLUA 1KPIA 3A6LA 1Y1RA 3HYSA 3OOWA 2ZK7A 4UUMA 4MRPA 4Q3OA 4C4TA 1RKUA 1Y8CA 1VGVA 1Y4DE 1EP2B 1CSEE 2P9GA 4OYHA 1IN8A 3GJTA 3H0KA 2XCIA 2I4LA 1XZPA 3E58A 2DHRA 4EG5A 1XBTA 3QWBA 3VHLB 7ABPA 3DGEC 3CUUA 1CJKC 1ZK1A 1AK9A 2EKPA 3ENWA 1E1DA 3KXLA 3BF7A 4U00A 1YJ8A 3CW9A 1TVCA 2KQUA 1LK0A 1U6IA 2ZTSA 1SIUA 3GEEA 2Q4RA 3GRKA 3SCZA 4WKPA 1E9CA 2JIMA 1LPOA 2UZ4A 4OXRA 2WZDA 1FSZA 2IHYA 4F92B 1REQB 5DTMA 1HA3A 3P9SA 2E82A 3TCNA 2D2EA 1Z33A 3DXZA 5AW7A 1I3NA 4U63A 1XF1A 3O2EA 2WHXA 1N0VC 1ENPA 5KO2A 4BUZA 4BCAA 4S12A 2QUKA 3N59A 3DAFA 1NWHA 4IHJF 4LY3A 1QFMA 3VMFA 1Z29A 3M2PA 2F3RA 2V7QA 3HB5X 1QO0A 1FP1D 4GPTA 4GT1A 4MLZA 3OX3A 3B5EA 4XZ3A 5BMOA 3L7BA 2G7MC 3MHPA 3CLVA 4KQKA 4XD7A 1K98A 2AHOA 1FCJA 1JSCA 2J6BA 1CE8B 3KJGA 3IUBA 2ZBVA 2QROA 1V3TA 1SU7A 1O9TA 5L3RA 4WADA 2NP6A 1TKAA 1EXDA 2JJYA 3Q7RA 3R0ZA 1I33A 4FHDA 3ZXUB 3LBFA 2Q9CA 2QG9A 2ZAOA 5IAGA 3BGIA 1CJVC 5BSTA 1G8SA 2AX3A 2ODTX 1D04A 2R00A 4QULA 5E4JA 5I7FA 3MCVA 3MELA 2Y6VA 2C5BA 3P9QA 4LFCC 2AFIE 4KDCA 2J85A 3LYLA 5LDDC 3N2KB 2F2TA 2HK9A 2FV8A 6ABPA 1JECA 2W0MA 1J7JA 1CBUA 2PXHA 1LLQA 2H2AA 2Z1DA 3BE4A 2FDXA 5ALPA 5E7MA 2OFOA 1X1BA 3A6KA 5AE2A 3FPEA 3GD5A 1UOPA 4GXNA 4KODA 4TL7A 3OQIA 1YMQA 3WNCA 1QQ5A 3K9HA 1UK9A 4IWYA 5C3UA 1M0EA 5KI6A 3KEQA 4M1KA 3K0HA 1I51A 2QZPA 1A71A 4FN5A 1IJBA 3FPGA 4XUDA 1Z4JA 4D0SA 2CXTA 3OWOA 1J2YA 4Z1MA 1XP5A 4I81A 4KXWA 3R9IA 4YRNA 3LRPA 4U6SA 2C2ZA 2YNMC 4CLOB 4DRXB 3UMYA 4KWHA 2KBEA 3UW1A 5A4DA 3EUEA 3PIRA 5TPZD 4W8HA 2Q2WA 4ON9A 4KBGA 1YSCA 2V6JA 4TTPA 3HCEA 3GLQA 5LM3A 4B09A 1GO2A 3WJAA 4EYOA 3D64A 3O93A 4C21A 3REQB 3S2SA 1YZTA 4KKXB 1WNFA 2GB4A 4D6PA 3ZDBA 3NBAA 3KSMA 1JH9A 4JOBA 2PZKA 1J2EA 3WLEA 3EOZA 4QBFA 4KRYA 1RWBA 5I9IA 2FRVA 1GSHA 1BJTA 1DEHA 2NSLA 3NBFA 4KIUA 5DB4A 5EJGA 4DUPA 5C8ZA 2ID4A 2HMTA 5CTJA 1Z4IA 4BFLA 4U4AA 2B25A 4BVLA 1UJCA 1G42A 2CMGA 2HU8A 1RY2A 3PJGA 2FPGB 4CKEA 1XCPA 3EPJA 3BQNB 4AN1A 3WOHA 1GVNB 1W5SA 5LZ5A 1V5FA 4I3GA 4NKRA 5JZOA 1CCWA 3BFXA 3MQ2A 5IBRA 1WBBA 1KKLA 1MOSA 3SC6A 4RA9A 5EJ8A 5K05A 3JQPA 1U8YA 2FP4B 3LRXA 4XWOA 4WOKA 1FDTA 1ZJZA 5CD1A 2FEMA 1T0IA 3NR2A 1Q12A 4KLRA 4KUGA 4Y6RA 3BTVA 3FMPB 3V8RA 4DG9A 1TCBA 4JI7B 3Q8KA 1WCIA 4L95C 5LMZA 2GM4A 3DKKA 3HVHA 5CFMA 2GZ3A 2IHJA 4ISBA 1N6RA 4TRJA 3T0FA 5K5EA 1N7GA 2HSJA 4PSKA 4F2DA 3ELWA 5AKXA 2WFLB 1Z4KA 3H4MA 4CN8A 5LP6A 2QXTA 1QGZA 1NURA 4MMXB 5GV8A 4EP1A 2QVLA 4L85A 1PJ8A 5A3JA 4HDOB 3EXEA 4UXIA 1CT9A 3PHHA 5AOBA 3BF8A 4MP6A 3K0FA 4YREA 4LVUA 3QPVA 1OLUB 1RM4A 2WHYA 2RJNA 3EZYA 1NAIA 4B32A 2IOFK 3ACDA 4OVKA 2Q99A 1BOFA 3IMGA 3C24A 2I7XA 1PK8A 3WHKA 3IHWA 5A71A 4YUXA 1R0WA 4WN3A 1VBMA 5I7RA 3LYAA 2TSYB 3T3MB 3R5SA 1P73A 2ZVJA 4P7FA 1TGVA 1DCTA 2A92A 3SEZA 2QSJA 3EIOA 3SVTA 1JDVA 3D2CA 4YV2A 3ROGA 3PFGA 3WQQA 3JQEA 4B3GA 1BHSA 1YB2A 2VCEA 1HORA 1N3YA 1N6PA 1Y3BE 4HX2A 1V25A 5K09A 2CT8A 4GDFA 1VRVA 1DMSA 3EISA 4I1RA 3CZQA 1QPBA 2E5LC 2XWQA 2ZBEA 3B1XA 3HNRA 3OIYA 4G5OA 4X3CA 4M0PA 4MWDA 1C1XB 5LCIA 1IAQA 2ATEA 3GRZA 4WK6A 4PLHA 2ZIGA 3S5JA 1UQUA 1W5TA 1XKLA 3CRVA 4ZWNA 5J2UA 2Q50A 1BMTA 5CXUA 4O8ZA 3JQAD 3VOBA 1FMLA 3TCKA 1UDCA 5TPZA 1Q0LA 4KXFB 1VHLA 2R5WA 5IJ0B 2QYOA 4RJ2A 2CF5A 3EODA 3WWZA 3N7UA 4R1QA 2O2HA 5I9LA 3N0VA 4OQMA 4YRJA 1S1CA 3DKVA 4URWR 3VYVA 1KAMA 2PSSA 3IX7A 3P4YA 3DOOA 4B75A 1VI6A 1VJ0A 2QD4A 3P20A 4ZD6A 3HMQA 2E9SA 4RKEA 4CIXA 4ZYYA 2CFRA 2BHSA 1N9GA 2ZSEA 4X93A 5K2MA 1QCYA 1RI3A 3ZH2A 3VH4A 1TC2A 4P5EA 3QBEA 4Q3LA 3I37X 3QA9A 1K0RA 4WKBA 1A8HA 4LCJA 2H4JA 3L1UA 4CL3A 2G9NA 1SKUA 4JEMA 5AOAA 2MSEB 1C9JA 2I1LA 3MOIA 4DLVA 1NW4A 2VBCA 3IEPA 3QH4A 4K6MA 3NC4A 3W6OA 2QJRA 2CWWA 1XCOA 3K1JA 1M7GA 3L7JA 3R0VA 2B83A 3FNBA 1WP4A 2H8KA 1NFQA 1BNCA 3LNTA 4FBGA 4IW3B 3AVYA 3ID6C 2Z51A 1JR3A 2WU1A 1Q20A 3Q3JB 4ND6A 3SXPA 3VVBA 4DLLA 2QR2A 1J33A 1OXMA 3LLCA 1QAQA 2BEVA 2X0KA 1SAYA 1W0KD 2FKNA 3IJEB 5CFQA 1J56A 1UQRA 3A3OA 4JIMA 4L5CA 4NEHB 4E11A 1FQOA 2PSDA 4ZGBA 1ICEA 2VIIA 1IG3A 4ZVSA 2IIBA 5AKEA 2D2VA 4I2NA 1JJVA 2PKQO 4R1TA 3K92A 3BCRA 1YHZA 4BQNA 1KI6A 4R7GA 5EY5B 4DQKA 5CTAA 4L72A 2J3DA 3KAJA 4FGJA 3O4JA 3B5IA 3ZCQA 1BAPA 4QICA 1IOZA 1G7RA 1QNFA 1WE2A 1DIAA 2I4RA 2ZBGA 4M1WA 4OP2A 4XVRA 4RVFA 5EI5A 1HR0B 1PJCA 2P27A 3K5IA 5D86A 6Q21A 2CD9A 2EVWX 4B74A 1PJ2A 4EFNA 3T9BA 5H70A 1KOJA 3CNHA 4JXXA 4P93A 4KSBA 4UKDA 3W6PA 1O6CA 1GN8A 1QGDA 3VSCA 1QJCA 3WZ2A 4QG3A 3EEOA 1ISHA 2XHEA 3HU2A 4CQMD 3H87A 4RGYA 2WAXA 2AJTA 2IPXA 1JG2A 1V8BA 3NVDA 4MX8A 1QQAA 4RHCA 1DC4A 4PZCA 1SZCA 1Q7CA 4FGUA 1GPYA 2DF8A 2YXLA 5IXJA 3OQIB 1VKHA 1I7NA 5EXTA 3UJAA 2GZ2A 3R5HA 4PS0A 3VPGA 3KYJB 2HRZA 3EDRA 3ZXIA 4PWYA 1GGJA 5CVVA 4TPKA 4PRKA 2Q9AA 2VG8A 4UTVA 1RAEA 3UJCA 4GS5A 1U6JA 4BQIA 5JCJD 5IBPA 5C51B 4RXMA 1E1CA 3IP7A 3W2IA 1SBZA 2MR5A 4KLCA 2QVCA 4TL9A 3VR4H 4WZZA 2F4NA 2JFHA 4K81B 3V97A 2V1UA 4WCDA 1CY0A 4N8SA 4N5DA 3BQ9A 4PSVA 4NMHA 4YA6A 4KWTA 1G3IA 2C1EA 4GL4A 3JQ9C 4DKXA 3W3AA 2JJ8A 2UYCA 5LNK1 4XFKA 3FBWA 3SMVA 5KWIA 2DG2A 4RSMA 5KQMA 6REQA 3NIBA 2RHOA 2J4CA 2ZYSA 4CKEB 3B1FA 4ES6A 1XCGB 3QKIA 1T4MA 4Q4LA 5HW0A 9LDBA 4F56A 5FV4A 1QFSA 4WGGA 1M2KA 1V0JA 3EARA 2ZSFA 4MWTA 3NGXA 3BXGA 4JI0B 3JYOA 3Q2OA 4RABA 2GCNA 4RA9B 3UANA 3HK2A 2JIPA 4D0LB 1WX1A 2Q0SA 2YWXA 1BZYA 1U8EA 2ZUDA 3OICA 4I46A 3WGNA 4Q6BA 1P4EA 4V0RA 2X0FA 1THMA 5SYMA 1WCIB 4BJ5A 2ODNA 1PJQA 4PUHA 2PMWB 3C5EA 4Q4AA 4A3SA 1HYQA 4A27A 5C52B 3LOUA 4HWTA 5EXEA 3WL8A 1RMYA 2ZI9A 4EQZA 4FYWA 2II6A 1A97A 1FU4A 4H17A 5LP6B 4QKQA 2AT1A 1NQUA 3C5HA 1V95A 1Z8DA 2WAOA 4KXLA 4RE5A 3SJBA 4CODB 3EXEB 2PH5A 2ZIUB 4Z53A 5AH0A 2EWVA 4OLHA 1TM5E 1ZZGA 3B85A 3K0FB 2V7EA 2HU2A 3E9MA 1E3TA 3GLKA 3FVTA 1OYVA 3AC0A 5ITZA 2A5DA 1Q17A 1H85A 3Q9SA 3EJ6A 5H9UA 1L5ZA 2MMCA 3BCSA 3IQWA 3TFQA 1B26A 3SZLA 5KPJA 2ZCJA 2P2CA 4KX5A 4P0TA 2YXBA 4L9SA 4QRHA 1N8NA 1XAGA 4L5BA 2OKCA 4CV1A 5FJIA 1Q3HA 1DCFA 1W4LA 1ZDMA 4B3TC 3C7CB 1JXAA 2PA3A 7ADHA 1H2EA 3WGZA 3O1HB 2CL6X 1H4SA 2OHXA 4TRNA 3UO8B 2GN9A 2JLZA 5CEEA 5JNUA 2BJHA 3TZ6A 1G291 3C8ZA 3AJDA 2VYFA 3ETOA 4MULA 2I3GA 1XKQA 1RFGE 4GPD1 3FKJA 3K5HA 2XHZA 4QDXA 3D3QA 1F14A 3ROMA 4FR0A 5HJEA 1K0UA 1UKCA 4RACA 1FFYA 2IEDA 1R0BA 1HT2E 2BFOA 3D43A 4JROA 1A76A 3WGJA 3Q7PA 1U2RA 4UHCA 5J2UB 2NO4A 3MGGA 3RVSA 3ZDRA 3NTOA 1A69A 1E2IA 1R8SA 4YLGA 1H9CA 3UXHA 2XCOA 2PJRA 2YJGA 1EX7A 2BONA 2ZAYA 2F4VC 3TLAA 3HFJA 4BMPB 5IWAB 3HI6A 3Q40A 1NMZA 3QPUA 4MVWA 3TYXA 1XCBA 1QWOA 1N5DA 3WGUA 2C2BA 4JD5A 1N9GB 3ILVA 2FI1A 3QPDA 2VDNB 4QOGA 1PR4A 1SPXA 3CR3C 4HEA1 5HNKA 2JG3A 3JQGA 3CONA 4GW3A 5C81A 1BHQ1 3F5SA 3AHIA 5EZ6B 1WMFA 4LBVA 2YXEA 3TQIA 4D25A 2AFHA 4MUMA 3VPFA 5KVCA 2IL1A 3BRWD 4K86A 1KDTA 4OB8A 3ZY4A 2P4EA 1AGNA 3AEUA 9GPBA 3RUDA 5J58A 3T7EA 3PXGA 5B37A 3IEIA 2XNHA 4HI0E 2XT6A 1J1ZA 3QKTA 2BEVB 4QTZA 1G7CA 1JEAA 1LI4A 3LY5A 3V4SA 2D5CA 3VPSA 1P17A 1PS9A 1F2VA 3OM9A 1C7RA 3OSZA 3WLMA 3ZPXA 1URPA 5A1IA 1ZIPA 2RH4A 3IKMB 1ZIXA 3PUIA 1U81A 4JUCA 4UM7A 4EFKA 3WDSA 1EUQA 1E9EA 3IQHX 4H6XA 4TRMA 2B30A 1WUYA 3TAUA 3VKUA 1DEKA 1KI6B