4DCVA

Crystal structure of b. subtilis enga in complex with gmppcp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
434
structure length
402
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 130
structure length 402
sequence length 434
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcvA01
1DS6A 3RC8A 2ONFA 1JQJC 1WCV1 2AXPA 3SE0A 2QMHA 4XIGS 2CDNA 4RZXA 3TQCA 2ORVA 4QL3A 1CR2A 5K8UA 2YC2C 4A2WA 5JI3E 2DFLA 2B8WA 5FOXA 5IT9D 3WBJA 3DZ8A 4PAQA 4U7DA 2AFHE 2NZJA 4JI0C 4NONA 4CF7A 5HTKA 3ADKA 1Q1QA 3GJ8A 1KI4A 1U98A 2ZE7A 3T15A 3IILA 3KJIA 1GRNA 2ZR9A 4JI4C 2OUKA 2R2AA 4X8LA 1AS0A 4DIEA 5K8TA 3GLGA 1T3LA 3DHWC 3AGQA 2E7GA 1XPRA 1KDRA 1XMOC 2QG6A 2ORWA 4YXWA 1YRBA 1HEIA 4JLBA 4XWAA 4TYYA 1N2CE 1XTRA 2AN9A 2JAQA 3OZXA 3SYLA 1LS6A 1HH2P 1WB9A 3O8DA 4GZLA 1T9HA 4OQLA 1RFLA 1E9BA 1Z6GA 1NIJA 4FMBB 4A8JC 4BZPA 4NHOA 4ZCMA 1XTQA 3MD0A 3Q85A 2IYXA 4HAVA 2ZRBA 5EQTA 2X8AA 3SBDA 1FPMA 1IQPA 2JLUA 2OSBA 4B2LA 1ML8A 3E1SA 4TZ6A 3REFA 3C8UA 2GXQA 3CZQA 1FP6A 3IO3A 3NBYC 3NC0C 4Q4HA 3E2IA 3E5HA 4Q4AB 2Q9AA 2XNDD 3UWOA 3EX7C 1UKVY 5CK5A 1ONBA 1JPJA 4A0FA 5BWMA 4EUNA 2CHVA 4DR2C 2OFXA 3TGPA 2C04A 4QM7A 3PITA 2QPAA 2FSFA 1ZW6A 2QAGA 4NYJR 1MH1A 1NG1A 4D0NA 2R6FA 1S1MA 2W0SA 2QTVB 2PMKA 5SZIA 1ETUA 1UKKA 1NVWQ 4G0NA 4Q66C 1UM8A 4DEXA 2V55B 1I2MA 3LLUA 4QOSA 2R6DA 2HCBA 3B1XA 3K9HA 5B64A 4M1OA 1U8YA 3K1JA 3EARA 1Y3AA 3CR7A 1KJWA 3HPQA 5A4JA 2ZRFA 1UBGA 2WWHA 2WMOB 4LGMA 3QPUA 4D81A 4AG5A 3UPUA 4OQMA 4JI8C 1U0LA 4MITA 5EE0A 5AUPB 1Z8FA 4BGDA 4DZZA 3U3KA 8OHMA 4Q02A 1ZM4A 3B2EA 5JEEA 1IN6A 4TQUS 3BBPA 3ZVMA 3ASYA 4XJXA 5BN4A 1KO8A 3FB4A 4M1YA 4XD7A 4YMWA 1P6XA 4OHXA 4PQRA 1KY3A 2IHYA 4KHPC 1G3RA 3QXCA 4A15A 1BO6A 2JDID 2E8CA 4JL6A 2FFBA 5JI2E 4D4KA 2IX3A 4R9UC 4XVRA 3ZD6A 1M7BA 2VP5A 1RJ9A 4TLDA 3C14C 5JS8A 4MYTA 1XX6A 2J59A 2ZS8A 3BH7A 3HJNA 2CL7X 3OF5A 1IJEA 1J5EC 2XJ4A 5TY0A 1RJ9B 1NY6A 2QRZA 3CF0A 2RAPA 1XD9A 2LKCA 1O3YA 2ORIA 3CNNA 4GOXA 4JLNA 3C5CA 4KHZA 4B3SC 4DV4C 3NVAA 2ZYTX 4EAQA 1YR6A 4B3XA 2O8CB 4JI7C 2I4IA 3C4JA 3UG6A 3N2IA 2ZUCA 4Q48A 3AVWA 2LCFA 1II0A 2PZFA 2HUPA 3QVVA 3U3OA 4AIIA 1US8B 2N42A 3MWYW 4AI6A 1D9XA 1FX0A 3ICEA 5DYIA 1K5GA 3GJXC 3QEJA 3EERA 3UG7A 4ITRC 4MH0R 5TMPA 1VG1A 3TUZC 3QF7A 2JLXA 1M2OB 1AJEA 4OJQA 2GEDA 2ZJ5A 5BQ5A 3ZDQA 5CLQA 2QENA 1OJLA 4UNPA 1VDZA 3G5UA 4LDJA 1IXSB 3TUJC 3SHFA 5EJEA 1AGPA 2UXDC 3TH5A 2GCOB 421PA 1COWD 2F1JA 3CNOA 2WV9A 3TW8B 4CEHA 1OPXA 1OXSC 4LFCC 1FFHA 4PXAA 4BLQA 5CB8A 1TX4B 4HLQB 3KQLA 2GETA 4LPKA 1QHGA 4KITB 2FPMA 3LX5A 4PAMA 1FTNA 2FGKA 3R8CA 2XSZA 3BB4A 5JWHA 1BOFA 1N0VC 2GEVA 4Q19A 3OAAD 5DLQC 4Z54A 3IBYA 4DV3C 4LFAC 3KFXA 4JT4A 1TF2A 2OXCA 2FEOA 3DPUA 1W5SA 1K0RA 3NXSA 3B60A 4BECA 1Z3IX 2CEAA 2FZLA 4FCWA 1HTWA 4UXHA 5J40A 4EKDA 1XTIA 1TTTA 1G6HA 1WP9A 4Q21A 2VA8A 2YVUA 4IHQA 4MDFA 4Z8XA 1XMSA 3DEFA 3BOSA 1G7RA 1E1QA 2QT0A 3NBXX 2ZRKA 4M9SA 1H8HA 1KDOA 1W48A 1XP8A 1PJRA 1E32A 2GF0A 2WKRA 2ZROA 2DPXA 5AUNB 3L43A 1Y63A 3ZZTA 4ZDKA 1QHSA 4DB2A 2NO6A 1PVOA 2QL6A 2YJTD 4FCVA 4TMKA 4TMXA 4DKXA 2OE2A 1FMJA 3H86A 4A8JA 2V54A 4B76A 1E6CA 4GBMA 2QP9X 4DLRA 2CY1A 3OAAA 2B21A 5CLLA 3ND8A 2EU8A 1OFTA 3AM1A 1SVKA 4BZQA 1E2QA 2X19A 4F7WA 4ACBA 2VL7A 2GJ9A 3ETLA 3OFNA 1V43A 2O8BB 3DZDA 2H17A 3RABA 2PMDA 4M9QA 3GJ5A 2J7PD 2JEOA 5EUQB 5FPYA 3THXA 1CRPA 3CF2A 1FL9A 2ZAMA 1LF0A 2W6IA 3FKSA 4KFTA 5C1BA 4OYHA 2KI5A 3P27A 4JLPA 5J4HA 4LCBA 4NU0A 4B6EA 3QEOA 2IYVA 4KSBA 2Z43A 1II8A 2DBYA 2WSSD 3LD9A 2J5XA 3DM9B 3Q7PA 4WOPA 1ZIPA 1KNXA 1ESMA 4TT3A 1G16A 3ZVRA 3NBZC 2EFCB 2Z83A 4AC9A 2GJAA 4Q1CA 4KBFA 1OXXK 1P4SA 2YWHA 5SZKB 4DCUA 5FFMA 4RD2A 1YQTA 3GLIB 2WIBA 2BJWA 3EPKA 1GZSA 4ZI3A 2OT3B 1IXZA 4AKGA 4PPGA 1SXJE 3DMNA 1GTVA 5EXSA 5H8WA 3GQBA 3MWKA 3A1VA 2HLDD 3VTKA 2F1IA 2WM9B 3BIFA 3PUXA 1X1SA 3FMOB 3GD7A 3ZS9A 4B33A 3EZ9A 2HJVA 1C9KA 1O87A 2WWGA 4IKEA 621PA 5IK2D 3U7HB 4A92A 3PUVA 2DYKA 1CBUA 1KKMA 4DLWA 3FGNA 1NSFA 4HAUA 4URZR 4XOIA 5AUOB 2VBCA 2VO1A 1KSHA 1JALA 1U2RA 2ODEA 3QIAA 3WY9A 1OFUX 3BJIC 2WAXA 3QXJA 1XDBA 1H8EA 4X8MA 5KSPA 2ONJA 3DOFA 2J9RA 2QORA 3FDIA 4MKIA 1JJVA 3IPXA 4DHEA 1E0AA 4X64C 1HH4A 2XZPA 1XTKA 3L82B 5TB5A 5E7MA 4DUGA 3AVXA 1G3QA 2Q0HA 1QF9A 4RD3A 2A2ZA 2H57A 2ZSBA 1E2MA 3L0IB 5FBRB 3WYGA 4DCNA 4IW3B 1GRRA 2G83A 3ZVNA 4ACAA 3AUYA 2GEUA 2JJ2A 3D6TB 3S1AB 1Q1BA 4DR7C 1M7HA 1P9NA 2UKDA 4LHXA 1XD2B 1KO5A 4FMDB 4HB3A 3QG5A 2AKAB 1E79D 4D2IA 3FMPB 1UPTA 3KKQA 4AYTA 2QMEA 4TQ9A 4OI1A 3RC3A 1Z28A 4X62C 2QM8A 4M22A 5H70A 1P5ZB 4MGZR 3H0KA 4DV1C 3CBQA 2NIPA 3CX6A 1X6VA 3GLFA 4YY3C 3IIJA 4OI4A 4PHFA 1DAIA 5TVKA 2IYYA 4MRNA 1A7JA 1S0UA 3UIEA 121PA 2VEDA 1G4UR 1NMZA 1TQDA 5D3MB 4LYHA 1GM5A 2EYUA 1DTSA 4M8NE 3GFTA 1OV4A 1R10A 4OHWA 4MYUA 2BM0A 1ZVQA 4QFMA 4E09A 1NMYA 1RW4A 2A78A 1I94C 2VHJA 1DELA 3O47A 3N70A 4CEJB 1IBLC 1DVRA 3B78A 1X8JA 1OLOA 3CIOA 2EFHB 1E2PA 3AKDA 5UKDA 2P65A 4OQXA 2H18A 2UU9C 1AM4D 3SYNA 1UDXA 3SJAA 1HY3A 3M0EA 2JCSA 4BFVA 4RKEA 4DT1A 4QKQA 3KL4A 2IWRA 4NKRA 3SQXA 2IF0A 1E0KA 4JLKA 1J8MF 4MA4A 1JAIA 1UBCA 3CM0A 1CP2A 5BW8A 5CM8B 3DVLA 5G3ZA 5L3RA 4AKEA 3T61A 5EE1A 2UZIR 1N6PA 1SKYB 1GL7A 1QHHB 3GFOA 4XVQA 4HZUB 2GRJA 4A6PA 3AF6A 2F55A 1RVDA 2QL8A 3T1YC 1KY2A 3AP2A 4AD8A 3W34A 1E9DA 4TWZA 3K0EA 5P21A 1N5LA 1NF3A 2CNWA 3GFPA 4ASUD 4ZV4A 1XCPA 5AUQA 3PUZA 4M1KA 4BLRA 3AF5A 2FFQA 4HAXA 4URXR 3CUEF 4NPHA 4EFLA 2PLFA 2O52A 4TLBA 2IW3A 2H8KA 3WNCA 4B3TC 2JJ2D 3L0SA 2Q9CA 4OHZA 5IHPA 2C99A 1XRJA 4C0KA 5E7JA 2F1HA 2QP4A 1R6BX 4WIAA 1Z22A 3RWMB 4M2LA 4M1SA 1SULA 2OBNA 3MJRA 5DO9A 4U00A 2GKSA 3K0CA 2PZGA 4TT3D 4V0MA 2RGCA 4C7OA 2BV3A 3VR5A 1PZNA 2HDNB 3C16C 4HUTA 1W44A 2FDCA 1N0WA 5L3QA 1Z06A 2IYSA 5K8LA 2CJWB 1F6BA 1DAGA 2WOJA 2JLZA 5JSZA 3FKSD 2QY9A 2W6ID 2E87A 3PCRB 1W36C 4YMVA 1ELOA 4LK2A 2VH5R 4DLVA 1IBMC 1WA5A 4LJYA 4UNNA 1G8GA 2IUSA 2YWFA 2DFKB 4H1UA 4Q1DA 1TAGA 1E69A 4I1SA 4LHZA 2EW1A 4XWOA 3RS2A 2C8VA 3P4YA 4B3GA 4TZ0A 1EFTA 1UKZA 2NO9A 1DARA 2ZRJA 4NBSA 3R9IA 4IVPA 4B3RC 2VIIA 3B1ZA 4C0BA 4US0R 4GRAA 3W9YA 3WRXC 2BMDA 4DSOA 3GJ3A 1AS2A 3I4LA 2FF7A 2DR3A 2CL0X 2GVZC 1QHIA 2BMJA 5LBIA 2PX3A 3SS8A 1XF9A 3ZVLA 4BLPA 1DAFA 2QP3A 3AF2A 1WQ1R 4JVMA 5JECA 4GKJC 3H2YA 5DN6D 2H7VA 1R0XA 3FHCB 2O0KA 2NG1A 3P32A 1N6HA 2Z4RA 1OXTA 221PA 4GL2A 4JZKA 3TIFA 1KSJA 2WVJA 1SXJC 4PSVA 4DRZA 3AVQA 4HZUA 3O8CA 1N6RA 4PC7A 1AZTA 4JBWA 1BYIA 2KWIA 1XZPA 1BMFD 4O2LA 4H9GA 4G01B 4AWXA 1VCIA 4XD7D 2JLVA 2NTYC 2F7SA 2NGRA 4QHYA 2WKQA 5JHGB 3NHBA 1CF4A 4NDZA 4NYIR 1CIPA 2KBFA 2W2XA 4FCTA 3AP1A 4IFEA 4YMSA 4C0AC 2EFEB 1TF5A 2GILA 3AF1A 5L8VA 3RANA 1OT3A 4J0QA 3CZPA 1W0KD 3PENA 4B47A 4LFBC 3PG5A 1IONA 1OXVA 2E8FA 1K8RA 1ZYUA 2WJVA 5D3MA 3R20A 2HT6A 2QPOA 4NP6A 2REOA 5CIWA 4M1TA 2IS4A 4PC6A 4L16A 1YJ5A 2QSYA 1L4UA 3QBTA 4K81B 2XX3A 3FWYA 1MO6A 1Z2CA 4TMWA 1FJGC 2JIZA 4Q18A 4V0ME 5L3SA 4IOLA 2FPKA 1UAAA 1E2EA 2ZRDA 4OJKA 1T3HA 4JL5A 4IRUB 4RZ2A 4ARZB 4B3FX 4KODA 1W5TA 3EA0A 5KSYA 2FFHA 2V6IA 3S1AA 2P6NA 5E95A 2ZI9A 2XSZD 2YYZA 4KLZA 1S3GA 1QHYA 2RGNC 1EXMA 3QPVA 821PA 3IQXA 4EIWA 1XTJA 1QVRA 1JR3E 3JZAA 4HDQB 1CR1A 1XJQA 2WHXA 2GZHA 2YWGA 2EVWX 2WJHA 2QPTA 4OHVA 1XEWY 3KFVA 1LB1B 1Q3TA 3OIWA 4C30A 4DLYA 4IDPA 4C4PA 4JI1C 3H4MA 2Q21A 4OQNA 4UJ3A 2PX0A 2ATXA 1ESNA 1JQLB 3BB1A 2A3RA 1T0JB 3PFIA 3ZD7A 1D6JA 2HCJB 3WYAA 4C2TA 3EIEA 1BMFA 2FOLA 2X77A 3EG5A 4HUQB 3RS5A 4CEIA 1UKYA 4MUAA 3HYRA 1G64A 1AS3A 1MRSA 2VHTA 4RZ3A 5A0FA 3THWA 3NDBB 3AGPA 4KO8A 2IS2A 3GMTA 4AURA 2FA9A 3U7GA 4BZXA 4K0KC 2C5LA 3CJEA 1QG4A 5KDOA 4DIDA 2YV5A 3VR4A 1R0ZA 1QHHA 2ERXA 2ZRLA 1U81A 2WIAA 1A5TA 3HU2A 4V0OA 4MH4A 4DC9A 4EPVA 4ZIRB 4GI7A 3I61A 3DMDA 3IKJA 4JBYA 3ZZ0A 4D80A 1XZQA 1XNJA 3QKRA 5HE9A 3C5HA 2R65A 4H1VA 1JR3A 1N6LA 2QA5A 2IWHA 3KQUA 3SI7A 1IY1A 1NKSA 1TEXA 3RAPR 5J5CA 4TMVA 3ZLJA 2CVHA 1M34E 4KYIB 3LV8A 4PFSA 4W5JA 5EXXA 1U8ZA 1GNPA 4GOKA 4UXJA 2P3SA 2CJWA 2QROA 3PUWA 1W36B 5BXQC 5DI3A 1XEXA 4TYNA 1T0HB 1KI8A 4ARZA 2G1KA 1CJTC 1GKYA 4PQFA 1PLLA 2QMUA 2IYLD 3NH6A 2WBLC 4RD4A 3B9QA 4Q4AA 2XTNA 4FWIB 3FMFA 1GIAA 1N33C 3QQ5A 1E2HA 4Q9HA 3K70C 1G8FA 1ZD9A 4JSYA 2G9NA 4GDFA 2BBWA 1E9EA 3WNDA 1U8AA 3EA5A 3BC1A 1TQ4A 4RFSB 1Q1EA 3CH5A 2ASBA 1KO4A 4M53A 4QGGA 4PSKA 1KTVA 1U0JA 3QY0A 5DH9A 3KDSE 5IRCD 2RGAA 5AR1A 5F3WB 1UEIA 1G5RA 3R9WA 2ZEJA 3GKUA 1K5DA 1KI2A 2ZE6A 3VR1A 4YC7A 1J70A 4NYMQ 2OHFA 4DLTA 2GA8A 3K0FA 2RMKA 3I5XA 4MGKR 3B82A 2J46A 3Q3JB 3NHAA 1AQUA 1QRAA 4TSFD 4FXPA 3K0SA 5J47A 1U9IA 1KJYA 1XWIA 3K09C 5D3QA 2BCJQ 2W2VA 4PZYA 1UBFA 2KZFA 1IXRC 2CL6X 2D06A 2FMXA 4C0QC 4GPTA 3Q8XB 4I4LA 3LXRA 4KFRA 3UMSA 3ICQB 3NDPA 1Z07A 4ASUA 2C78A 3BE4A 1SKYE 4I1OA 2AXNA 3AB3A 4YONB 1KI9A 2ZRCA 5EZ6B 3QXXA 4CGZA 1EGAA 4CIDA 1FNMA 3VKHA 3LRPA 2HEIA 4JBXA 4JV5C 3OEHA 1AA9A 5KPDA 4NYMR 2VPPA 2WZQA 4E07A 1PUJA 1MO4A 3OESA 2Z5FA 1NIPA 2BJVA 1G9XA 1S9HA 4D82A 1JBKA 2OM2A 1IN4A 1TU4A 3A58B 1TU3A 2GXUA 2RGNA 4D4JA 4D26A 3K70D 4HAZA 4DR4C 2N1BA 4NYIQ 5KUTA 4KSCA 1HT2E 4TTPA 1NLZA 2OILA 4IJMA 5KU1A 2WPDD 2YZ2A 4LJ6A 3I5YA 2ANCA 4AK9A 4WAUA 1ZNZA 4NXMC 3H84A 4AKHA 1IN5A 1KIMA 3UATA 1SVOA 1VCOA 5JZVA 4DLZA 3RRZA 5KSOA 2PT5A 3EZ7A 2XZOA 4LBVA 1ZD8A 5KNDA 2MMGA 4LSGA 4HYYA 4P4TA 1S3SA 2QBYB 1QHXA 2W58A 3GLHE 3RS3A 2DWQA 4QG7A 3FOZA 1M8PA 4PO9A 4W7SA 1KJZA 2RB4A 5FL7A 4G5SA 3RS0A 4LBWA 3X1WA 2OESA 3TNFA 4P4SA 4ZCLA 4E03A 1SXJB 1MO5A 2FH5B 4URUR 1NLFA 4I81A 2R44A 5G40A 2ZUDA 3T06B 2V4ZA 4EQ6A 1HA3A 3PV0A 3GLIE 2J0UA 5JEDA 5TDHA 4IOMA 2IK8A 1L4YA 1KSGA 1JOSA 4DUYC 3I62A 2FPLA 2WSMA 5CM9C 3L8ZA 3LLMA 1P2UA 2NO1A 1RE0A 1CLUA 3CRVA 2WJGA 1W49A 1CJVC 1Q21A 3WP1B 4FWTA 1PV4A 2ZXUA 3IDQA 4A4DA 1GILA 4MDEA 3DKPA 4C2UA 4TL6A 3QI2A 1GOTA 2BDTA 3VQTA 1RYFA 3LQQA 5FTMA 1T8TA 1XEFA 4EDHA 4Q1EA 4Z51A 1P72A 4IDOA 2GK6A 5HPYB 5GADl 1T3SA 1KKGA 5L3SB 1N5JA 1R5NA 3EW9A 4IEIA 4LV6A 4LYAA 1HT1E 4RKFA 3V4RA 1N36C 3I8XA 3Q7QA 5SZHB 5KDLA 3AH8A 1A1VA 1KI1A 2VHQA 3I1FA 3KZ1E 4LWZA 1RPZA 2PEZA 1KO1A 3IEUA 1OB2A 4QHTA 4BQSA 1RKBA 1SVIA 4IOJA 1VCMA 5J4YA 2JLYA 4DLUA 1NLYA 2PEYA 4HEJA 1T8UA 2CLCX 5IK2A 4JI3C 4DBLC 3WMEA 2J7PA 3GLGE 3K9LA 1JXOA 1YR7A 3OHMA 1GKUB 4EJSC 3PEYA 3LBIA 4WZ6A 4D0LB 4BLOA 2P6RA 1XEWX 4RVCA 3ZJYA 2AD5A 2O8CA 1CS4C 3EPHA 1E0SA 1G21E 2BMEA 4UNQA 1QDEA 5GJWC 2F3TA 1HR0C 4RJLA 4ZPXA 3TK1A 4TSFA 2JLRA 2VHUA 1YE8A 2ECKA 3ADCA 2RGEA 4LJ4A 1VCNA 2FGJA 2ATWA 3KKNA 1J8YF 1UFQA 2D3WA 2ZTSA 3EZ6A 3SEAA 5TXGA 1DADA 3QBVA 4UXIA 2AWNA 2B8TA 4FIDA 2IHBA 1XTSA 4GZMA 3GLHA 3KX2A 3GPLA 1MABA 4LBYA 2DYJA 1UDWA 1OH8A 3IIMA 2BHRA 2ERYA 2MSEB 1U9IC 1OIVA 1F60A 1FUKA 1S2MA 2HF8A 2OAQ1 3K09A 2GAAA 4XSHA 4CW7A 3NEJA 1XFAA 4PZZA 1DBSA 5DYGA 4FW9A 3RVBA 1LQLA 5LB4A 3B13B 2UZ3A 1KOFA 3QXSA 2J41A 4DUGD 1ZM7A 3BH0A 2OPLA 2YHSA 4OK6A 2OO7A 2ZJBA 2P2LA 2G6BA 3JAMD 1L2FA 2ZSEA 2J0UB 2CXXA 3QF4B 4PSAA 5F2EA 1RRPA 3SOPA 2ZREA 4LJ8A 4BEBA 2JLWA 1GFIA 2MMCA 2AK2A 2IYTA 2VF8A 5BN3A 2IUTA 4DDUA 3PVSA 4LHVA 1M6NA 4UNSA 1CJUC 2D2EA 5DI3B 2C9OA 2F43A 4GOJA 5FOSA 2R6GA 1GAJA 2ZQ5A 5JS7A 5KTYA 3U4QB 1VG8A 3SJBA 4URWR 1G18A 4NYJQ 5JRJA 5JMTA 3R8FA 2XOKD 2GCPA 1WRBA 1A2KC 1YZTA 3U61B 3QKRB 5AJZA 1LW7A 3B1YA 2ANBA 4Q9KA 3VNVA 3CNLA 1OKKD 1PLKA 1P3JA 1KI7A 1KKLA 3EWSA 3EIQA 1XU4A 3IHWA 1T6NA 4IDQA 4ESHA 2PT7A 4KCGA 1EFRD 2W0MA 2BC9A 3EC1A 3OEED 1W1WA 2BVNA 2FFAA 1Q12A 2OBLA 4TMZA 1RIFA 2BKUA 3LA6A 1VLAA 4FD2A 3TSZA 2WWWA 4Q5IA 3BFKA 1OIWA 4MUBA 3K9NA 5L3QB 4HB2A 4CT4B 1SVWA 2C98A 3TAUA 4DSNA 4LHWA 5DIFA 2HHHC 1IJFA 1N25A 3QSYA 2O8BA 4Q4HB 5H68A 4YQFA 2OAP1 1TQ2A 1LFDB 3Q5EA 4K46A 5FUVA 1OYYA 1YU9A 3WP0A 3ZGXA 1YR8A 2WKPA 2B92A 2QRNA 2IS6A 1W4CA 4Z8YA 1E2FA 1USPA 1FMLA 1W2HA 2AFIE 2Q3MA 4B2PA 2E8EA 1FX0B 3P20A 2JDIA 4TTQA 5CK4A 1ZBDA 1JAHA 2VP6A 5CDFA 2B6HA 1RRCA 3W8RA 1IN7A 4RSGA 4OL0A 2ZJ2A 3FE2A 4OK5A 5K8IA 2WWYA 4NTZA 5G3YA 2ASEA 3THXB 2GZDA 2YNMA 4GMDA 4O0MA 1MT0A 4BRUA 1S8FA 1E2JA 4MGYR 1GVNB 2W83A 5L3VA 4PO8A 4KBGA 3QJYA 3EC2A 5AJWA 2EFDB 4HUQA 1GRQA 3W6OA 3PEUA 721PA 3AKYA 2A5DA 3VX4A 3PEWA 5F9FA 4HDOB 2C9CA 1ZCBA 2DWOA 4LV5B 5JCZA 1EWRA 3KTAA 2VTKA 4QBGB 1HE1C 3DOEA 4DV0C 3A4NA 2MSDB 2VP2A 4JS0A 4KFSA 3SDZA 3TBKA 1RRFA 1OH5A 1S9DA 3X1XA 2ZYVX 3IBGA 3EASA 4KVAA 4R2HA 2OPLB 1N5IA 4TN1A 1DOAA 1GDDA 1CJKC 1YZNA 2H5EA 1NN3A 2JIZD 4B34A 3FHTA 2C96A 1FQKA 2QU8A 4AY2A 1EESA 3D31A 1ANKA 4G5RA 1UBEA 4KV9A 2H92A 1G1MA 2W00A 2CXCA 1W4BA 4I1VA 2BWJA 2OFOA 2GVDC 1YHNA 2HXYA 1JXMA 3GJ4A 2V9PA 4LJ9A 2XXAB 1KDPA 3FFBA 2D4HA 1XJ0A 4IVRA 2VF7A 1LNZA 3WNBA 2VQFC 1DAHA 5GJBA 1II8B 1Q1ZA 3HU3A 5AJYA 4PAOA 4Q03A 4A0HA 5HZKA 2D62A 1G3IA 1MO3A 4JYAC 3X2SA 4WA7A 4BLSA 3KQKA 1NVVR 3QKSA 3GLFE 4FN5A 2DB3A 1SVLA 3OEEA 3FTQA 4WXPA 5HR5A 4ZDWA 2ZVQX 3V4FA 5FBLB 3CKLA 1QBKC 3VAAA 1A4RA 2CCGA 2OV2A 4DDWA 3SN6A 1JPNA 2CK3A 1QZXA 2PCJA 3SU8A 3T1VA 4B3MC 4F4JA 4LY6A 1JJ7A 5HKKD 1XD2A 3PQCA 4F91B 2XEXA 5KOYA 4W5WA 1E2NA 3WYFA 1FP7A 1W4RA 1WF3A 4B3DA 3G82C 1NN1A 1DPFA 4M9XA 4Q4JA 2IC5A 4K8OA 4UQOA 4ZKEA 2UUAC 2KB0A 4JVSB 1JNYA 3KJHA 2ZYUX 2WWFA 3MRSA 2BBSA 1KI3A 4QXAA 3MFYA 2F6RA 4M9ZA 5JLJA 3THYA 3H1TA 4P32A 5CYPA 2A5GA 3BRWD 4CDGA 2JJ1D 2ONKA 3CRW1 3F5FA 3AVUA 3QNUA 5FPSA 3THYB 1IY2A 1G20E 1W0JD 3CPEA 4A0RA 4M21A 4ZI2A 1ODFA 3GCGA 3NIBA 4JI5C 2AWOA 2BEJA 3LBNA 3ZS8A 2ZJYA 4DDVA 3BWDD 1ZU5A 1BIFA 1JI0A 1QWIA 3UXMA 3JVUA 4C0SA 3TUIC 4PTLA 3BD9A 1G8YA 1G17A 3IO5A 3X1DA 2JASA 3ZQ6A 4F38A 5EE5B 3U7FB 4AG6A 2ZUBA 2WJIA 3PXGA 4FI3C 1Z2AA 4OBEA 1GKIA 1ZB9A 1HQYE 1R8QA 3BS4A 4LUCA 1DAEA 3V00A 4XVUA 3GLFB 2DFNA 5C18A 1N6IA 3L0OA 1E9FA 2AHOA 1W46A 2WJJA 1MR3F 5KPJA 3WBKA 2JLSA 4ILEA 1SHKA 1RYHA 1X86B 2QT1A 4LHYA 3LO5A 3MSXA 2ZM6C 1N5KA 5JSZB 2F43B 4QGHA 3T5DA 5GJVC 4C0LA 3EPJA 1LF5A 1CTQA 4NXNC 4DSUA 3BK7A 1P73A 1OE0A 3KKOA 2QTHA 2O0JA 1YZLA 2W6JD 4B71A 2ZRGA 2FNAA 1LY1A 1GL6A 1P61B 2G3YA 1E98A 1FW6A 4LF8C 2AD1A 5LMNC 2ODWA 1J90A 1EX7A 2P0EA 3HU1A 2FE4A 4V0NA 4FINA 1GITA 3CB4A 4BFWA 2CVFA 1G3MA 1KZGB 3U6BA 4JL8A 3IGFA 1GSIA 3Q9LA 4BFTA 1NBMD 1F48A 2VP0A 4NCIA 5KHOC 2WWIA 4JKYA 3QPWA 4BPBA 1TF7A 4YMTA 1KK3A 2IXEA 3T12A 4MKHA 4JKIA 4QGAA 1Z0DA 2WICA 4DT1B 2I3BA 1U0HC 4GNKA 3T1TA 2WPDA 5DHAA 3LW7A 2FSIA 3K0AB 3P26A 1IM2A 4JLOA 1ZIOA 1ZM9A 2JJ8A 3U3JA 3VHLB 1NN0A 5LMUC 1W4AA 3A1UA 4GP6A 4KYUA 2HLDA 5DGXA 5FH9A 2PJZA 2QE7A 2REXB 3K0AA 2ATVA 4G1UC 1Z08A 1KAGA 3WHKA 2PBRA 5HKKA 2GXAA 2IA5A 1E9RA 4IEEA 1S1CA 3B6EA 5CJ2A 5EP3A 3REGA 4UNRA 4Z1MD 1G7CA 3SQWA 3KKMA 2D7CA 2C95A 2NQ2C 4TLCA 2BEKA 4CEIB 4A82A 1PUIA 4MKFA 4YMUA 2ZPTX 2G0TA 1WBBA 1XXHE 1KI6A 4LX0A 1P7CA 1TUEA 2XNSA 4BE7B 4ZCIA 2WWXA 1OIXA 4JYCA 3BERA 2OCBA 4C7OB 5FTLA 2OLKA 1EWQA 2XR1A 1TPZA 3D8BA 3K8YA 1E79A 4YLGA 4N0DA 2IS1A 3RSOA 5FPHA 1CU1A 2JLQA 3LNCA 2FG5A 3HYTA 1ZP6A 3LDAA 1R2QA 5B30A 3SJCA 2ZI6A 3ONWA 4ZIRA 1KO7A 5CJPA 1WDTA 2XJ9A 4E22A 3HWSA 5TV2A 1P9RA 3DM5A 5FOTA 1KK2A 1XCMA 3DL0A 2IYQA 4B74A 3BH6A 4OKSA 1HV8A 1G4AE 3U6KA 2VYFA 3EAQA 4IVQA 3U3MA 1ZM3A 4AKIA 2I1VB 1GP2A 1EFUA 521PA 2O8DA 1XNRC 1CRQA 4Q4JB 3B1WA 2RHMA 2ZJ8A 1T5IA 4B44A 1G7SA 4BFXA 1JEDA 4JVLA 5JHHB 3MWLA 2YKGA 2WAYA 2ZI5A 1GL9B 1KNQA 1ZNYA 1F2TA 2VP9A 4WW0A 3VR6A 1DAKA 2J7KA 1CR4A 4D6PA 5FUWA 4ZO4A 4BRWA 4TL7A 1DG3A 2PZEA 3M6AA 3I3SR 5C4GB 3W90A 2ZRIA 4P0TA 5EP4A 3L0PA 1L8QA 1R0YA 3MMPA 4BSZA 2R62A 3X1YA 4JJZA 1B0UA 1U94A 4JT2A 4NE2A 4Q7MB 4UKDA 2X1VA 3CR8A 5BYJA 2ZS9A 4P33A 4A0GA 4RZUA 3SBEA 1GUAA 2OEPA 1R5OA 1H8ED 1VHTA 2ZYWX 1E2LA 2XGJA 5LDDC 3OTOC 3AVPA 1P2VA 1Z0KA 2FU5C 2YWEA 3KJGA 1MV5A 5B2ZA 3TW4A 5EXPA 5FOWA 2G77B 2VQSA 2ZVPX 1DE0A 1TEVA 3F8TA 1NP6A 4DV2C 3LW8A 1P9WA 1CULC 2ZI3A 4O3MA 4B43A 3THWB 2W2TA 3KXLA 3W3AA 4Q7JB 4TLAA 4C9BA 1NJFA 3BFVA 3CRMA 1HQCA 3RYTC 4B48A 3NWJA 5FBWB 4LV8B 2ZANA 1G6OA 1Z0FA 4DV6C 3SYKA 1IOZA 1JR3D 1VECA 2CHQA 2SHKA 3JVVA 3LAWA 1F5NA 2OXRA 4MTNA 1F3OA 3OFND 3A1SA 2O0HA 3A37A 2HF9A 2HJGA 3KTAB 3AEZA 2ZIAA 1OFHA 3A1TA 4RCZA 4TYPA 2O5VA 1W36D 5HCIA 3CONA 2WSSA 5EE9A 3A8TA 5LPNA 2FV8A 3TJZA 4MRSA 5IF9A 3U4QA 3CLVA 3CWZA 4EJSB 1AK2A 1OB5A 3QKSB 3GJ0A 3TE6A 2C9YA 4LF5C 2GXSA 4LJ7A 1ZC4A 3Q5DA 1CEEA 2OG2A 3UMFA 1HURA 4OQFA 3B9PA 2LKDA 5EUMA 1V5WA 5B57C 1FOEB 1D2EA 1VG9B 3UWKA 4XWKA 1W0JA 5AJXA 1ZD1A 4AYWA 3AVVA 4QJ3A 2B7BA 2PN2A 4MRVA 5DISB 1J2JA 1U99A 1YR9A 2QNRA 3P4XA 3CPJB 4L9SA 4JMPA 4LF9C 2HT1A 3D7MA 4A6XA 1N6OA 3B5JA 3FFAA 4CT5A 3RRNA 4MQBA 1WXQA 5FOVA 2MSCB 3QKUA 3GEEA 3PR1A 4F93B 3NBFA 4DB4A 4S2EA 1SHZA 2QZ4A 3AUXA 1MABB 3I72A 3DKVA 1VYVA 3CRRA 2RH5A 3I92A 2FZ4A 4PC2A 5FL3A 1X8KA 2D7DA 2BM1A 2KBEA 1E2DA 2GDJA 1COWA 1TADA 4L9WA 4DR1C 4Q7LA 4NH0A 2WMNB 3FVQA 4MYCA 1G7TA 4NL4H 3QE0A 3TMKA 1E1RA 1E4YA 3MG9A 4HB4A 4LPSA 5KSZA 4P4SB 1Z5ZA 1KMQA 1R5BA 5JBQA 3A6PC 3NKVA 5BR8C 2XITA 3K9GA 4G5OA 1TUIA 4P4UA 4KAXA 1IBKC 2KSQA 3UANA 4CEHB 4EPTA 5FUXA 3NG1A 2ZU0C 3SHWA 2FJUA 4KJZA 1NG9A 4F4IA 3J81D 3J81k 4DR3C 4P3YA 2FN4A 3B1VA 2Z4SA 3PUYA 3QG1A 4QC2A 2J0VA 2KJQA 1OH6A 1IAQA 4G5QA 1YZKA 1JECA 1W7AA 1FTSA 1G41A 3F0TA 4US2R 2C03A 3NTUA 3LH5A 4EJSA 4OHYA 4BASA 4CRWB 1YZUA 1XMJA 1KAOA 3U44A 4L15A 3O8BA 3B8HA 3TAHA 4A36A 2Q9BA 2E1RA 1N34C 4QGFA 2XXAA 2PL3A 1N3BA 2XZLA 4QM6A 4NOZA 3EZFA 3KB1A 4JLJA 2HV8A 4GFDA 2RGGA 3TQFA 2VRWA 4B2IA 2ODBA 1I4TD 1NKTA 2Q6TA 3KXIA 4FMCF 1P2SA 4Z1MA 4XTCS 1E3MA 3TSOA 2D7VA 3B85A 3RS4A 2VLIA 4LRWA 4X8HA 4JIMA 1RC8A 4ZDIA 2QE7D 1XJCA 4TL9A 4ESVA 2XAUA 2H16A 4WZBE 4US1R 1FZQA 4V02A 1N32C 2O8EA 5HE8A 4EPXA 1E4VA 4TLEA 2ZE5A 1KMHB 1G8PA 3HDTA 5TARA 1ZUNB 1IBRA 4DUZC 1LS1A 1G291 1YVDA 4KVGA 1DO0A 5FTJA 5JCPA 1ZMXA 3LY5A 4LJAA 3V9PA 1ZCAA 2OCAA 1ZB8A 2ZSDA 3AVOA 4TTRA 4N3NA 2O8EB 5EP2A 5E3HA 1VMAA 3K0CC 4M1WA 3I32A 1ZRHA 1ZJ6A 2XB4A 5IT5A 2O8DB 3MCAA 3CRQA 4OK3A 4DV7C 3EIHA 1CJMA 5FL7D 1UEJA 3VNUA 3EWAA 5DN6A 1SXJA 3MLEA 1FQJA 3SFVA 3VU9B 2ZE8A 3HPRA 4FMDF 4PHHA 1NBME 1Q22A 2G0NA 4C3ZA 2FEMA 2JA1A 2RKOA 4LC1A 4DEYA 2C77A 1AQYA 4JYBA 1HE8B 3WMGA 2WOOA 4HLUA 4V0KA 3VKGA 3C15C 6Q21A 2G1JA 1E2KA 4F4CA 1Q0UA 1F2UA 3AKCA 1XPOA 1EFRA 4PQYA 4Q9IA 2IYZA 2BKEA 1OYWA 4UJ5A 2J45A 5FI1B 1R0WA 3RSLA 4PR0A 2CCKA 4RD1A 2OLJA 5CYOA 1XMVA 2IYRA 3KKPA 2XOKA 4WVFA 4KXFB 5HZHA 2H1LA 2CNWD 2P5SA 2XNDA 3GEIA 3I07A 3GEHA 1EG7A 1OH7A 5CDFE 3A4MA 1MRNA 1AIPA 2D74A 3LVQE 2ZI7A 3U3RA 3MAAC 2JGNA 4B6FA 5AK0A 2PJRA 1XNQC 1R7RA 4JLMA 1DAMA 4QBHA 5H1YA 4A2PA 2A7QA 4LI0A 1CKEA 5FR1A 3VR3A 4R7ZA 1KHTA 2UXBC 3ADDA 3D3QA 4L8GA 1SVSA 4W5HA 1MKYA 2NZ8A 4BWYA 4URYR 5GVRA 1HNWC 4ERNA 3WHLA 1NYEA 5JWOA 1T5LA 3KUCA 4DSTA 3TRFA 2QBYA 3ND9A 2ZAOA 1WMSA 1BS1A 3LVRE 4A2QA 2CE7A 1WH9A 2JJ1A 4NZYA 2BIFA 2AR7A 2GTPA 2EFGA 3JZMA 1G19A 5C4MA 5LD2C 1NJGA 5FBQB 2I1QA 1G5TA 2PH1A 3RNLA 2O8FA 1C4OA 4LF7C 4I1UA 1XXHA 3K53A 4YXWD 2V7QA 2KE5A 3TLXA 5FUYA 3T34A 2W6JA 3N2EA 4EPRA 2HXSA 3R7WB 2XB2A 4Y0AA 4Q1FA 3LX8A 4LOAA 5E4FA 5KDDA 4DLSA 3BGWA 1QG2A 4N0EA 1Q20A 2VQEC 4TMTA 4Y0VA 3TVDA 1P62B 5C2JB 1XB2A 1ZNXA 4DWJA 2E5LC 2UUCC 1NVXQ 4IFBA 3FMIA 3FKQA 1NBMA 4L4UA 4TYQA 3RLFA 3VR2A 2X2FA 3KQNA 4NMMA 3AF4A 1D5CA 2J0QA 1AN0A 1VIAA 4AYXA 5J4KA 2R9VA 3VKWA 3T5GA 2Q3HA 3KQHA 3A4LA 2V8OA 2QM7A 2NMVA 5FBVB 1JB1A 4ABYA 4NCHA 1W47A 4HI0E 1D2NA 5EZ5A 4C0JA 2QMOA 5DE3A 1VPLA 3IQWA 3SC3A 3ZH9B 1K6MA 2DCUA 3OIYA 1KK1A 2RGBA 1H65A 1SKQA 1NY5A 4OI0A 1OXUA 2AKYA 1SVMA 2BBOA 2QGZA 1AKYA 3QF4A 1D9ZA 3LUSA 5F98A 4IDHA 2OCYC 2QSZA 2EQBA 3TKLA 4YDSA 4QJ4A 1KMHA 4BUJA 4G3XA 1J99A 2IYUA 2Q3FA 4PHTA 4POAA 1B23P 2QEQA 3ZQJA 2AL7A 2CMKA 3KB2A 1KGDA 1VKJA 2VSXA 1CXZA 4V03A 1HYQA 4LYFA 4U02A 4HLCA 2ZSAA 3J80D 2GESA 4PC1A 3W5JA 1N2FA 4URVR 2F1RA 1SXJD 1SGWA 3MJHA 2C2HA 3AF0A 4HAWA 2CK3D 1BYUA 3R7WA 3SFZA 3TR0A 2QQEA 4GT1A 4PZLA 3QOFA 4MGIR 1R8SA 3A1WA 3KUDA 4WBSA 4M4SA 1YKSA 4Q9JA 5JFGA 4NCJA 5J4VA 1ZAKA 3BAFA 3M1IA 3IUYA 2NOAA 4PO1A 2O8FB 4BEJA 3LBHA 1ZUIA 3TVTA 3QUSA 1KK0A 1E96A 2CBZA 2REBA 3QVUA 1MOZA 3CX7A 1LV7A 4DR5C 1QHNA 5DHFA 2JMPA 1HUQA 3AP3A 2IEZA 4Q00A 4RCYA 4DV5C 4HLUC 4YDHB 2RHDA 3HR7A 4IXNA 2F9LA 4CYMA 4N1AA 1IY0A 1KZ7B 4RFSA 2GK7A 1HNZC 4B32A 3PJRA 3W3ZB 3NEYA 1GNRA 5ANRB 1ZNWA 4B75A 1GWNA 3LXXA 1OF1A 1FUUA 4Q1AA 5G53C 5KYKA 4LF4C 2VSOA 2GCOA 4V0LA 2VHCA 4JLAA 2P5TB 2UUBC 3LQRA 2PLRA 1BH2A 4BFYA 1XBTA 3GLHB 2IEYA 2NPFA 1J7KA 4M1MA 1DEKA 3OIVA 3T1OA 3DO6A 1AGRA 2J87A 2ZJZA 1NMXA 1ZU4A 3SNHA 5J4LA 2GF9A 2QAJA 3ASZA 3KJEA 4WZAE 1Z63A 3OEHD 2V3CC 1D8TA 1OKKA 2IUUA 4EPWA 2GJ8A 3EPLA 4B3CA 1EFHA 4PPQA 4XH9B 1WE2A 1A82A 4JLDA 4IOKA 3CO5A 1E1QD 2ZI4A 4DCVA 1VYUA 3C7KA 1NL3A 3ZIAD 5CITA 3THOA 1ZC3A 4QNMA 4ZKDA 4R2IA 1W0KA 2F9MA 3GJ6A 3VFDA 2GBLA 1C1YA 2ZITA 2QTFA 4GP7A 2GJKA 1OSNA 4EPYA 2DHRA 2A30A 3N5CA 3F3YA 3L8YA 3FYHA 4FMCB 5LD2B 3U60B 1XD8A 1XCGB 1QVAA 2BBTA 4TYWA 4JSTA 3BORA 4HAYA 5DI9A 1S4QA 5EXTA 2A5FA 1Z29A 1G8HA 3T1HC 1DG1G 1OHHA 1TNDA 1F2TB 1Z83A 1YZGA 1Z6TA 3OIUA 1E1RD 3IPYA 4XTRA 3NH9A 2VP4A 1Q57A 3AF3A 2HYIC 4D4LA 4AQYC 1RRGA 2GZAA 4D4MA 3CX8A 1NVUQ 1H8HD 1EX6A 4PANA 4RY2A 3HR8A 3GLGB 5JJLA 2AK3A 3PIRA 5JRZA 3VHXA 4KI0A 1LTQA 3IEVA 4PC3A 4DLXA 2ZS7A 4EFNA 1F2UB 4R98A 4TL8A 3AVYA 4X65C 1Z6AA 1T91A 2ZM5A 2OBMA 5F9HA 3T35A 1KSFX 5GVSA 2OZEA 4HB0A 2E9SA 1VYTA 1X1RA 2GNOA 2TMKA 4HLDA 4EQ6B 1E2GA 3BFXA 1OW3B 3WMFA 2QQ0A 1NRJB 3VU9A 3UKDA 1E9AA 4PPNA 5A2QD 2PT7G 4GSYA 4XX2A 1ZINA 4QNRA 1X3SA 5A5GA 2EGTA 2CHGA 4LJ5A 2VSFA 1TL7C 5EE3A 4R71A 2ZRAA 5AJVB 2CLDX 4BFUA 3ZZUA 4CVNA 1M7GA 5B58C 3U44B 2Z0MA 3U2QA 2IL1A 2CLSA 2Y8EA 3FHOA 2BJOA 4D25A 2OCPA 1II9A 5AWFC 1GNQA 4HSEA 4DJTA 3TR5A 1WBDA 1XEXB 3LWNA 1KI6B 4PX9A 5FTNA 1S96A 4A8JB 1SQ5A 2N46A 1U90A 4DDTA 3MWJA 4C0HA 4IXMA 4PPFA 1FNNA 1AKEA 3CW2A 3RRYA 5JJIA 2RCNA 1N6NA 4JI2C 1HNXC 1G3UA 1XPUA 2YC4C 3SR0A 4KFUA 3B7GA 4RD0A 2A9KA 5M04A 5FLXD 1XXHB 1UADA 3RRMA 4BFSA 3AV0B 3TSWA 2ZRMA 4XSGA 3CF6R 2ZR0A 3NC1C 5FR2A 4Q1BA 5JJKA 1BKDR 2G88A 4PHGA 3CPHA 1Z47A 1PA4A 1LVGA 4TQAA 1Z6XA 1P60A 4II7A 1R4AA 1VIYA 2ZU6A 2NO0A 3RS7A 3K70B 3Q72A 1I4LD 3HP1A 1I2DA 4HZIA 4WXRA 3VX3A 4B35A 4QHSA 2GJSA 5DSZA 2UVQA 1M74A 1USPB 4M0LA 2NO7A 1OHHD 4NCKA 5SZJA 4G5GA 4Q7KA 3RDPA 2EYQA 4X8OA 5JWRA 1A2BA 3ADBA 2Z6VA 4CEJA 2CCJA 2ODNA 1NSTA 3ZIAA 3VMFA 1Z6YA 1Q3HA 2GCNA 5G41A 4DR6C 4NCNA 3ZYCA 1PLJA 1IN8A 5EP1A 1NVVQ 2FSGA 1DO2A 1ZM2A 2YOGA 2ZRHA 1TQ6A 2DY1A 5CIQA 4JJKA 2QI9C 3T1QA 2XTZA 4DCSA 1P75A 2L0XA 4MYHA 3WXMA 1M1YE 4QBIA 2K5UA 5E7IA 3EXAA 4MRPA 1UKEA 4YHHC 4JLVA 2FX3A 4EFMA 3CH4B 2IT1A 2QAGC 3GP8A 3ECCA 4JVNA 1KDTA 4QBFA 1RZ3A 1E9SA 2IBMA 5FI0B 2GBLC 5GJCA 3AQ4A 4HATA 4RFVA 3SJZA 4DXAA 1EFCA 1E9CA 2J1LA 2ZRPA 1E94E 3E70C 3I73A 1JEEA 1G5PA 1NN5A 2A5JA 3W8NA 4MRRA 2ZJOA 2PCLA 4RD6A 4O25A 4OI2A 5BN5A 4A9AA 2F4VC 2EWWA 3A36A 5KNCA 1Q44A 2RGXA 4CZ2A 4GKKC 2D2FA 3R9XA 3EZ2A 5FOUA 1UJ2A 4B3BA 1YRAA 4ZDJA 3WRYC 5KNBA 4F92B 4LC0A 1Z0AA 4GMXA 2YOHA 2QUZA 1XMIA 3C41J 4LZZA 5LB2A 2ZETA 2UXCC 1VTKA 4KLNA 1T4GA 2R6CA 1E2IA 2DFTA 4B73A 2IYWA 1SZPA 3IHLA 5CB6A 1UF9A 2IF2A 1AZSC 2YINC 3U5ZB 3CWQA 1GG2A 2V1UA 4BFZA 2ZJAA 5C46F 1NNEA 1JR6A 1E99A 1NI3A 1VHLA 2GAOA 4L5BA 2ZSFA 4QJ5A 2ZRNA 3BB3A 4X66C 2R6AA 3LFUA 3SZRA 5IDVA 4Q4LA 2YOFA 5FTKA 3U7EB 5FPKA 3AKEA 2FSHA 4HDCA 5ELXA 3OE7A 3QKTA 3P1JA 1I4DD 1XMQC 3KXKA 3X1ZA 2GHIA 2P6UA 4QRHA 1CR0A 1ZUHA 4LYJA 3RWOA 1L7VC 4LBZA 2FWRA 5FPTA 2R8RA 3DDCA 4OX9C 2V6JA 2YCBA 1P2TA 2QGNA 1N0UA 3O8RA 2BCGY 4U5XA 3UK6A 3L2OB 3AVTA 2LWIA 2QAGB 3QXHA 4E5UA 4DCTA 1TMKA 3FPAA 3G0HA 2DWPA 3BXZA 5DNYB 4MKGA 1YZQA 4Q9LA 2QN6A 2IXGA 3W6NA 4BLTA 5HCNA 2P67A 3MUFA 1D2MA 2X2EA 2HYDA 3PEVA 2V1XA 4KU4A 4O2RA 2J3EA 1KYIA 2GWHA 5BYKA 2ZR7A 1US8A 2OFWA 2B7CA 2CE2X 3OE7D 3W5IA 1IHUA 2IXFA 3IIKA 4Q01A 2AX4A 3M4YA 4ON9A 3QENA 3GLIA 1EK0A 1VG0B 4D0GA 1Z0JA 4I99A 4IDNA 4A1FA 2J0SA 1L2TA 3RHFA 4LF6C 3MGCA 3UMRA 2V7QD 2RGDA 5IWAC 2BMFA 1E0JA 2XTMA 3I8SA 1W2GA 3GJ7A 1N6KA 2WJYA 5KO2A 4DVGA 3K0FB 2EWVA 3W6PA 2JATA 4JI6C 4P31A 4S35A 2A5YB 2BOVA 4W9MC 1Z0IA 1X8LA 4Q47A 2NPIA 1OFIA 2F3RA 2WTUA
chains in the Genus database with same CATH superfamily
1JQJC 1WCV1 4IIVA 1MC8A 3F49S 4XIGS 3MA0A 3AO0B 2CJPA 4IH4A 3EQ7A 3OICA 3RVJA 1YB4A 1CR2A 2FRDA 2W37A 1A9QA 1UM9A 2FUG1 3TUFA 3IUSA 3KAKA 3LECA 3NPMA 3O2SB 4RQTA 1N75A 4GKJB 3C8ZA 5E6RB 5FOXA 5IT9D 5AW2A 3DZIA 4M7OA 2FR1A 2PV7A 3UCXA 3WBJA 2WE8A 1ESZA 3U1BA 1GG9A 4EYOA 4CF7A 4A10A 1E7WA 4FDVA 1C3LA 1BXZA 1Q1QA 3HFSA 1KI4A 3T15A 1ZD3A 3GDWA 3IILA 4EI2A 4HVLA 2IZZA 4P36A 3M6MD 5JD5A 2R2AA 3LOUA 3RB8A 4W5NA 5K8TA 3A2LA 3C8HA 2FMKA 1P0MA 1T3LA 2NN3C 3DHWC 5E6SA 1V5EA 2ZWMA 4NEHB 1J5EB 1XMOC 1YZ3A 2W2KA 2BH2A 4KXUA 1L3BA 1MF7A 4HRYA 4XWAA 1N2CE 2AN9A 3KVYA 3SYLA 4ETNA 4P3KA 5E0OA 1LS6A 4XIYA 3O8DA 2PUBA 4QRDA 4GZLA 2ZTHA 3BRWA 4RK7A 5ALMA 2XT0A 2DBVO 2O8BB 1NIJA 1RAGA 1V11B 3RRFA 5B1IA 3MD0A 3CGWA 2IYXA 1OWLA 3Q85A 4TV8F 1BRMA 2X8AA 4OXRA 5LL6P 2P75A 2WG1A 3D3NA 4RAOA 3QHAA 4U2DA 3ZHYA 2JLUA 2VK1A 4LQCA 4ZLPA 4UM9D 3Q0TA 4PLPA 2TSYB 4TZ6A 2I6UA 2GXQA 1FP6A 1JLRA 3NYQA 3E5HA 3WA6A 4XPZA 5MGBA 1RQNA 3FRJA 1ONBA 4TMYA 4A0FA 3VI3B 3F9IA 5BWMA 2FZVA 2Z2ZA 4EUNA 5K05A 5KSWB 3KC2A 4M6WB 2GFQA 3NIGB 3ZI4A 3VDQA 3TGPA 4FB5A 4QM7A 4ODIA 1AH2A 4S1TA 5JS2A 1DRKA 4BCAA 2QAGA 2NUAB 1YDWA 4BHTA 2GMWA 2GN1A 2R6FA 1WWKA 4TRJA 4OLHA 3PPYA 4GLLA 4B84A 3L4BA 5DLYA 1IPFA 3AUKA 4K05A 1I3OA 3LUFA 3PSHA 5LLSA 4EHJA 1JAZA 2DUUA 1I2MA 4X84A 4EUEA 5F64A 3FOCA 2H9AA 2R6DA 4R9SA 5CLJA 3Q88A 2E0IA 4M1OA 4CF6A 3ZE1B 5LCIA 2BP7A 4QU9A 4W8OA 5T6BA 2B8NA 5IF3A 1C0EA 3HPQA 5A4JA 1M2GA 1N9GA 4AJ2A 3BXXA 3IAEA 5TJHA 2WWHA 1NYLA 3HU5A 4LGMA 3QPUA 5HILA 2FDRA 4Q39A 3UY4A 4AG5A 3CUTA 4D81A 2O06A 5AUPB 3UPUA 4MITA 4BGDA 4DZZA 4MPJA 3CXUA 3WLLA 2DHEA 2GK3A 5BOSA 1LBQA 1WMFA 3DBHA 4Q02A 5AD1A 1AXGA 5K0EA 3BBPA 4KZPA 3ASYA 5BN4A 1KO8A 4Q12A 4MYDA 4XD7A 3PJDA 3KJQA 4YMWA 1P6XA 4OHXA 3RUPA 5DPMA 4D43A 1KY3A 4F45A 4F60A 3MM4A 4JZYA 1G3RA 1Z6ZA 5K3SA 2AXQA 5HG0A 1BO6A 3ESRA 5E3JA 1N92A 5K8FA 2QUBA 2JDID 3ND5A 5E4YA 2R1VA 3AR5A 3DD1A 2C97A 2QVCA 3HDVA 4HRXA 4WZBB 4D4KA 4R9UC 5U4XA 3GYGA 3LUGA 2VP5A 4FNAA 4TLDA 3HDGA 5KREA 3PQFA 1V1JA 1XX6A 2J59A 4U2BA 3TQQA 2CL7X 3OF5A 5J2UB 1XMOB 4Z9BA 5JSYA 4J7CA 1O96B 3D6AA 2OYSA 1J5EC 5IN5A 5LIPA 4CMGA 1QRSA 3N54B 1RJ9B 4NK4A 2Q2WA 1C7FA 3CF0A 3DMYA 4P7FA 4LF8B 2LKCA 4P83A 1RYZA 2HUNA 1NBWB 4MUFA 5M3BA 2ORIA 1LDGA 1QS0A 2B30A 2E5WA 2P27A 3FYSA 1YS9A 3Q98A 4ZP1A 1ORIA 3FUXA 5D5HA 3C5CA 1Y5RA 3Q3GE 3P2IA 4KHZA 3MVEA 1JJBA 2ZYTX 2MSKA 3NM6B 4HDNB 2RK4A 1V3VA 2G72A 2ZUCA 1YRQA 2C3UA 4OQEA 3HCNA 1II0A 4O2BA 1ZNQO 4X0EA 4B7ZA 2QR5A 4P3XA 2PZFA 5I7SA 2HUPA 3G49A 1BA2A 3QVVA 4IUBS 4L6IA 2Z57A 4LW8A 2N42A 2ZYSA 4NOJA 2QVZX 4RY0A 4WLEA 4AZWA 1ICEA 1E63A 2JLCA 3JWJA 4FDUA 1VB3A 4HADA 5CBKA 3ICEA 5ITWA 3GJXC 3EERA 4AJLA 4MH0R 1VPEA 4NZPA 5TMPA 1D6MA 3PR3A 2NYAA 3W78A 1GYRA 1H2BA 3EVDA 1OJLA 4QODA 5B3AA 1VDZA 3K1AA 4DAOA 1IXSB 1F20A 3BK2A 1G1AA 3LMKA 3TUJC 5FOQA 3QTLA 5EJEA 5KCMA 1JFFA 4IQ4A 3C6QA 3IA7A 3KYIB 2GCOB 3TH5A 1ZBQA 2PUFA 1HOTA 2HA3A 1UZLA 4M0EA 2DM6A 1O4VA 5L7TA 4CEHA 1A0OA 1NV8A 1OPXA 5ERXA 1FFHA 2GN6A 4YJHA 5CB8A 2P7IA 5EERA 3KQLA 3JTEA 3EVZA 3H9UA 4LPKA 1QHGA 3ILHA 4KITB 1AHNA 1H66A 1HT3A 3LX5A 4XWTA 5HQ3A 2JIDA 3R8CA 1B41A 5TS2A 3DVAB 1BOFA 1N0VC 1QLJA 2C1ZA 2GEVA 4KPGA 4Q19A 5DLQC 4Z54A 4LFAC 1SCDA 2QD1A 5CT6A 1W5SA 2XI4A 2CEAA 4UXHA 2BFDA 4H27A 1RI5A 5J40A 4AZ3A 1U2EA 3W06A 1NR5A 2VA8A 4G1FA 5AIBA 1DEHA 5L53A 2HDWA 4A8HA 3ZNQA 1U7OA 2R96A 3JD1A 5HKAA 5I48A 2ACKA 3BOSA 1PNTA 2F3UA 3ANLA 4HFJA 5BW4A 1KDOA 1RWKA 2FETA 2WKRA 1GU1A 2QYOA 2Z8YM 1RPAA 1ZRSA 2Y6UA 4Z9AA 1QJCA 3HCAA 1ECPA 1QHSA 1XQ6A 1XELA 1MAWA 2QL6A 4FYVA 2QL5A 3GA0A 1WDLA 4XM2A 3W04A 5B36A 2GN2A 1FMJA 3RAJA 3H86A 4KWEA 2JJYA 3F6YA 2A57A 3DNMA 3O0DA 4EG6A 2C00A 4I7EA 2B21A 5KTNA 2JF0A 1OFTA 4L1KA 1E2QA 1NSYA 2PS0A 4F7WA 4ACBA 1EXVA 2GS9A 2WC1A 1KJJA 1VSQA 2H17A 3QBEA 4YJGA 4ODJA 1RCUA 3HNRA 4JQZA 3I0NA 3L0BA 1GAWA 2JEOA 4C7JA 1RMTA 4HNGA 3VM6A 3ZV6A 5FIUA 2ZAMA 3ZR4B 1I4WA 1GPAA 2CFOA 3L7CA 4OYHA 5HDQA 2IU0A 3H0CA 1RCTE 3UGTA 4WXMA 4LCBA 4NU0A 4B6EA 2JRCA 4BX9A 1KJ9A 4KSBA 1WSBA 4LZWA 3V9PA 1TLLA 2E82A 3FJ1A 2MDTA 4H08A 4CMEC 5KMGB 1WHTB 3LQ2A 2I4LA 1ZIPA 1XRRA 1ESMA 3H75A 1GEEA 4JJEA 1CZLA 5EJ8A 3NBZC 5IDXA 3ZCQA 5LXTA 2EFCB 4CLOB 4Q1CA 1E5DA 4LY3A 1PG0A 5SZKB 4QVIA 1NYTA 3LOQA 1EAYA 1YQTA 3LWDA 3HC7A 3DYBA 4K9PA 4RL4A 4EHDA 1IZ9A 3JRNA 3L18A 3LWBA 4AJKA 1MXCA 2WIBA 3GA7A 1CSEE 2BJWA 4H7DA 3EPKA 1IQRA 3KUKA 1VJDA 3HACA 4O4LF 1GTVA 1P4RA 1VBNA 3OEWA 4EGJA 5EAIA 5AK3A 1FUGA 3OA2A 4ZI7F 3P9CA 4DEVA 2F1IA 2WM9B 4XB1A 1GPBA 1QMGA 1T34A 4B33A 1BX1A 1N2BA 5CT8A 1RD4A 2ODTX 621PA 2XQJA 5IK2D 5AW9A 4A92A 1PGPA 3I9V1 1QRUA 3MTAA 3L7AA 1CBUA 3A27A 3IUQA 3WNZA 4DLWA 2IQIA 4AULA 1XDWA 1NLUA 1NSFA 4ZCTA 5A0VA 3OX3A 4TWAA 1I2BA 1VKZA 4URZR 1JI3A 2FWNA 3ZQUA 4AJIA 1KSHA 5BNTA 1U2RA 4IZIA 4U63A 1TYBE 3WY9A 4BMDA 3BJIC 3AK4A 2WAXA 2PM8A 3ZDXB 5KSPA 4X8MA 4QDJA 3AIMA 3PF9A 2W2KB 2CY0A 2BI7A 1JQDA 5DT9A 1G2PA 3URKA 2OV3A 4HYEA 4DSAA 3VA7A 1W2WB 1JJVA 3RQSA 3LL7A 4XUDA 1WY5A 4TV8B 5TB5A 5E7MA 2MYPA 4JLWA 1G5IA 1L5VA 3ILYA 2EAUA 4IDDA 2KYRA 4K5QA 5J5AA 3WYGA 4RTOA 2MTBA 2O20A 1JDNA 3WHPA 1MW8X 3N05A 3PP8A 2JJ2A 3C85A 2IEDA 3FH0A 1R6VA 4IQ8A 3ZWWA 4U8HA 1XDGA 4LHXA 1P9NA 5COQA 3SC4A 2YFQA 3A6DA 4LQ4A 4FMDB 4HB3A 4D2IA 2A9VA 1UPTA 3KPUA 5G0WA 5JALA 1RDFA 4LZJA 4TQ9A 1PZGA 3Q3HA 1ML4A 3UXHA 3B3JA 3BDIA 4LNAA 1P5ZB 4GX5A 3BHJA 3KJXA 4DV1C 4C4YA 3CBQA 3H4IA 3RIMA 2BGWA 3I9MA 2GN0A 3L1UA 4UNIA 5TVKA 5CA0A 4BNDA 3F6EX 5LQDA 3ROKA 1S0UA 3INTA 3HVHA 3VOTA 4EKEA 4N5IX 2I34A 3GRRA 4GG1A 1NMZA 1HBJA 1TQDA 4FFRA 4DMGA 3Q2KA 1AB5A 2GO1A 1GM5A 4AS1A 2WYVA 1RLJA 1DTSA 1QC5A 3NJ8A 4M8NE 4WCVA 3GFTA 5FWNA 3ONVA 3QI7A 2V7BA 1I80A 1Z12A 2BM0A 4RULA 5JE8A 3TQOA 3OQIB 1P7PA 2EHJA 3LLCA 4QFMA 3OOEA 3U19A 3T7TA 5I7UA 2VPWA 1T35A 1I94C 5K0LA 3O7MA 1PF7E 2YBDA 4QOHA 1QCCA 1Y8QB 3B78A 3A10A 4LRYA 4AJNA 5L95A 1SXHA 1Z74A 2I22A 4UMEA 2FPSA 1ZPDA 2VHEA 3WVNA 1YDFA 1AM4D 1E3EA 3SYNA 3WDSA 4ARIA 2XUJA 3SJAA 4HVAA 2HTFA 4BFVA 3PFNA 1HLDA 3CJRA 3RI3A 2XBMA 4DN6A 1PTJA 2ZSIA 3V8EA 4H7HA 1CFJA 3A9CA 4Y2PA 5ADVA 3DMHA 2JKYA 3MMXA 4AUEA 4DMHA 1C0LA 1UBCA 1X1QA 3HA5A 3TDKA 3VU0A 1YQEA 2YVLA 1J2EA 4JENA 1RM0A 4I14A 5CVVA 1YV9A 4AKEA 3G8YA 2GZ2A 1QHHB 4H60A 4XVQA 1QIMA 4LNUA 3L0CA 4NZMA 3UMGA 3A4YA 1PK9A 4A6PA 2PMBA 3H2KA 2HSDA 3GHYA 2QL8A 3EGWA 3AP2A 4M0FA 4XDZA 5F76A 4S2UA 1ZVVA 1RJGA 4G8BA 4GWLA 3GZJA 3K0EA 1U7UA 5TEWA 2VK2A 3WQHA 4ASUD 3GFPA 3I45A 5I4IA 1C7QA 3D3JA 3HXTA 4ZV4A 1BMTA 2P79A 1WSAA 1XCPA 3EGXA 1WVGA 3PUZA 4IQFA 4AO8A 2IXTA 1KJIA 2WU4A 1RWOA 5DW3A 3T7IA 3T7CA 1IB6A 4NPHA 4N01A 3B36A 3OFJA 1JYSA 3GROA 4ZQIA 3K8QA 2JJ2D 3S1SA 1BGVA 3JQ9C 2PSSA 4OHZA 3RUIA 4KE9A 3S8MA 3ITNA 1ATZA 3GRZA 3O8NA 1MTOA 1JYEA 2JG3A 3PQ3A 1O94A 4F5WA 5E7JA 4X1KA 4AF8A 4HQKA 2HIGA 4WKCA 3M6XA 4M2LA 2ZAIA 2QTBA 3L5OA 4M1SA 3MJRA 2ISSD 5DO9A 3PQ5A 2VZLA 2Y67A 1SCKA 1UC9A 2GKSA 4Y7DA 2DG2A 2BV3A 3DE1X 3VR5A 2PUTA 4IR7A 3OUUA 4UOEA 3L93A 5IWCA 2WEKA 1I94B 1X7DA 4YUAA 5BV1A 4MV3A 1KPIA 5L3QA 4N41A 4GMHA 4BQPA 1D09A 2XMCA 3KZMA 4O8ZA 1TKRA 1KWGA 5BSVA 3H9GA 5ALEA 3FKSD 3PCRB 2E87A 1RG9A 4XYGA 1F17A 1QAMA 4E5DA 3VYRB 2VH5R 3TNYA 5SY9A 4UHDA 4EF6A 4BVKA 3JQAA 4PFQA 4DA8A 3JASA 4UFNA 3MJTA 4J94A 2EW1A 4NJMB 1FMCA 3RS2A 3OUTA 3P4YA 1BN6A 3HN6A 5LMNB 3K4QA 5TNXA 3ZJ4A 4BJ6A 4H1WA 5T64A 1BE8A 4BX2A 3GZTB 2R2GA 3E0QA 4K6KA 3BSSA 2TRSB 3X1KA 3NVKI 3LTNC 3GIDA 1J00A 3WRXC 2BMDA 3DDUA 3K9QO 4RZHA 3GJ3A 5HW0A 2A9FA 1AS2A 2DR3A 1F5SA 1NOJA 4DMKA 1YCGA 4V1CI 1OBFO 1X2EA 2GARA 4YA6A 2R87A 2FQYA 2BMJA 3PDCA 3BJRA 2ZWOA 4OFBA 4QYSA 3AL3A 3VR4D 4Z4FA 1A4XA 2EFYA 4E5KA 1QLHA 2QP3A 3GBVA 2WF7A 2VJMB 1QGAA 3NQ41 3LC7O 5K3DA 2P3OA 3SM9A 3P32A 1IRIA 2NG1A 4OG2A 4LRXA 5JAIA 221PA 3KYDB 1C2TA 1GUZA 1IC6A 2CLEB 4Z9FA 3WLRA 3TIFA 4GL2A 4DRZA 3QWFA 4QFDA 4R05A 4QXQA 3AVQA 4HZUA 1QQBA 1N6RA 3BMQB 3Q1LA 2VZ0A 2V7WA 2XUKA 3FR7A 4JBWA 3WGOA 4ES6A 1XZPA 5DNCA 3V4OA 1PZEA 2JI6A 1GDHA 1JKIA 1XRBA 4O2LA 4FD3A 4RJIA 3EH2A 3O3NB 4G01B 1JDTA 3I23A 4FHEA 1UZMA 1RJFA 2AFHB 2NTYC 4GRDA 4ZT7A 5H81A 4D3YA 2Z6AA 4ZQFA 2EKBA 3P2EA 2NV6A 4UBIA 4F4DA 3OPYB 1JU3A 4C0AC 2XD9A 3NVDA 1S8OA 2V7UA 4XFJA 4PSCA 3WGKA 3WB2A 3LJKA 1NE2A 4AECA 3CZPA 4NE9A 3ND7A 3ZW7A 2I62A 1Z2PX 3L8MA 1IONA 3IDFA 5D3MA 1K8RA 2I6FA 1KEWA 1VA4A 2WJVA 4YRFA 3OTIA 4OOEA 2QPOA 3CB2A 2O0LA 5DK4A 3KPWA 1GTZA 3IODA 1AURA 4PGFA 3R23A 1C0KA 4M1TA 1WSWA 2WHYA 3G0GA 2ZB8A 4PC6A 4EMSA 2HGZA 2XX3A 4H7PA 2CUTA 1MO6A 2R4TA 4TMWA 4TVBA 1G38A 2JIZA 4TN5A 1KJQA 1NPYA 3BZWA 2GGSA 3W77A 1F2DA 2B1QA 4IOLA 4D98A 2FPKA 1UAAA 2HRZA 2VI5A 4GZ6A 1NXWA 4F5EA 5AQ1A 1W5TA 2PJDA 4M38A 4CLOA 1ZDMA 1UDBA 4L95C 3S1AA 3W2GA 2FP4B 4L3VA 3O3OB 4CV0A 2PGLA 4H0CA 1S3GA 2VRBA 5LWHA 4BUZA 1Q91A 3JZAA 4DIBA 3TCXB 3L05A 4XXHA 3FUUA 2P4HX 4Y2TA 3HB0A 4P82A 4WCFC 2NUTA 3H5VA 3GLKA 3KFVA 1N36B 1QIKA 3MD9A 4DLYA 4IDPA 1XVIA 3NRJA 4PNEA 4C4PA 5CIYA 2WA1A 3BCHA 4JI1C 1FDRA 2VJQA 3EQ9A 3QWBA 3AILA 2FLWA 4OQNA 4P08A 4UJ3A 2VQ3A 3ROXA 2ATXA 3AMVA 3ZLUA 3OP4A 2I4TA 1T0JB 2FRDC 3DGFC 1D6JA 1UWCA 3O84A 3QWAA 4CKYA 1SG9A 3R3UA 1M33A 3I09A 2J4DA 2X77A 3UQYS 1DLJA 2NLOA 4CEIA 1JUDA 3E3LA 4ZI7B 3UJAA 1R0LA 4LXXA 2F8LA 5BSRA 1WS6A 3ILXA 1MRSA 2VHTA 4XGQA 5KKCA 4RZ3A 3LYLA 3THWA 2GTIA 3NEAA 4XX1A 1TCUA 2B36A 2AZDA 3AGPA 3EVEA 5MN4A 4F9TA 4KO8A 5IJ0B 4OLBA 3TZHA 2JIOA 1H4SA 2IS2A 1C8KA 4F96A 1FYVA 3NKLA 3GR1A 4RBNA 1TK9A 1WAMA 5KDOA 4K9LA 1Y1KE 2YV5A 4DIDA 2Q1WA 2PH5A 2Q4TA 3EEFA 2Z6UA 5LQKA 4KNVA 1SOUA 4L76A 3HU2A 1A5TA 1M1NB 4MH4A 3UMJA 4EPVA 4O4JB 1UJ6A 4GI7A 4GVXA 2XOEA 3V4SA 3ZZ0A 4D80A 1RIIA 2ZR8A 3QKRA 4DBLE 2MR6A 3JQAD 2O54A 5CFPA 1XNRB 4HGNA 5JAQA 1JR3A 1ZI6A 2QA5A 1NUPA 4M9UA 3JR7A 1K75A 4LFAB 3SI7A 3NV9A 1M10A 5KYGA 3QVMA 2CVHA 2ZULA 4UU7A 1R6XA 4KYIB 1OXKB 4R3UC 5EXXA 4CGYA 1U8ZA 1GNPA 3C1AA 4LDQA 2BH1X 5IABA 4RTPA 1W36B 2CJWA 3MCWA 1FJXA 1NMSA 5TSDA 1HNWB 3WDKA 2W2LD 1T0HB 4OM8A 4HVCA 2F9FA 3MXOA 5BUCA 3EWNA 4KXLA 5A2QA 4CL8A 3M89A 4OX9Y 5H3CA 4R9RA 5F7OA 2GEJA 3R5JA 1FS5A 4F21A 4FEGA 5FJIA 1YO6A 3D0KA 2IYLD 2GUWA 3ESBA 3NH6A 2ONCA 1I1NA 2X40A 4AP5A 1PR5A 5DGCA 4HPVA 5B58T 2BF4A 1JIQA 1U3GA 2JJQA 4PRYA 4G0OA 3CH7A 4OJMX 3IAUA 4PRZA 1P2FA 4NNOA 1V7ZA 1N33C 2XW6A 2HA5A 2PFGA 4ZVQA 3O82A 2ZDGA 3ZDEA 1DCMA 1A8IA 1Q1NA 1VRCA 4B6JA 3C39A 4YH1A 4GDFA 4UD6A 2BBWA 1E9EA 3WNDA 4HRAA 4CMCA 2OOSA 2QX4A 4GECA 2JHGA 2LTAA 1Q1EA 4E7OA 3LA8A 1KO4A 1TVCA 2QIPA 3MERA 1CT9A 4LGCA 1P1JA 2M5OA 2D4AA 3TGLA 3UEOA 1XTTA 5IZ4A 1U0JA 3EGIA 3QY0A 1M2VB 3W3AD 1PJ8A 5CD9A 2RGAA 2B61A 1DUVG 4UEJA 2D00A 4DQVA 3ZDAA 4BATA 4CDRA 3R9WA 4QZVA 5GZ1A 2ZEJA 3LFHA 4IG4A 1K5DA 1KI2A 1MAUA 1NRIA 2PO5A 4ERXA 5I4CA 1J70A 2Q2NA 4NYMQ 2CXQA 3NB0A 4FSHA 3TR6A 1YS1X 2HK6A 5JIBA 1NVBA 2GA8A 3D3WA 1E3WB 2BN4A 1RXEA 4MGKR 3Q3JB 4FJ2A 3NHAA 1DJPA 1AQUA 3RHSA 1GGFA 1U9IA 2JCBA 1VSUA 2Z5GA 3HBNA 3RSGA 1PJ4A 2WJ3A 1V16A 1SXIA 3QSGA 4FEYA 4MWBA 3AY3A 3LQKA 1E6UA 3FNHA 4M99A 1UBFA 1O57A 2KZFA 3ICWA 5CNJA 1LNQA 1QIHA 1IXRC 2UU9B 4C0QC 4MV4A 1EFVB 2AOVA 3HZRA 2LV8A 1LUAA 1F4PA 4I4NA 2C78A 3AB3A 4PLYA 5JG7A 1KI9A 5DBEX 4K2AA 3ET4A 3QXXA 4CGZA 3NHWA 1D3AA 1FNMA 5ALUA 5I7FA 2F1OA 4LVOA 4ESEA 3T7DA 2C3PA 3OEHA 2VLBA 5IM4A 1AA9A 1H2AS 3C8DA 1JQKA 3W5DA 2QYSA 3CG0A 3GNSA 5IZCC 1POXA 4EO7A 2R79A 3NIFB 5LA6B 2BJVA 5I47A 5EIWA 1TYEB 1SQGA 1E6EA 1RZUA 2L82A 4D82A 1T4DA 2I1LA 2OM2A 3MGBA 4OSEA 5JCOC 5JAPA 3U16A 4YP1A 3KETA 1TU3A 1L3CA 3FTNA 2GXUA 4D4JA 4FYKA 3K0KA 3QNWA 3TD2A 2C5BA 4HAZA 1CUBA 4MS1B 3SHQA 5H4GA 1UR5A 4RIIA 4YMLA 4X3OA 2WUVA 4TTPA 3AI3A 2G1AA 4YIHA 1LNSA 4U5QA 1MX3A 3GDFA 5K0SA 1JS1X 2WPDD 4LJ6A 2VRCA 3I5YA 1O5TA 3HRIA 1PU2A 3CUKA 4G2TA 3N8NA 1SVOA 4FDTA 4V2UA 3HCFA 2IGTA 4LS3A 2BM8A 4LYDA 3OC0A 4I50A 5JZVA 3RRZA 3ZIDA 5CEFA 1AK1A 3DE5X 5K6TA 1OU4A 3PX7A 2J9XB 2XZOA 3DQQA 3JQEA 1MP0A 2X7HA 4JMLA 4K3UA 3KNZA 1HL3A 4ZOLB 2CGEA 5IG2A 1IY8A 3STYA 4BMVA 1S3SA 3AUTA 1RWWA 4L7IA 2W58A 2H2WA 1JDVA 1ORDA 3L02A 5DTJA 2NYVA 3FOZA 1M8PA 2W43A 4KOEC 3E5NA 4BGVA 1TK3A 1KJZA 1K86A 1NW8A 4MOWA 5FWYB 3U7QA 5FEUA 3L6RA 5KTRA 4PU0A 4OL9A 3PE4A 2X6TA 4DCPA 5I8PA 4R7TA 3JU3A 4K3VA 4N4AA 1MO5A 4MI3A 4O2AA 4WUVA 3MK31 1J06A 4I81A 5K1ZA 1NW9B 2ZUDA 1EU1A 3C3MA 1W6UA 3B38A 3F6SA 1QR6A 3S8EA 1S2IA 2J0UA 3RJ5A 3M4XA 4IOMA 2BP7B 3IAS1 3I62A 2FPLA 3FJYA 5FYDA 3OPYA 2O3QA 3LLMA 5HFAA 3PD7A 3CRVA 2FKNA 4PXSA 4D0SA 1CJVC 4BMSA 2DZDA 4ZT5A 2D13A 4MDEA 3HGQA 3L1IA 3A2KA 4LXYA 2FF5A 4TL6A 3OU6A 2O1SA 3PNPA 3GIWA 1GOTA 4XM0A 3NOXA 3L40A 5ALNA 4B82A 1CHNA 3WLEA 2HMAA 2OZPA 5E6RA 3A14A 2BGLA 1T8TA 5JR3A 2PZJA 2D1YA 4DWOA 2NACA 4ZQBA 2BZ0A 5G0UA 1XVAA 1XZAA 2PD4A 4RA6B 3VVCA 3SS9X 2OYCA 1H5QA 4IUDS 4N12A 1N2ZA 2REQA 3H5WA 4WEQA 2JZNA 1HYGA 1N5JA 1YL6A 3EW9A 4IEIA 2O4UX 4LV6A 4IJKA 4WNAA 5DNAA 1N36C 2G6TA 3WA7A 4V0RA 3DB2A 5KDLA 4HQOA 1KI1A 3I1FA 4TV8A 4DCGA 2PRZA 2PEZA 3IURA 3WMRA 4BQSA 4IOJA 1VCMA 5IN4A 2G06A 1FU8A 3ORFA 1HK7A 1NLYA 1Y3DE 2WNSA 2W48A 3PDIA 4CKEA 4DL9A 3FVRA 1KIFA 3GLGE 1JXOA 1YR7A 3ZDRA 1GKUB 2I7TA 3AM5A 1WMDA 1YVUA 4EJSC 3K5PA 1W93A 4FFBA 1ACJA 4WZ6A 2GFIA 3W9UA 4WXHA 4D0LB 1XEWX 4BGUA 4GRIA 2X0FA 4TXJA 4ED9A 3EPHA 3A31A 1RPNA 4FOTA 1UPXA 3KLNA 1EM8B 4CLXA 3WK9A 1HR0C 4BPRA 4RJLA 4BCDA 2F48A 3UJCA 1K0UA 2H1SA 1E9VA 2WTMA 1OX5A 3NANA 1SUEA 4GPIB 1IZ8A 4XA8A 1VCNA 3FNIA 3GEPA 3MT0A 4X54A 5A1JA 1EE2A 3HQ4O 1KRHA 2KLBA 5JARA 1J8DA 1ESDA 1S2DA 3RNOA 4IS2A 1PZXA 5BQOA 3QBVA 4CTOA 2VAVA 1RAFA 2JGAA 3QHPA 4ND8A 3CX4A 1L5KA 3DZKA 4OXQA 1NUTA 3FLMA 3GPLA 3EHDA 2JS7A 2ZZNA 1LRJA 5TGDA 4HX9A 1JTFA 4I6GA 2DYJA 4RK1A 6ADHA 3UZ0A 1U9IC 2OAQ1 1F60A 1FUKA 1CFZA 2HBQA 3HBJA 3K09A 2GAAA 4HTAA 5C8YB 3JQFC 1XFAA 1DBSA 1OR8A 3PWTA 4PX2A 5DYGA 1P77A 5LB4A 3EAFA 4ZAWA 3QXSA 1KOFA 1JHRA 3I76A 3JQPA 3KBOA 1ZM7A 2BKAA 3RTCA 2YHSA 3K35A 5DNWA 3SXUB 2OO7A 2OO5C 3S8YA 2JFZA 2WSBA 2Q5QA 2ZSEA 1Z39A 2WDPA 4DIOA 4BUCA 5E7IA 4LJ8A 1Y8ZA 1WMBA 3K31A 4NECA 2DTXA 2AK2A 3OJFA 2VXCA 2VF8A 1QFYA 2IUTA 2Z1NA 4XPIA 3PVSA 4URFA 4DDUA 4FGSA 2RAUA 4MIOA 1DV2A 3DP7A 5ALHA 4E5PA 1GG8A 3UFXB 4GOJA 2BAGA 1GAJA 5I4BA 2XQVA 4YAUA 5KTYA 3ICVA 1DWOA 1VG8A 3SJBA 3CIFA 3OOHA 4FJ1A 2L2QA 1PQ4A 3E3NA 1G18A 1QK4A 2QLFA 3R1IA 4NYJQ 1CUZA 2P1ZA 3PE3A 4FGWA 4IG9A 4U7WA 4CMBA 5JJ5A 2DLDA 3V80A 1XGKA 2GCPA 2ODPA 1WRBA 3LYUA 3D6UA 2ENWA 2Q0XA 3VC3A 1YZTA 1R3UA 2JAXA 3U17A 1NGSA 1R12A 5AJZA 1LW7A 3B1YA 4BAZA 4DBVO 3CMMA 3EW7A 3E2MA 1GCUA 3VNVA 1P3JA 3UMVA 3EWSA 3OZIA 3PNYA 4QWMA 4GMKA 1POWA 3HA7A 2YWCA 1EFRD 1K7CA 4C7KA 4BQEA 3EC1A 2JVJA 2AYZA 2PPLA 4L08A 4KO1S 4ENQA 4FXOA 2PUEA 2OBLA 3O94A 3CNEA 1JU9A 1THTA 1GXSA 1NJ6A 3EZXA 1VLAA 1QFXA 3D6MA 3L9WA 2WWWA 4L72A 4L0DA 4Q5IA 1OIWA 4AP9A 1SOWA 5L3QB 1KOGA 1JAXA 1O97D 1CY7A 2XCQA 2QQ5A 4HB2A 3T3EA 1ONOA 3BMCA 4M7PA 4YJFB 4BWFB 2O8BA 4WUTA 1KRWA 2X86A 4Q4HB 2WM8A 2OAP1 1TQ2A 5FUVA 3HVKA 1SO8A 2HSJA 3MLBA 1SBYA 2PXXA 4OYRA 3LPDA 3O6VA 1DT5A 1E2FA 4I1RA 1USPA 2CLMB 4QDTA 4TKVB 4UVEA 2V0GA 2Q3MA 2EZ4A 1JHUA 1FX0B 1N7HA 2JDIA 3V8BA 5ALVA 1CVIA 1V45E 4FU0A 2PUDA 3WK5A 3GV0A 2UZ0A 3RJZA 3VH3A 4J7AA 4JGGA 1JLHA 2W71A 3HRKA 4PLWA 3ZKAA 4QYIA 5IVHA 2WWYA 4ZT4A 1LCIA 1TDJA 5G3YA 5LZ5A 2AS0A 2WTEA 1P5HA 1QB7A 2EV9A 4J3FA 1MT0A 3GPIA 4FN4A 3EZGA 3KZKA 3REQA 4JR0A 2LVBA 5KTKA 3I6IA 3R5KA 1LBTA 1R00A 3OCZA 5AJWA 1IBCA 1UKCA 2EFDB 2FEAA 4O1MA 4RSMA 4EG7A 5EIXA 2BMVA 2Y0BA 3QVLA 4GM1A 3WIOA 1MB3A 5D00A 1E4OA 5H16A 3VX4A 2Q6VA 3PEWA 5CD1A 1ZCBA 5EWJB 2GOYA 1Y0BA 1JMKC 1R1DA 3B1FA 4QBGB 1ND6A 1FDVA 1HE1C 1NMEA 3DOEA 4BB6A 1G2QA 1Y4ZA 3SDZA 4PG6A 4J1NA 1RRFA 4Z4QA 1CB7A 1S9DA 1WQ3A 1L1EA 1N3IA 3T7EA 3U09A 3QH4A 4KVAA 1WMEA 4PQEA 4TN1A 3PUHA 2DX7A 2H5EA 1M75A 3F47A 4GGOA 4AY2A 1UJNA 5AK6A 1UBEA 2FPPB 4KV9A 1CJSA 2BTQB 1FMTA 2H92A 2MMAB 3BICA 4KX5A 2HGSA 4QOIA 4IILA 2AH5A 3AYZB 1QV6A 3A05A 4FFLA 2DLCX 1QUEA 1S3IA 2G07A 3Q7RA 1JBEA 2GVDC 4YRSA 2UYYA 2HXYA 3CVOA 4Z1OA 4UTXA 2V9PA 2XXAB 1KDPA 1A50B 2R8XA 3KXPA 1YMUA 2MYUA 5DX8A 2VQFC 3DLTA 1T9BA 2P1DA 4JEHA 5AJYA 4NZZA 3FNQA 5L4NA 2D62A 2A1IA 2LBPA 4C06A 1F1BA 3LZDA 4ENTA 2IPOA 5LA6F 1MO3A 4PYJA 4J49A 1NWHA 1Z8NA 1WUYA 2CFCA 3HCEA 3QKSA 4G1EB 4JCCA 3PT9A 4HWSA 4X97A 1ZMRA 5JTUA 2A5LA 3OVMA 1RZRD 1T1RA 4WDQA 1H6CA 1UBJS 2DB3A 3OEEA 1KZYC 5B2FA 3PIIA 5BWOA 3O8QA 4ZDWA 4HDMB 3GGPA 1R16A 4LDRA 3ZU6A 5ULLA 1KS2A 3DV2A 3IAM1 5HK9A 1QBKC 1IYZA 5HVNA 5F1PA 4ZYXA 3IALA 3L79A 3UN1A 2HIAA 4WA8A 2CK3A 2UYHA 3KV3O 5ILQA 2J9FA 4KXXA 2IU3A 1XI2A 2V03A 4TLLB 2B34A 5D3ZA 2JCXA 3TPCA 4ARCA 3D2LA 3L0DA 3VJKA 1ZIDA 2XEXA 4LVNA 4TZTA 1KL7A 3VDRA 1W4RA 1WF3A 1FBNA 2HZ7A 4B3DA 2AUTA 1DPFA 2OM6A 4Q3NA 4UQOA 1VGRA 4M1ZA 3BX1A 1PL8A 1JNYA 1C1HA 1DKMA 2AE1A 2O2CA 3NLLA 2PR2A 4MWSA 3ZDZB 1Q7CA 3MRSA 1GARA 3JYNA 3NVMB 1FLVA 1KI3A 2RG7A 3MFYA 3PE6A 5KYVA 3HDQA 3K32A 3CKYA 4ZRNA 4P32A 1HFJA 3DDSA 2A5GA 2X0KA 2PH7A 5MHTA 3P0FA 4CDGA 1UK8A 2ONKA 3F5FA 6YASA 4E5SA 4HOYA 3DUFB 5GMOA 2QZPA 4ZVKA 1E1DA 1KBOA 3Q87B 4HQ6A 1CUHA 4JNCA