4DCVA

Crystal structure of b. subtilis enga in complex with gmppcp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
434
structure length
402
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARARK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 130
structure length 402
sequence length 434
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcvA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcvA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcvA01
1AQUA 1NVXQ 2B7BA 121PA 3JZAA 2O8DB 4L16A 3AVVA 4HDCA 1A2KC 4A6PA 2IWRA 4RSGA 3PCRB 2X77A 2GEDA 2XOKD 3AUXA 3CH4B 2ZRIA 1CJTC 3F0TA 4XD7A 5DI3B 4CT5A 4C7OA 4F4JA 2W6IA 4DR7C 1YR9A 5FH9A 1E2LA 5IT5A 2GESA 2Z0MA 5SZKB 4A2PA 1SVMA 4KBFA 4BLPA 4ITRC 2XXAA 4LF4C 1XD2A 1DBSA 1DEKA 2GVZC 3CONA 1NYEA 5FLXD 4HZUA 4BUJA 2JJ1D 1XNRC 4R7ZA 3ZDQA 2ORWA 1KDPA 1KKLA 1NI3A 1ZNWA 4JLNA 3R9WA 3CWZA 3LDAA 4Q9KA 1DG3A 3R8FA 2FJUA 4URVR 1TEXA 1XXHE 4QJ3A 1R0YA 2ZJOA 4FD2A 4C0KA 4QBIA 4C0SA 3T5DA 1S1MA 3IO5A 3R7WB 1SVSA 4RFSA 1BKDR 1XMVA 4TSFA 4B32A 1KY3A 2OBLA 1ZMXA 1JNYA 1ZAKA 2QU8A 3GJ7A 5B57C 5L3QA 3ZD6A 5BR8C 1HQYE 2QRZA 3FYHA 3DOEA 1QVAA 1E2NA 4LBVA 1HE1C 1CJUC 3IEUA 4JBWA 5JS7A 4DR3C 2WJIA 1G8PA 3KB1A 1K5GA 4W5WA 4UNRA 4MUAA 1K5DA 1ZBDA 1G8FA 2ZJ5A 5JLJA 2D7DA 2QROA 1FX0A 4O25A 2VPPA 2IS1A 4D6PA 1E4YA 4D80A 1G9XA 1Z06A 4C3ZA 2BMDA 4YDHB 4ZIRB 4A15A 4RZ2A 4Q00A 4DRZA 2GAAA 1Z5ZA 3P1JA 3ZLJA 1R2QA 1SZPA 4MRSA 1C4OA 2JLVA 4LV6A 2F3TA 3C41J 2XB2A 2FPLA 4PR0A 1Z0FA 1R5NA 1IBMC 2ZSEA 3U3MA 1EX6A 2JAQA 1E0KA 3KQKA 3DO6A 3RVBA 2IYZA 4C4PA 3EX7C 2FA9A 3H4MA 1P61B 2XSZD 4KSCA 5FTMA 1OFHA 2C78A 2W2TA 2QE7A 1A4RA 3W3ZB 1KSFX 3SYNA 3HU3A 3KTAB 3VHXA 4LJ5A 4MQBA 3CZQA 5J4HA 4KVAA 2QPOA 4NZYA 5TXGA 3RYTC 1E1RA 2QN6A 2JIZA 3VKWA 3MMPA 1U98A 4LHWA 3FPAA 4OK6A 2CDNA 4DCTA 3DPUA 3A1SA 4JLMA 1J8YF 3ICQB 1CR1A 2EFDB 2IYTA 3Q7PA 2F55A 2G77B 1XFAA 2V9PA 1TF2A 2J5XA 1DE0A 5KPJA 4OK5A 1J5EC 1E94E 5CM8B 1G3QA 3CWQA 4BFYA 4EPTA 1KZ7B 1FQJA 2ZS9A 4LYHA 2MMGA 2WJYA 4PPGA 1W46A 3NXSA 1CXZA 4YMVA 1N6HA 4A4DA 5EZ6B 1IN5A 4GI7A 3LO5A 4GBMA 2YWGA 1P2TA 2VL7A 3UXMA 1N36C 3ZYCA 3R9XA 1TU4A 3OHMA 5HE9A 4M0LA 3BC1A 3DOFA 3C4JA 2QORA 5E7MA 4ESVA 2DPXA 2ZR7A 3A36A 2IYQA 2P67A 1GZSA 3A1VA 4PHFA 1IXRC 3VNVA 3AF2A 2H7VA 4OI2A 2R44A 2NTYC 2RGNA 3QKUA 2OT3B 1VIAA 4FWIB 3WBKA 3WYFA 1CF4A 5DN6D 1HV8A 3KFVA 4YDSA 5JEEA 2AFHE 2RGXA 1R0XA 2DCUA 1KI2A 4LHYA 4IJMA 1PUIA 2V4ZA 4K46A 4MKGA 4JI0C 1NRJB 3TSOA 4B3FX 4BE7B 2L0XA 4TTPA 4AD8A 4EPVA 2FNAA 2GTPA 2GNOA 5FUYA 2CK3A 4NYMR 3B2EA 2WPDA 3OEHA 5IK2D 2J46A 1JPJA 1IN7A 1XJQA 2OE2A 4DT1B 2VHJA 4IEIA 3OESA 3ZZ0A 2ZM5A 1QHIA 2C99A 4C0JA 3I72A 3B82A 3IGFA 2PCJA 3D31A 4Q4AB 3O8CA 2V7QD 1OKKA 2NPIA 3KJIA 3X1DA 3WYGA 3F5FA 3U44B 4V0MA 1UEIA 1SQ5A 4BFSA 4IHQA 2A5JA 3IBGA 2G6BA 4TL7A 4Q19A 2XJ9A 4LJYA 5GVRA 1UM8A 4NBSA 4HEJA 4C0QC 4CF7A 1KNXA 2PJZA 1MRNA 2QSZA 2WAXA 1JR3E 2R9VA 4IOJA 4LYJA 5CK4A 2IBMA 2XNDD 2YVUA 4BLRA 4A1FA 1VG1A 2UUBC 3ONWA 3Q85A 4HB2A 1ZD1A 4IXMA 4IOMA 3FHCB 4KAXA 4MTNA 4YY3C 4AKGA 1O87A 4DDTA 4QNMA 5EUQB 1TL7C 4MRRA 2EGTA 1NLZA 2P2LA 3KZ1E 2JEOA 4FCVA 3IQXA 1LNZA 1CRQA 5EP3A 3TRFA 1Z0AA 1G64A 3IQWA 1N6PA 4JLPA 1RJ9B 5F9HA 1G18A 1HH4A 5FBVB 4NP6A 4B73A 3B1XA 1JXMA 5CB6A 4HLUA 1DADA 4QHSA 4XSGA 3GD7A 4D4KA 4ZCMA 1ZIPA 1J8MF 2ZJYA 3DKVA 3TK1A 2FFAA 1OH6A 3KX2A 5C46F 1VMAA 3ND9A 2OPLA 4AG6A 1H8EA 5JFGA 1VYVA 1TU3A 3E2IA 1XCGB 4K8OA 4YMSA 1ZRHA 3EW9A 1QG2A 5CJ2A 4JSYA 1MKYA 3CNOA 4EJSA 4ESHA 4A0GA 2ZUDA 5JWHA 3W34A 4Q4HB 4QRHA 4R2HA 1D2EA 5FI0B 2QGNA 2ZRJA 2ZJZA 1P73A 3LBHA 1E2FA 1P6XA 2FGJA 2GDJA 2ZI7A 5KSZA 2ZI5A 1AN0A 1TADA 1LS1A 4PANA 2VP0A 5TDHA 1E2EA 1SHZA 3SJBA 4JL6A 2J0UA 3THXA 3IPXA 2AD5A 4O0MA 4E03A 4DB2A 1JR3D 1N2CE 4OQNA 1VCMA 1BIFA 2JDIA 1VG8A 2EU8A 4MDEA 4P4SB 4XTCS 1XF9A 1Z0JA 1NY5A 1Z28A 3LVQE 1TQ6A 3LX5A 3CLVA 5DSZA 4IEEA 2JJ2D 4BZPA 2EFHB 4Q7LA 4CRWB 3QE0A 2OCBA 1MABB 2D74A 1X1RA 3GLIA 1NMXA 4CEHA 5KDLA 2NO7A 4E5UA 3QKRA 4TWZA 1ZD8A 3HYTA 3ADCA 2OV2A 4G5QA 2ASEA 4KBGA 1G16A 3CX6A 4CZ2A 3WP0A 2F43B 3LW7A 1DAMA 4C0AC 1G5PA 4DV5C 2CLSA 4US1R 3WRXC 1OH5A 2QA5A 2G9NA 1FNNA 2X19A 4JSTA 1L2FA 1F48A 2C9CA 1SKQA 4Q7MB 3MAAC 2A9KA 1W0JA 4ZDKA 1CJMA 2WMNB 4B6EA 3NDPA 4YC7A 3PFIA 2O8BA 1GWNA 5EP4A 2O0HA 2CHGA 2ZSBA 1UJ2A 1XRJA 5FOVA 2IA5A 3TE6A 4TMXA 1G4UR 2FG5A 2R8RA 3MWKA 5CIWA 3K09C 1N6LA 3BS4A 1DVRA 4Q1BA 3U3JA 2WICA 3UPUA 4B75A 3T5GA 2O0JA 4FMCB 5BWMA 1CP2A 1VDZA 4D0LB 2N1BA 4X8LA 5H68A 1OHHA 2IYLD 3EA0A 2VSFA 3U2QA 1SHKA 2PN2A 1XZQA 4RD1A 4CVNA 5SZJA 3K9LA 1XTIA 4NYJR 2XZPA 4D4MA 2CHVA 1U94A 1Z3IX 2ZYWX 3EWSA 5HZHA 2VP2A 4TZ6A 3CF2A 3CF6R 4L15A 1US8A 5E7JA 1OV4A 3FHOA 1JBKA 4PC2A 1KK0A 5EJEA 1W4RA 3GLFB 3WHKA 2QP9X 2ZU0C 3K0FB 4A2WA 3K1JA 1COWA 4FMDB 2WKPA 2VYFA 1P3JA 1RYHA 3A58B 3LXRA 1KZGB 1ZCAA 1AKEA 4HB3A 3EPJA 3KJHA 1PLKA 1XBTA 2V6IA 3AM1A 1SXJA 3EIQA 4GMDA 1OLOA 4F91B 3THYB 2J3EA 3ADKA 4KYUA 5DLQC 4M1YA 3SS8A 4JV5C 1OXXK 4IVQA 4LYAA 1LQLA 4M2LA 4OK3A 5GADl 1F2TB 5JZVA 1P2VA 2R6CA 4BRUA 1PZNA 2Z83A 1GAJA 2BEJA 5KUTA 1W5SA 1XCMA 1L7VC 4WW0A 2OILA 1OYWA 2ONFA 1OFTA 2XSZA 4HUTA 1HNWC 1X8JA 4A8JA 1MRSA 4URXR 4Q1EA 1U0LA 2GCPA 2ZVQX 2P6RA 2ATWA 1VCOA 3SYLA 1NIPA 2C03A 1G3RA 2R65A 4IFBA 5DO9A 3FKSD 2Z43A 4AG5A 3I5YA 2ZE5A 5TARA 5KU1A 2PBRA 2JCSA 4Q48A 1EFHA 3TR5A 5AWFC 4LI0A 5FUWA 2WIBA 4QBHA 2VTKA 4WXPA 3C8UA 1YRAA 5IDVA 1KTVA 1N6NA 2RAPA 4OI4A 5FOUA 3RS3A 4Q4JA 2HYDA 2GCNA 1K0RA 4DKXA 2IC5A 3BBPA 4JI5C 3U6BA 3TVDA 1OXUA 1KI6A 2A7QA 2DWPA 3TNFA 3MUFA 4CEIA 3OZXA 1YZTA 2XB4A 3DDCA 4BFWA 3T35A 3R20A 3QF4A 1AGPA 4Y0AA 1RKBA 1YZQA 1B23P 3EIEA 3VTKA 4DXAA 2Q3HA 4JL5A 4LJ7A 4PSKA 4JL8A 3SR0A 3LBNA 2HEIA 4JI4C 3BH7A 1KOFA 5LB2A 1UDXA 1VIYA 4FCWA 1HT1E 2W6JA 3OIUA 821PA 1B0UA 4PQYA 2FOLA 1XD2B 2GRJA 2VP9A 3GLGA 4QGFA 5JJKA 2ZAOA 1QDEA 1XMOC 4HZUB 1ZC4A 2EFEB 2KE5A 4JVSB 3BIFA 5KNBA 1KDOA 3MLEA 4PO1A 2WJHA 2ZXUA 1T4GA 1CJKC 1HTWA 2E8EA 3QKTA 2GJKA 2XZOA 2BEKA 1X6VA 4AK9A 4NKRA 2HLDA 4TMTA 4J0QA 3Q72A 1G6OA 3AUYA 3FKQA 2DWQA 2FV8A 1JEDA 1AQYA 1BYIA 5EZ5A 4G5RA 2P6NA 1CR2A 1TEVA 2ZTSA 3ECCA 1MO5A 1KI8A 5CYOA 1ZM4A 2JJ8A 3TKLA 5L3QB 3SHWA 1QHXA 4DDWA 4TYWA 2WV9A 1ESNA 1GUAA 4EUNA 2H1LA 3O47A 1IXZA 2REBA 2GWHA 2GK7A 3P32A 4Y0VA 2CJWA 4LHXA 1N5KA 3K70D 2G83A 1TF5A 4V0NA 3LLUA 2O8CA 5BN3A 3DMDA 3LVRE 1WE2A 3AGPA 3KJEA 4DV0C 2YHSA 2V7QA 3BXZA 3RANA 2ZRDA 3MRSA 3OAAD 1Z47A 1N33C 4P3YA 2R2AA 4EFLA 3GP8A 3N2EA 3OFND 4H1UA 2IL1A 2UXCC 1HH2P 2B7CA 2HT6A 2OAP1 3RS4A 3SNHA 4L8GA 4NPHA 5DE3A 4Z1MA 1ZCBA 1NVWQ 3P27A 2A5YB 4L4UA 1XD9A 4OHXA 2WWWA 3LUSA 4KXFB 3UKDA 4Q02A 4DLYA 2XR1A 3MWYW 4MA4A 4F7WA 1XPUA 2XNDA 4TL6A 1GILA 3AGQA 4JBYA 2QEQA 2P65A 4UQOA 3GLHA 5IWAC 2BHRA 4BSZA 1HEIA 2IXEA 4GZLA 5CDFA 4BGDA 3OIWA 2G3YA 4N3NA 3UATA 3I4LA 2QENA 3ZH9B 3NWJA 1GL7A 1YR8A 4QKQA 5IHPA 3B85A 3U60B 2R6DA 2A30A 3Q7QA 2AFIE 4GOKA 1HR0C 3SYKA 5FPYA 1JJVA 5KHOC 4GDFA 1QHGA 4URWR 4V0LA 1GL9B 5JI2E 3AVQA 1QWIA 2IX3A 4PC7A 1U9IA 3T1VA 4KYIB 4XWAA 3QNUA 8OHMA 3ICEA 2QMOA 4B35A 2BOVA 1UDWA 4URZR 2YV5A 3LWNA 2QM7A 5E3HA 4Q66C 2FGKA 4PSVA 2YC4C 4E07A 2PT7A 1WBBA 2J7PD 2DB3A 3SC3A 1BMFD 3KQHA 1E9FA 1ZC3A 3HYRA 1OB5A 4PZYA 3DL0A 2BCJQ 4KFTA 2H16A 3I73A 3V4RA 1GRNA 2EFCB 1E9EA 5HTKA 2YC2C 2DHRA 3BFXA 1CIPA 2GF9A 5KNCA 2UZIR 2O8FB 3FB4A 4LF6C 4QGHA 1GVNB 3CPJB 3TAHA 4W5JA 1RPZA 5FBRB 3H1TA 3I5XA 4N0DA 1II0A 1IHUA 3GJ0A 3KL4A 4TT3D 2GJSA 5FR2A 3A1WA 1LW7A 2HF8A 1ZNZA 1F6BA 3PEUA 4OHWA 1MO3A 3QG5A 5CYPA 3FWYA 1UKEA 1X1SA 2D2EA 1RRFA 3CRRA 1JALA 2FZLA 4O3MA 2BV3A 4PX9A 3FMOB 5BYKA 3QJYA 4NDZA 4P0TA 3U7GA 1T8TA 4TLEA 2DFLA 4KHZA 3W5JA 4DWJA 3NHAA 2QZ4A 3B1ZA 2IXGA 2XGJA 4Q4LA 2IHYA 5LBIA 4DV2C 3VR5A 3QXJA 3MGCA 2DFKB 1ML8A 2G1JA 3QENA 4QOSA 2GHIA 2QMHA 4E22A 1M7HA 4C2TA 2VP4A 4C30A 3IIKA 4XX2A 3IHLA 5IF9A 4PPFA 3ETLA 3EA5A 2VRWA 3TJZA 2IYYA 3QY0A 3UG6A 2E8CA 4CEJB 1CR4A 3KQNA 4M1WA 4B74A 2E1RA 3C14C 4AKEA 4B47A 4LPSA 2F3RA 2HXSA 4RFVA 5DHFA 2YOFA 2C5LA 2KB0A 2JLZA 1V5WA 3S1AA 2ZYVX 2EFGA 2HHHC 2W0SA 1IJEA 4UNNA 1OFIA 3CPEA 4G1UC 4LJAA 5FBQB 1XMSA 5FI1B 4PTLA 3NTUA 1G5RA 1YRBA 4HLDA 1JJ7A 2OFOA 3B60A 4O2LA 1XB2A 4HLCA 2VBCA 2DYKA 3CJEA 4GP6A 3VAAA 4G01B 2DFNA 1WF3A 1Z07A 3PUXA 2IYSA 1QHHA 3QBVA 1WA5A 4JT2A 4QG7A 3I3SR 3SI7A 4QL3A 2PEZA 3MJHA 4FN5A 4V02A 4QFMA 3CM0A 1J7KA 3AEZA 2O8EB 1G8YA 2O5VA 2KWIA 3REGA 5DIFA 2YOHA 3E70C 1HNZC 1YR7A 1KMHA 3TUZC 4BPBA 5KDOA 5EP2A 3A4LA 1MV5A 2GXUA 3TIFA 3PENA 4P4UA 3WMGA 1KNQA 1T5IA 1JQJC 1EFCA 3QXSA 3T1OA 2D7CA 2ODBA 5BXQC 1YHNA 1LB1B 4R98A 1IAQA 2OPLB 2PZEA 5GJWC 4G3XA 1M74A 1P2UA 3EZ9A 3F8TA 3K70C 2H57A 2GEVA 2ZUBA 4EJSB 4GKKC 1EESA 4DV1C 1ZW6A 2ZEJA 2O52A 3U4QA 5ELXA 1BOFA 2WJJA 4IXNA 5TB5A 5HZKA 1NY6A 2JATA 4ZI2A 1S96A 2BMFA 3AF1A 2GCOB 3TUJC 4LJ9A 4AWXA 5UKDA 4ZDJA 4JLKA 3SHFA 3EPHA 1LF0A 4WZ6A 4BZXA 1ETUA 1FJGC 1X86B 3FTQA 5SZHB 1I4LD 5SZIA 2FPMA 3D7MA 3Q9LA 1KI4A 1N6IA 5JCPA 1VLAA 2IEYA 4GSYA 5AUOB 4BFZA 3GEIA 3RS2A 4IKEA 1X8LA 1AKYA 4TQ9A 3WMFA 1XTKA 2GBLC 3IIJA 2VSXA 5DHAA 2IS2A 2DR3A 3U7HB 4KI0A 1XJ0A 1ZM2A 2SHKA 4L9WA 4MYHA 4D25A 1D2MA 3BE4A 3KQUA 2FWRA 2IF2A 1UAAA 3L8ZA 3RAPR 1G6HA 2ZAMA 1KYIA 1NIJA 3EZ6A 4PC3A 2IUUA 5D3QA 3GLIB 4DIDA 1VCIA 4XWKA 3ZVLA 4CEHB 2AR7A 1NBME 3QKRB 1TX4B 3N5CA 2ZROA 3GPLA 2BJVA 5E4FA 1RRGA 5CJPA 2CE2X 1D2NA 1JR6A 1XP8A 1Q1QA 4I1UA 3U3OA 3VX4A 4X65C 1XPOA 3A6PC 1UFQA 4EAQA 3W8NA 4MDFA 2FDCA 3CNLA 3W6OA 2OLKA 3QUSA 1E2IA 4Q9LA 3CNNA 4LPKA 4LGMA 2IYUA 4ZDIA 5JS8A 3H86A 2QBYA 1OIWA 4WAUA 1JI0A 3FOZA 1Z6YA 1E2KA 3RSLA 4BFVA 4YMUA 3I92A 2ZRCA 3D3QA 3H84A 4JYAC 4Z54A 4NL4H 3M4YA 1N5LA 3EC1A 2HF9A 2NO9A 2V55B 4TQAA 4QXAA 4GP7A 2C98A 2G0NA 3CF0A 4XTRA 1E9BA 5J47A 1XTJA 5JJIA 5EQTA 3B7GA 4DLVA 3EZ7A 4P4TA 4KITB 3RRNA 2ZS7A 3QXXA 3PJRA 3OIYA 1KK3A 1W0KD 3B9PA 4GFDA 2DY1A 5J4YA 4C2UA 4TZ0A 2ZQ5A 4M1KA 1E9CA 1TQ2A 4JZKA 1GFIA 3K0CC 3OTOC 2QGZA 4BFTA 4MUBA 2VLIA 1E0AA 1P7CA 3WHLA 1WMSA 2WMOB 1E96A 4YXWA 5EE5B 2F4VC 3BWDD 3FFAA 4IDPA 4HATA 4PO9A 4AI6A 1US8B 1OH8A 1NBMD 1WBDA 2A2ZA 3CX7A 2QUZA 4HZIA 3HJNA 1J2JA 5TVKA 3GCGA 2CY1A 4A9AA 1D8TA 2MSEB 2O0KA 3ZVMA 1JEEA 1E9AA 1WDTA 3OAAA 1OSNA 1W36B 3F3YA 4WBSA 5G40A 1VHTA 1XDBA 4HUQB 3QPVA 1SXJB 4ERNA 2ZI3A 3ADDA 3OFNA 3GEEA 5DNYB 1KJYA 4OYHA 2GKSA 5E7IA 4JKIA 1GRQA 4QBFA 4OHYA 1XX6A 2GVDC 3UANA 1Q20A 1Q1BA 3I61A 1XEXB 1WH9A 3CKLA 3HU2A 4LRWA 5J5CA 1XWIA 3ZIAD 5EXPA 2FFQA 1KSGA 1Z6TA 1BYUA 3DMNA 4JKYA 3LAWA 4LOAA 1CU1A 4A8JB 1H8HD 1SKYE 3PUWA 4B3TC 1HNXC 5K8UA 1SVWA 4DIEA 5G53C 4RKFA 2IWHA 4UNPA 3T1YC 3SQWA 5P21A 1ZB9A 3WP1B 4WVFA 2FZ4A 1JQLB 1A82A 4TYYA 4KFSA 1YE8A 2ZR9A 2BBWA 3GLFE 1E69A 1Q1EA 4LBZA 4P32A 2ODNA 4AKHA 3K0AA 2QAGB 2J1LA 2QPTA 3IHWA 4XJXA 1V43A 4I99A 3KKMA 1KSHA 1W5TA 1GP2A 1L4UA 1R8QA 3ZVRA 5HKKA 5FPHA 1G17A 1AS2A 1KO1A 4UXHA 5DI3A 4EFMA 1EWQA 1LVGA 1KI6B 4CEIB 2WWFA 1FTNA 1Q12A 1Z0IA 1C9KA 2PH1A 1CLUA 3WNCA 1D9XA 3DEFA 3QF4B 4A2QA 4M22A 4CIDA 3R9IA 4LK2A 4M1OA 4JBXA 1W49A 4I1OA 3SQXA 2OUKA 4Q01A 3ADBA 1YU9A 1R10A 2P0EA 1UKKA 1GNQA 4LV5B 3LFUA 1ANKA 3EIHA 1CJVC 4M9ZA 4JYBA 4MRVA 1E1QD 4DEYA 3G0HA 4M1TA 5H70A 1G3UA 4PC6A 3EZ2A 1TPZA 3GFOA 221PA 4Z51A 1XCPA 1K8RA 4LY6A 5GJCA 1EFUA 1ZVQA 3B8HA 3GJXC 2ZYTX 2E7GA 1RYFA 4UXJA 1RE0A 3MD0A 2Y8EA 1TUIA 3B6EA 2OCAA 1T6NA 4B71A 1OJLA 2CL6X 3V4FA 1ZU5A 3SU8A 1AS0A 2CL7X 2XTZA 2NO0A 4ZCLA 2X8AA 5G3YA 1UBEA 2GK6A 4JI8C 5HE8A 3VR2A 2IT1A 3RRZA 3AP3A 3U7FB 2UVQA 1QZXA 3FMIA 3VU9B 4KCGA 2ZETA 4RCZA 4EPXA 5F3WB 3PXGA 3AP2A 3BORA 2UXDC 3N2IA 1N5JA 1W36C 4OQFA 3B1YA 2CJWB 2RGEA 2WWGA 3B13B 3SJCA 1QHNA 4X62C 4IOKA 4XOIA 2O8CB 4OI0A 1OW3B 2GXSA 2H17A 4LYFA 3CIOA 4JVNA 3WXMA 4PZLA 1N3BA 1CRPA 1E32A 1OXTA 4RJLA 4JI3C 4ZKEA 2WWHA 3NKVA 3H2YA 4TMVA 2RKOA 3OIVA 1TQ4A 5KYKA 1UKYA 1GNPA 2GETA 1T91A 5HCIA 1F5NA 1W4BA 1HYQA 2Q3FA 3RNLA 4DLUA 1IY0A 3U3KA 5C4GB 1WP9A 2XOKA 1VTKA 3RABA 1RC8A 4B2PA 4BLQA 5JHHB 5A4JA 3KXLA 2YWFA 1OPXA 2WSSD 5FOSA 3AVTA 4LF8C 4LFBC 2BWJA 2VP6A 1E2JA 1JAHA 1EFRD 2BJWA 4HB4A 4I1SA 3VR1A 2AHOA 3HU1A 1U0JA 3D6TB 4W9MC 4K0KC 1T0HB 2VQEC 2A78A 2JJ1A 4IDNA 3BB3A 1DO0A 4UKDA 4LZZA 1NLFA 5M04A 4A36A 4A82A 1S0UA 1HURA 3RWOA 2QAGC 2RH5A 3FHTA 4RZXA 3VQTA 4QGGA 1FUUA 1UADA 2QTHA 4EFNA 4GKJC 1SVOA 2ECKA 3AF0A 1XMQC 4LF7C 3HR8A 4TTQA 2WIAA 3DZDA 4UXIA 3OEED 3GJ4A 2MMCA 1XMIA 1X3SA 4WZAE 2D4HA 5K8IA 5HR5A 5C1BA 3P4XA 1FMLA 4JT4A 3L0IB 1SKYB 1NSTA 2ODWA 2REOA 4DEXA 1Y3AA 1UEJA 5IT9D 4M1MA 1KDTA 2WSMA 2YOGA 2RGAA 1TMKA 4QJ5A 2B21A 1UBFA 3RSOA 1P9RA 3AQ4A 2JGNA 4HAUA 5BN5A 4KHPC 4ABYA 4JVMA 4TTRA 2C04A 1XMJA 5DISB 3I8SA 2W6ID 4D26A 1Q1ZA 2F1JA 4OX9C 2GZHA 4RVCA 2D2FA 4M53A 5GJBA 3NIBA 2B8TA 1IN4A 3TH5A 2FU5C 3BH6A 4L9SA 5FPTA 3TBKA 2D62A 3KUDA 1IBLC 2YYZA 4B3DA 2YINC 3X1ZA 2FPKA 1OYYA 421PA 2AWOA 2J0QA 1U2RA 3K0EA 2HXYA 1M2OB 2VIIA 5BW8A 3AV0B 4LJ6A 4M1SA 5FBWB 1VG9B 4ZO4A 1F2UB 1G19A 3PEVA 3O8DA 5FBLB 1E2DA 4PQRA 4F4CA 5FTLA 4AYWA 5JMTA 3AH8A 1YVDA 1PVOA 4DLXA 1RZ3A 2J87A 4TSFD 3EERA 3QKSB 4CT4B 3AF5A 2ZSFA 4WA7A 1KO8A 1IJFA 1D6JA 2JLQA 3CO5A 2V3CC 1QRAA 4LC0A 4ASUD 1NJFA 4NXMC 2P3SA 5FTJA 1XXHA 3BD9A 1NVVQ 1T9HA 2WM9B 4PPNA 3PEWA 3THWB 3CR7A 4OKSA 5JBQA 1T3HA 3OF5A 4ARZB 3L8YA 5FR1A 3NC1C 4LUCA 2I4IA 2FX3A 4JS0A 4DT1A 1LF5A 4TMWA 5KNDA 4UJ3A 2VQSA 4B33A 3EPLA 2YJTD 3ZZTA 1E2PA 2R6AA 4Q4AA 5KTYA 5KO2A 4DDVA 2OBNA 2PLFA 3X2SA 1L4YA 4NMMA 3FVQA 1KDRA 3FFBA 4RD4A 4WXRA 2CLDX 2CXCA 2BBSA 2QMUA 3EWAA 4B34A 3U44A 2OAQ1 4NCHA 2B92A 5FOTA 4A0RA 2XEXA 1M6NA 1R5BA 1UKZA 2VF7A 5IRCD 3A1UA 2ZRAA 4DR6C 3P4YA 3P20A 3SBEA 1PJRA 3K09A 1U8AA 4Q5IA 4LDJA 5KSPA 1NJGA 4DLRA 1ZP6A 2EYQA 1GL6A 3NC0C 4DSNA 4BEBA 2YWHA 3X1WA 2F1IA 4C7OB 2DWOA 2LCFA 2AKAB 3S1AB 5JWOA 3A1TA 1GM5A 2BCGY 5GVSA 1XD8A 1W0KA 1U81A 3ZS9A 3Q3JB 3NHBA 1MO6A 4RY2A 1W4CA 4PFSA 4NCKA 3OE7D 2XXAB 3RS7A 1IBKC 5EXTA 1R0ZA 4W7SA 1NN3A 2CCGA 2GF0A 3HPRA 2BBTA 3G82C 2C8VA 4U00A 1RJ9A 4B3RC 3AVXA 2ZRFA 3ZZUA 4D0NA 1IY1A 2LKCA 4QHTA 2B8WA 2D06A 3LH5A 4D4JA 2Q9CA 2XAUA 4URUR 1A5TA 1W1WA 3X1YA 4URYR 1NKTA 5DN6A 2NO6A 2HYIC 5JRJA 4KJZA 2Z5FA 5AUQA 1XEFA 4WIAA 4RFSB 3CBQA 4HB0A 4QHYA 3VMFA 5JJLA 5L3SA 3V9PA 2KI5A 5AJZA 2CMKA 2MSDB 1KO5A 4BZQA 1DAHA 2IHBA 4Q9JA 4Q4HA 4KODA 1J99A 4JJZA 1HE8B 5CB8A 2V6JA 2W2XA 2IEZA 1EGAA 3LXXA 1P5ZB 1OXVA 4V0ME 5IK2A 5DYIA 4B2IA 4HDQB 2HJGA 4ZDWA 4JVLA 1PUJA 4DUYC 3T15A 1Z0KA 4XSHA 2OM2A 4IDHA 1FX0B 4I1VA 2EWWA 5CITA 5KSYA 3LNCA 3I07A 3GFPA 1G7CA 2WBLC 1GITA 1K6MA 4FMCF 4P4SA 2J0SA 3GKUA 4UJ5A 3VNUA 1Q22A 2FFBA 1FP7A 1I2DA 4B76A 3BJIC 4OL0A 3MSXA 3Q5EA 3AP1A 4LHVA 2K5UA 5FPKA 4Q03A 2F1HA 1OF1A 2ZRHA 1I4TD 1WRBA 1RRCA 4KU4A 1ZINA 2CNWD 1KAGA 3GMTA 4B44A 2HT1A 4JLBA 1DELA 1W44A 2AK2A 2ZRMA 2ZSDA 2IYXA 3WRYC 3BRWD 4U7DA 2RB4A 3TSWA 3KFXA 1FUKA 5JWRA 3TVTA 2ZRLA 4MGIR 3C5CA 1E0SA 2WPDD 4GPTA 4HI0E 4DCSA 2QP4A 4K81B 3I8XA 4YQFA 4FMDF 1XU4A 5GJVC 2JLYA 2OG2A 3NEJA 4ZCIA 2VA8A 5EE3A 2PMKA 2IS6A 3TW8B 1ZUIA 3CRW1 4D4LA 4H1VA 2ZSAA 3FMPB 4US2R 1AJEA 1TUEA 2FH5B 3EASA 4TYNA 5HCNA 2DYJA 1OKKD 2AN9A 4X66C 1II8A 2D3WA 2DBYA 3U61B 5C2JB 3AF3A 1OXSC 2RHDA 2TMKA 4BWYA 2QL8A 4GOXA 1FP6A 2ZRPA 2J0VA 3E5HA 3K0AB 3SE0A 1T0JB 1A7JA 3K0SA 3DHWC 2V8OA 2ZJ8A 4Q1FA 4U5XA 1ZNYA 5EXXA 1KJWA 4M4SA 4LF9C 3HR7A 4F92B 1JPNA 3T06B 3T61A 1U90A 3A4MA 1ZIOA 1R6BX 4Q7JB 1FNMA 2QTFA 4LBYA 3QEOA 4QGAA 2WZQA 2NOAA 4A92A 2GAOA 5D3MA 2NGRA 5LDDC 5AJVB 4G5OA 1JR3A 4GOJA 3VFDA 3ZS8A 6Q21A 3IPYA 4KO8A 3GLIE 3QXCA 1WB9A 1GOTA 2VP5A 3ASYA 3GJ3A 2VHTA 3K0FA 1G21E 1KI9A 2GZDA 2ZI4A 4Q18A 2JLXA 4OHZA 4BFUA 2W58A 3LD9A 1YZKA 2JJ2A 1BH2A 2C2HA 1AIPA 1Z83A 4L5BA 4NE2A 1KJZA 2UKDA 5B58C 3HDTA 4JLAA 3LLMA 5LD2B 1H8ED 4KFRA 1RW4A 4RD0A 4LHZA 4LJ4A 3SFZA 1N32C 1E79D 3B1VA 2Z4RA 4G5SA 1O3YA 5JSZA 3U7EB 2OHFA 2OXRA 3NEYA 3FMFA 2BDTA 3C16C 2XNSA 2CXXA 1ZM3A 2H92A 2PLRA 4RZ3A 3TAUA 2FSHA 2NIPA 3BB1A 3NVAA 3VKGA 1CBUA 2F9LA 1T8UA 2QMEA 3ZD7A 4AIIA 3WYAA 3VKHA 1G41A 3ZQ6A 2QAJA 3RS5A 1E9RA 2WSSA 5HPYB 2FSFA 1PA4A 1YJ5A 2QTVB 3J81D 2KSQA 1CTQA 3BGWA 3GJ5A 4LSGA 4R2IA 4RD3A 1N34C 521PA 1JECA 2JDID 4OI1A 2CEAA 4PQFA 1N0UA 4KSBA 4F93B 3CPHA 3KQLA 5J4KA 5JI3E 4ILEA 4UNQA 3PUVA 2C9OA 2G0TA 2OFXA 1NF3A 2NMVA 4OQMA 4DCUA 1BS1A 5AK0A 1P4SA 2CVHA 3RHFA 4MKFA 2Q6TA 5KPDA 2W83A 3OEEA 3EAQA 5J4VA 4JI2C 4DR2C 1Z6GA 1G5TA 2IYWA 1NNEA 3KJGA 4NCJA 1UKVY 2J41A 4XH9B 4B43A 3IEVA 3H0KA 2EW1A 3AKCA 5K8LA 3KUCA 1VHLA 5FTNA 4E09A 4DLZA 2BM1A 4N1AA 4NXNC 4IVPA 3BOSA 5FFMA 1SXJE 2OSBA 1ZB8A 3IILA 3TQCA 4BLOA 1MT0A 1VECA 2C77A 4AYTA 2BC9A 2OESA 4DV3C 2I1VB 2X2EA 3SBDA 1W0JD 2GXAA 3QPWA 2CVFA 1GIAA 1LFDB 3RC3A 4EPYA 2XTNA 3GQBA 1KY2A 4CW7A 5FL3A 2QL6A 5B2ZA 4MGYR 1N6OA 1KI1A 4DCNA 3AVUA 2QI9C 5H1YA 4BLTA 1OH7A 2IYRA 3RC8A 2FMXA 1S8FA 1UPTA 2WJVA 4Q1DA 2EQBA 4HLQB 2BJOA 4F38A 1EX7A 1OHHD 2QPAA 2BVNA 4Q47A 1DG1G 3VR4A 5JCZA 5AJWA 3THOA 5J40A 1N25A 4ON9A 3Q5DA 4TQUS 2CCKA 2PT5A 1IXSB 1DARA 5CLQA 3AVWA 2C95A 4PO8A 4Q1AA 4M21A 4GL2A 1ZUNB 1TTTA 4ASUA 4KVGA 3BFVA 5LPNA 2NQ2C 2RGNC 2ATVA 2J0UB 4HAXA 3THXB 3NBFA 2H8KA 1AM4D 1H65A 2J45A 3IKJA 3QSYA 4B3SC 3CRMA 3FKSA 2F1RA 3LX8A 4AC9A 2RGBA 1E9DA 5LD2C 2Q0HA 1XNQC 1COWD 4TL9A 4ZPXA 1KAOA 2PMDA 3AKYA 3WNBA 1W36D 2UUCC 4JI6C 1UBGA 4ACBA 2QQEA 4NTZA 4YONB 2UUAC 2IXFA 1SXJD 1QBKC 3JVVA 3KDSE 1SVKA 2ZJAA 3G5UA 3W8RA 4AURA 1KK1A 1VKJA 3T1HC 2JLRA 4X8MA 4RD6A 3MWJA 1Z6XA 1LS6A 3KKOA 3NG1A 3P26A 1R8SA 3BH0A 1GG2A 1IN8A 3TLXA 4TN1A 3GLGE 1PV4A 1RIFA 2XJ4A 2N46A 1T3SA 1E98A 4DVGA 1II9A 1GNRA 4XVQA 3SZRA 1KGDA 1IOZA 1KSJA 4B3XA 2O8BB 3QQ5A 4DDUA 4F4IA 1HUQA 3J80D 4HAZA 3OE7A 4H9GA 1KI7A 1TAGA 2E5LC 1TQDA 3RLFA 1D9ZA 2HCBA 1DPFA 4Q1CA 3J81k 1W7AA 4PAMA 3LRPA 1N5IA 1IBRA 2HV8A 2XTMA 3QG1A 4MGKR 1ZU4A 1E2HA 1R0WA 5FOXA 4FI3C 4FINA 3FE2A 2AX4A 5TMPA 1Z22A 2FF7A 3CB4A 4YLGA 4EQ6A 1ODFA 3QF7A 2WJGA 1A2BA 3TSZA 1Q44A 1GDDA 2PT7G 2UXBC 5BYJA 4OJKA 1NMYA 2ZE8A 1USPA 5A5GA 3I62A 4NHOA 2HJVA 4LCBA 3L82B 2QQ0A 4KLNA 1DO2A 1WCV1 2IK8A 2ZS8A 4X8OA 2CE7A 4HLUC 2ZRNA 4HAWA 1W47A 4IW3B 4LFAC 3N70A 3GEHA 4D0GA 2HUPA 2ERXA 3CW2A 3GJ6A 5LMUC 4LFCC 3M0EA 4PZZA 5FL7D 3LA6A 4A6XA 1VPLA 4FW9A 3HWSA 2W2VA 4CYMA 5H8WA 2W6JD 2ZJ2A 1IM2A 1Q3HA 3I1FA 3L0OA 4EDHA 4EIWA 1CULC 4JMPA 4EJSC 4BRWA 3UWOA 2O8FA 1NLYA 1S2MA 2A5FA 4DJTA 1LY1A 4TYPA 5K8TA 1NMZA 3DKPA 3QIAA 4GRAA 1ZD9A 3GLHE 1YKSA 5FUXA 1JOSA 1G291 4D2IA 5CDFE 621PA 2GILA 3HP1A 2J59A 1G7SA 1NN5A 2HLDD 2Z6VA 3MCAA 2WTUA 2J7KA 3X1XA 2I1QA 3DVLA 2ZJBA 2CCJA 3IBYA 2AD1A 4TLAA 2GBLA 1TNDA 2CNWA 3IDQA 1D5CA 3TGPA 2MSCB 1KKMA 2ZITA 1AS3A 1U99A 5EE9A 1J70A 1J90A 1W2HA 2A5GA 3M6AA 5A0FA 1AGRA 1E2MA 3JZMA 3CR8A 5CK5A 1S3GA 1XXHB 4M9SA 5A2QD 1QHYA 2IUSA 1S9DA 2YCBA 1MOZA 5AJYA 4ACAA 1VYUA 1X8KA 1YZGA 1F3OA 1ZUHA 1Q57A 4IFEA 2X1VA 1EFTA 3CRVA 3QPUA 3T12A 4DB4A 2XX3A 1U8ZA 3VR6A 1VYTA 1QG4A 2GJ8A 2QSYA 4M9QA 4CGZA 1RVDA 2LWIA 2UZ3A 1RRPA 2O8DA 1M1YE 3PQCA 2VHCA 4CEJA 2VH5R 2WVJA 3LY5A 3VHLB 5AJXA 1XZPA 4Q4JB 3E1SA 2RHMA 1KI3A 4Z1MD 4I4LA 1OT3A 2GXQA 1XPRA 3MFYA 4X64C 2ZI6A 2PL3A 4Q9HA 4DV6C 3NBXX 2J7PA 4LV8B 3DZ8A 1G3MA 4D82A 5LMNC 2OFWA 1BMFA 1G8HA 1N0WA 4C0BA 3VR3A 4NCNA 5L8VA 3AKEA 4IDOA 3B9QA 3BK7A 4D81A 4P33A 4TLCA 2V54A 3GJ8A 4AKIA 1Z6AA 1JB1A 2O8EA 4IRUB 1GSIA 3ASZA 4FCTA 5FUVA 3GLGB 1IONA 3R7WA 3K0CA 2VEDA 4RD2A 1ZM7A 1R7RA 3IIMA 1AK2A 3T34A 1S4QA 1KO4A 1NP6A 4TT3A 5B64A 2FFHA 3SN6A 4TMKA 4YMWA 3ZVNA 5ANRB 2QRNA 3IO3A 3SDZA 2ZRBA 1E79A 2AKYA 4NYMQ 4JI1C 2JASA 4TLBA 5L3SB 3UMSA 4QM7A 4MKIA 3RRYA 3PVSA 4C0HA 2AXNA 2ZYUX 4DLWA 2JA1A 3AVPA 1XTQA 4DSOA 4U02A 1JAIA 1N6RA 2OCYC 3V00A 2ODEA 1FPMA 3CRQA 4DLSA 3EARA 2GCOA 2PZGA 1I94C 1Q3TA 5B30A 4BFXA 4ZIRA 1SXJC 1UBCA 3W9YA 3KKQA 1YZNA 4B3MC 1TF7A 1L2TA 5BN4A 4II7A 3QI2A 5F98A 1ZJ6A 1SULA 1WXQA 5FOWA 4G0NA 1KIMA 1W2GA 2ANBA 3LBIA 2A5DA 4B3CA 1HA3A 2BMEA 3QXHA 1GTVA 4US0R 5LB4A 4RKEA 4QM6A 4S35A 1HQCA 2VF8A 2FSIA 3CH5A 4LC1A 4NU0A 5EP1A 3TQFA 4RZUA 1W48A 3KXIA 1DTSA 2ORVA 1P62B 4R71A 1R5OA 4HAYA 4A8JC 4V03A 4XVUA 4DUGD 2B6HA 4DZZA 1Z29A 3LQQA 5KDDA 2I3BA 1RFLA 2RGCA 3BAFA 4JLVA 721PA 1XEWY 2BKEA 3KTAA 4TL8A 3JAMD 1E9SA 2OLJA 3GLHB 5L3RA 5E95A 3C15C 1DAFA 1U0HC 1NVVR 3UIEA 3RWMB 1VCNA 3W6NA 4P31A 1U8YA 3MG9A 4MYTA 2ERYA 5F2EA 1FMJA 3B5JA 2QT0A 1XEWX 4HAVA 2CBZA 2ZANA 1VG0B 1NG9A 2AWNA 5KOYA 3QEJA 3PUYA 4MYCA 3MWLA 1FQKA 4QJ4A 1II8B 2ZREA 4KV9A 1E0JA 2F9MA 2FN4A 1XTSA 2ONJA 4PHTA 3O8BA 3L0SA 3CZPA 1A1VA 3FGNA 4MRPA 1P75A 4XD7D 4EKDA 3PIRA 5CIQA 3REFA 2XZLA 2BMJA 2EWVA 1IQPA 2Z4SA 4PAOA 2PX0A 5EE0A 4IVRA 4QBGB 4Z8XA 3NDBB 1FTSA 2ZE7A 4C0LA 3A8TA 4JLOA 1T3LA 4HDOB 2OXCA 1GKUB 2IF0A 4LBWA 4ZV4A 4MRNA 3BB4A 5EXSA 3WY9A 4XIGS 1Z0DA 3CX8A 5D3MB 4GT1A 1E2QA 4DCVA 2EYUA 3FDIA 3AVOA 4NH0A 4RCYA 4S2EA 3TR0A 3B1WA 4IOLA 3BERA 1EG7A 4KLZA 4N0EA 3U3RA 2GA8A 4DR5C 1AZTA 2ASBA 1Z2CA 5AUNB 1NVUQ 3TMKA 1KKGA 4FXPA 2VQFC 4DV7C 1S3SA 4PXAA 2AXPA 3LV8A 1Y63A 2RMKA 1FFHA 1CR0A 2YZ2A 1YZLA 3L43A 4HUQA 2A3RA 2Q9AA 1MH1A 2NZJA 4CDGA 4DLTA 5JEDA 1OE0A 4M9XA 4PPQA 5AUPB 3PUZA 1E4VA 5JSZB 2AL7A 1BO6A 2OZEA 2ZRKA 2IUTA 3PITA 4MYUA 4O2RA 3M1IA 1S1CA 1N6KA 4LWZA 1E99A 3SOPA 1XEXA 2V1XA 3QVUA 1NG1A 1ONBA 4LJ8A 2F7SA 1Q0UA 1QVRA 2CHQA 3UMFA 4QC2A 1G20E 1L8QA 1QHSA 4B3BA 1G7TA 2HCJB 1M7BA 2WKRA 4HYYA 2JMPA 1CKEA 1DS6A 2VSOA 1XJCA 2FSGA 3U5ZB 1KMQA 2QT1A 3K9GA 4Q7KA 2H18A 4FMBB 4JLJA 1E3MA 1P9NA 4B48A 4Q9IA 2GEUA 2R6FA 1AA9A 3JVUA 4FIDA 1DOAA 5C4MA 4JJKA 2QNRA 1SVIA 2XITA 2G88A 4OHVA 3UWKA 2KBEA 2QAGA 1G7RA 3K9HA 4W5HA 5G41A 1G1MA 1ELOA 1GKIA 1Z8FA 3ZGXA 1I2MA 2R62A 1E2GA 3WMEA 2WKQA 3W6PA 2JLUA 1W4AA 3L2OB 4B2LA 3W90A 2QE7D 3RRMA 5CLLA 1XNJA 3SJAA 4NYJQ 1FOEB 3HPQA 3IUYA 4GMXA 2P6UA 4G5GA 4OQLA 2E9SA 3R8CA 2WHXA 3KXKA 2YKGA 4IDQA 1QHHB 3EC2A 2ZIAA 4NYIR 1E1RD 2GJAA 2JIZD 3W3AA 1P2SA 1DAKA 4PAQA 4ZI3A 3NH9A 4TLDA 1IY2A 3TW4A 1LV7A 4A0HA 5FL7A 1NBMA 1CS4C 4BQSA 2R6GA 1KMHB 1EK0A 2NG1A 5C18A 4DHEA 5JRZA 2PZFA 1U9IC 5EUMA 4V0OA 4I81A 5F9FA 4NOZA 1SGWA 3UMRA 4KFUA 1AZSC 4ZKDA 4XVRA 4NONA 4FWTA 3VX3A 4OQXA 3C7KA 3A4NA 3CUEF 4TMZA 3KKPA 4BEJA 2ONKA 4Q21A 4V0KA 2VHUA 1R4AA 2ZPTX 3LQRA 3K8YA 1PLJA 3B78A 2P5TB 2J9RA 3I32A 4JLDA 3ZQJA 3U4QB 3EG5A 4LX0A 4GNKA 4WOPA 3T1TA 2QM8A 2N42A 5BQ5A 3VU9A 1MO4A 2WAYA 3ZIAA 2QY9A 2Q21A 4DSTA 5EE1A 3RS0A 1NL3A 2ZU6A 1H8HA 1Z08A 2QP3A 1M8PA 3SFVA 2KBFA 2ZVPX 3LW8A 2KJQA 2ANCA 5CM9C 4YXWD 4DSUA 2JLWA 4MGZR 4B3GA 3KB2A 1MABA 4QNRA 2YNMA 4OBEA 3L0PA 4JI7C 2CLCX 3AF6A 4AQYC 2UU9C 4EPWA 4AY2A 4DBLC 4JIMA 3K9NA 2C96A 3QBTA 3GFTA 1DAEA 5JECA 2FEMA 5DGXA 2F43A 2CL0X 4NYIQ 3EPKA 4HSEA 3PV0A 2P5SA 2HDNB 2CK3D 4MH0R 2DFTA 3OEHD 3Q8XB 4MITA 3PR1A 2EVWX 3ZJYA 1N0VC 1ESMA 1XTRA 1Z2AA 3DM5A 2WWIA 4POAA 2AK3A 3QOFA 1YR6A 1FL9A 3AF4A 2WOJA 3UG7A 3K53A 1NN1A 3NH6A 2Q9BA 4PHGA 2REXB 1E6CA 1FZQA 5DYGA 3T1QA 4OJQA 3TUIC 3UK6A 4AYXA 3SJZA 2D7VA 4A0FA 5J4LA 1G4AE 1Z63A 2QBYB 2OEPA 2H5EA 3ND8A 4UNSA 2YWEA 1EXMA 2F6RA 1E1QA 1F60A 1G3IA 1YZUA 4JYCA 1ZM9A 5FPSA 4DUZC 4PSAA 3AVYA 2BM0A 2FE4A 1OIVA 2VO1A 4YHHC 2OBMA 3O8RA 1SVLA 1KK2A 1NSFA 5G3ZA 1I4DD 2QG6A 2ZE6A 2KZFA 2PCLA 2IYVA 2RGGA 1YQTA 4EQ6B 1KO7A 2PX3A 3NBYC 3PEYA 5JHGB 4WZBE 2LKDA 4BECA 5HKKD 1N2FA 1ZYUA 2VHQA 2WOOA 4NCIA 1PLLA 1USPB 3PG5A 5AR1A 4XWOA 1T5LA 3GLFA 2WWXA 2ZI9A 4M8NE 4GZMA 2JLSA 1ZNXA 2RGDA 2NPFA 2ORIA 2PJRA 2BIFA 1JXOA 5TY0A 4DV4C 4DC9A 4BASA 1Q21A 2BKUA 1P72A 3K70B 5KSOA 1G8GA 4B6FA 3AB3A 4X8HA 1P60A 2W00A 2X2FA 1GKYA 4C9BA 1DAGA 5TV2A 3W5IA 1OIXA 3C5HA 3QVVA 3THYA 1OB2A 1QF9A 2ZUCA 1F2UA 1P9WA 2NZ8A 3SEAA 3AKDA 5L3VA 2ATXA 1F2TA 1IN6A 2G1KA 3NBZC 3QKSA 4LF5C 1WQ1R 2E8FA 1NKSA 2W0MA 2Q3MA 3RDPA 1EWRA 1KHTA 3A37A 4PHHA 2V1UA 2C9YA 1M7GA 2GJ9A 4Z8YA 3WBJA 2GZAA 3EZFA 5DI9A 4YMTA 4DUGA 3KKNA 4PC1A 1GRRA 3D8BA 1S9HA 3DM9B 2E87A 3MJRA 4MH4A 1LTQA 1EFRA 1OFUX 5DH9A 4EPRA 3THWA 4ARZA 4R9UC 1M34E 2RCNA 5FTKA 2ZRGA 2NO1A 2FEOA 2BBOA 2ZM6C 4MKHA 4BLSA 1FW6A 4DR4C 1UF9A 2IW3A 2WWYA 1CEEA 1HY3A 1DAIA 1C1YA 1MR3F 4TYQA 3U6KA 2OO7A 2IS4A 3WNDA 3BFKA 2PEYA 4DR1C 1HT2E 2OCPA 3EXAA 2ZR0A 1NN0A
chains in the Genus database with same CATH superfamily
3H5AA 2B7BA 4GI5A 4ALLA 4L16A 3I0MA 2JARA 5C80A 4A6PA 4P53A 4RSGA 3UHOA 1HC7A 1OTXA 2FFRA 2OHIA 3OQVA 2PKWA 1VIDA 4CT5A 4BO5A 1MQAA 1AHPA 4DR7C 1QRRA 2OZVA 1E2LA 1OLSB 3AEXA 1KVRA 2DMRA 2Z0MA 3AM4A 4GLJA 4KP7A 4RH1A 4LF4C 1DJLA 1XD2A 2C2BA 4ZO7A 2GVZC 3M6MD 3VDMA 1XRRA 2HA6A 5LWQA 4BUJA 4HZUA 2PA0A 4QUIA 1D2RA 1SOAA 1ZUD1 4FT2A 5AJHA 5EXDA 4MW1A 2EQ5A 3HFJA 1LCIA 4JLNA 3W5VA 3CVUA 1H42A 3WHIA 4XIIA 5MGNA 2FJUA 4BKUA 4H1WA 5KTPA 1Z38A 3W2GA 1L8XA 3PICA 3AFNA 2IYPA 2ZK7A 3D0KA 5HS4A 5KSWB 4EF6A 3UEBA 1YRWA 1JLMA 3NXKA 2A0YA 3NI2A 3WWYA 5LP6A 2P0YA 1ECLA 4C0SA 4TTIA 1DQPA 1J9EA 1S1MA 2FMUA 2NQTA 4RFSA 1R5JA 3R7WB 5ICSA 4TSFA 5TQJA 1PBNA 1JNYA 4KI7A 1ENOA 3GJ7A 4O8CA 4WZZA 2H2IA 2ZQZA 3CKKA 2EERA 1L5RA 1JSRA 3AHCA 1XHEA 1O93A 1DAOA 2O2JA 2XKJE 3Q3CA 4HGZA 1HE1C 5KQGA 4JBWA 3DLHA 3R6TA 1GGKA 1ULAA 2GNPA 2WJIA 3DXYA 3KB1A 4OXXA 1SCNE 5ISMA 4M8KA 1BCSB 4B85A 4WLFA 3FVVA 5A05A 4JC8A 3S4YA 5JLJA 3KDPA 4ARUA 4IDBA 4B4KA 3EMVA 2ZT7A 1V7ZA 2VPPA 4O4JB 2BUCA 1Q0HA 4UUNA 3H5TA 2VBGA 3T5TA 4OJTA 2XD9A 3ORYA 1SCUB 4IQGA 1E4YA 3JQQA 4D80A 1Z06A 4OVKA 3ZK9A 2BMDA 1T2CA 4WZBB 3D3WB 2IXTA 3L4BC 4JITA 4ESEA 3FSJX 4RZ2A 1DC8A 5AVXA 4EJ2A 1R2QA 1C4OA 3MJCA 3CQ3A 5BN4B 1LUAA 2VOJA 2VQ6A 2VUUA 3C41J 4F5ZA 2WZDA 3OE4A 4OMDA 3DDOA 3EDMA 5LUBA 1R5NA 2I6XA 3RYCB 2ZSEA 3U3MA 1EX6A 1AB5A 4AO6A 3DO6A 4QBTA 3GNQA 4R1UA 3RSZA 4KQXA 3G2PA 3N2YA 5EVCA 4BQIA 1U2DC 1XQ6A 2EZTA 4LISA 4ZMRA 2ECFA 1GTMA 4KSCA 4HR7A 1NQAO 5FTMA 4RHUA 5TF0A 4EHNA 3UV3A 4YMLA 3F98A 3QVMA 3IXQA 5FRDA 2CJXA 2R8BA 2QN1A 4GLLA 1T9AA 3H65A 4PLWA 2C4KA 2BHSA 2PMWB 4BVJA 1SPXA 1WQ4A 1ZI9A 3KTAB 4W6QA 4WGFA 3SYNA 3BT7A 2O7RA 4MLZA 1ORWA 3OT1B 1KQ3A 2FN7A 4LOLA 2QPOA 3WGZA 1C3JA 3IA7A 5K85A 2A33A 3NANA 1NJ1A 3TW8A 2CDNA 5F21A 3WDKA 3ZE0B 1J8YF 5ALLA 1CR1A 2EFDB 2IYTA 3HCCA 3Q7PA 3NTLA 4LSMA 4A8PA 2JGDA 1DE0A 1W25A 3JVEA 4F9TA 2Q28A 4NAUA 4QXMA 4WKNA 1FQJA 2PU7A 3BGOS 4R31A 3LF2A 4Y1FA 3AB7A 2MMGA 3GARA 5KWVA 1UPCA 1FTYA 3QLVC 4A3SA 4A4DA 1O6BA 4EGJA 4IMIB 5MDHA 1JF8A 3OLVA 2WSIA 4AJJA 2YWGA 4ZI7F 5FA8A 4JJ7A 4HCJA 2NSJA 3NFRA 3GXOA 5HE9A 4M0LA 2JEYA 4DA7A 3M1YA 1NM5C 4RXUA 1U7TA 2ZUUA 2X76A 4LDPA 3U13A 7AT1A 3RJMA 4ESVA 3QOXA 1LBHA 3IDAA 3NTVA 1ZD2P 2ZR7A 4NFLA 3RJTA 5LDHA 2C3MA 5FWDA 2Q5CA 4H6WA 1QRUA 1CQIA 2PFSA 2R44A 3I9OA 5DT9A 2R97A 3GZTB 3D1VA 2YCLA 4V0RA 3BILA 2PXAA 1T5BA 2RGNA 3S82A 1RRVA 3WL6A 1TO6A 2MTBA 2EP8A 1CF4A 2P9BA 3PE6A 4H6PA 3OQIB 2Y1LA 5CEJA 1JG4A 5K6RA 3ESRA 3S2IA 3FRIA 4DHWA 4XRGA 1P9OA 1F8YA 5DYYA 1R0XA 2V65A 3IT1A 1KI2A 4LHYA 3ZWKA 4DRXA 2F1OA 5EHZA 2XT9A 4W8HA 4IMRA 1BC5A 3IHTA 4YDRA 3TSOA 4HO1X 4AD8A 5K3BA 3NP9A 1V35A 3TGLA 1VBNA 2GNOA 4QIHA 4XEHA 1EFVA 1OLXA 3ZK7A 1N2XA 2C84A 1G59A 1Y6JA 1ZX1A 1JPJA 1IN7A 1XJQA 4FX2A 5LLDA 4IIHA 3T9AA 3BGDA 4QYXA 2SCUB 1Q6YA 3OPQA 4C0JA 4EBBA 4EI2A 3N2QA 4FYXA 1P29A 2V7QD 3S2ZA 4XFDA 3Q3GE 2NPIA 2FUEA 2FXIA 1QFXA 3ZU2A 4FT4A 1W75A 3I76A 5A4FS 3BFJA 4IJWA 2FPXA 3B51X 1PR1A 3LT4A 1VI6A 2XWBF 4YJDA 3BHNA 2X4GA 4Q19A 2AVDA 2XJ9A 3OT4A 3KHTA 4ZT4A 3D5EA 3DZIA 2GZ2A 4UTZA 5FWXB 1EWYA 2BMAA 2EIXA 3B53X 3BICA 3WQRA 1QF6A 1L1EA 4L6AA 5CK4A 2XNDD 2HBRA 4FQ8A 2CUKA 3PQ2A 4NBNA 4Y9TA 5K0LA 3T3PB 4C21A 4QVIA 1ZD1A 1L7MA 1IB6A 1Y5IA 2GA9A 5DTQA 3FHCB 4DS3A 1XPRA 1M0WA 4J0CA 4MTNA 1O87A 2ZWMA 4QNMA 2XTAA 4UVGA 4MRRA 5EUQB 5LZ7A 5IX8A 2P2LA 1XMQB 4LF7B 1Y8RB 5JD4A 3WYCA 3AHFA 4UE6A 1LJ8A 4BFCA 2QL5A 1D0VA 2I8CA 3NHLA 4EM6A 4JLPA 1N6PA 3AJRA 3R5FA 1G18A 3HA5A 2CYAA 3M1LA 4DBVO 2IITA 5FBVB 2P2FA 2AMLA 2QPLA 4F1KA 4UATA 1JXMA 1R8XA 5CB6A 1L4LA 4HLUA 4WFQA 1XDSA 4LS3A 4QHSA 4OXIA 4D92A 3L40A 2F90A 4J9UE 4JT9A 3OU2A 3W2HA 2VJLA 3K92A 3DKVA 3TK1A 2FFAA 1G5HA 3KX2A 2WFLB 3O74A 4UVHA 5E9AA 4ZZ0A 5D6OA 1V7CA 2OPLA 2JGLA 4OX9B 2ZAYA 1O9HA 4G81A 2WFZA 4JSYA 4EJSA 1XZCA 3KJXA 1F12A 5LU9A 3EISA 1RDFA 4CMIB 3V97A 2WFAA 1Y1TA 2NSDA 1OZHA 1ISRA 4QRHA 3TVYA 1D2EA 1LNSA 4LKOA 3E2PA 1ECCA 1SZDA 3H6GA 2GDJA 3SLGA 2W5UA 4M8IA 1WHSA 4Y9SA 5I4KA 3SJBA 3AL3A 3AR7A 1DXQA 4FEAA 2J0UA 3C0KA 4E03A 3J81A 3O8QA 4GOND 2B20A 5FLEX 4DB2A 1V9CA 5F5NA 1VCMA 3GPDG 1LC3A 3IP1A 2P2DA 3KQMA 3NHYA 3W9SA 5IMSA 2FETA 2OG1A 3Q2KA 2G5PA 4CLXA 1BA2A 2NT3A 4XTCS 1DEXA 4E5PA 1XQ9A 5AVQA 1CJBA 3EWNA 4RQAA 3QMMA 2YHIB 4AVYA 1X80B 1MJGM 1CQXA 1VJCA 4R9RA 1YJAA 4CRWB 3HY3A 3M6VA 4EA8A 1PWEA 1XK6A 4Z1OA 1P44A 3IUBA 4CEHA 2NO7A 2OHVA 3EBLA 3F6EX 1GTSA 2GMWA 3SOZA 4BU0A 1G21A 3ADCA 3Q3HA 1NDHA 3QUAA 4KZPA 1G16A 2QRGA 3CX6A 3ASVA 3DA8A 2FUCA 3PUKA 4CZ2A 1E1KA 2YDYA 4WXEA 3WRXC 1B16A 4OHCA 2G9NA 1C9NA 2I34A 1L2FA 2C9CA 1SKQA 1L3IA 1W2WB 2BFWA 1GAWA 2IXAA 4HL6A 2B2XA 3UXHA 1Y8CA 3V5NA 3W7AA 1YQEA 3G2KA 4YC7A 3ROTA 5JSFA 1GFWA 1A9YA 2B1IA 3M4ZA 3P9ZA 4EPVA 1XRQA 1XRJA 2IA5A 3F5QA 1ISJA 1R6AA 3O7MA 4RF3A 2XMBA 4JXZA 5I47A 1N6LA 4JCCA 4X3PA 1FLNA 2E18A 3I2KA 5HKBA 5IM4A 5ADHA 1BROA 1I80A 1KAEA 4F2HA 2WICA 1RHKA 4I3GA 4W1RA 4FMCB 4QNNA 1XZDA 1YCFA 2QX7A 1ZGAA 4LDQA 4PYMA 5CH5A 4Z9YA 5EIBD 5JDCA 4GEKA 1LH0A 4F6RB 4X8LA 2WHPA 5H68A 4HDAA 4LECA 4A5OA 2DT8A 3RIXA 3WLSA 3WB9A 4L4QA 1MDFA 1DBQA 1P5RA 1POXA 2BJHA 3G8DA 1WR8A 2VZ9A 1VPTA 1W0CA 1Y33E 2QUKA 3ZGLA 3VSCA 1XZQA 1ZMBA 5AHWA 1WL8A 5I9NA 5SZJA 3VR4H 1UBJS 3C6ZA 1VIMA 3ZX4A 4UTXA 4E31A 4P0QB 4RACA 3WYDA 1FPQA 4UOQA 1U94A 2PRIA 4OLHA 4QAQA 2VP2A 4H0NA 1JG2A 3W1EA 1US8A 2XHEA 1QH8A 2ET6A 3FHOA 4BZZA 5EJEA 1W4RA 5H81A 5AHOA 4LNAA 2VWGA 3LZCA 1IC6A 1B41A 1P3JA 3S8MA 3LXRA 1KZGB 1ZCAA 2V7WA 1AKEA 2XLCA 1JU4A 5JSYA 4HB3A 3EPJA 2ZUEA 2ACVA 2V6IA 1PG4A 1B76A 1ES9A 3GNSA 1SXJA 1GN8A 1N8KA 3LU1A 4FLFA 5BWLA 4GMDA 4C20A 4DUYB 3WR5A 4F91B 1YQWA 3DH0A 4IP0A 5CB4A 2J3EA 4BBPA 3IAAA 1FNDA 2J33A 1W29A 3GW8A 2H31A 5TQ0A 4POOA 1QO0D 1BHSA 5K0BA 3DMYA 3E7WA 1DKNA 3EY9A 3EZYA 5T3UA 5LYJF 5C8YB 1SBIA 4U0KA 1YJXA 1A71A 4XWWA 3VNRA 1EDOA 1JXAA 1Q0QA 2Z83A 3HJTA 4PQGA 4ZTUB 1SXHA 5K3FB 1W5SA 4ZHQA 1CYEA 1L7VC 3DJFA 4BEVA 5DRTA 5J23A 3UVEA 3F6RA 3PL5A 1PJAA 4OB7A 4XEUA 5DBIA 3U17A 3STVA 3VI3B 1X8JA 3DHYA 2E82A 4M0CA 4A8JA 4YGXB 5JVDF 3RDPA 3J80A 1ZXLA 1R3UA 2ATWA 3SYLA 4XWYA 3G3EA 3AJEA 3R09A 4IFBA 4URHA 1YL6A 5DO9A 3WOHA 5BSTA 2HSGA 1QK4A 2P9ZA 5K4HA 3I5YA 5GOZA 5LKRA 3FUTA 3ED1A 5KYGA 3B20A 2JCSA 4XAQA 4N6OA 3M4JA 4LI0A 1HF3A 4Y6OA 4M98A 2E4YA 3C4VA 4QBHA 1U0FA 5FUWA 4WXPA 3SXPA 5HRUA 3C8UA 4R8KA 3N0WA 4TOIA 1ABEA 2X5KO 1HFJA 1I3NA 4PLZA 1IWPB 2RAPA 3QBEA 3QPCA 5HM8A 1RJEA 2GCNA 2HYDA 2X6QA 1K0RA 1LC0A 5FT9A 4KPFC 2WKSA 4JI5C 1BX0A 3O1HB 4H6XA 3U6BA 1MX5A 4D8VA 4FLMA 2GEJA 3OZXA 1YB5A 2IVFA 2XB4A 2B1GA 3EPPA 5AXDA 2ISCA 3ZX5A 5A0VA 3VTKA 3KRTA 4QJIA 1KZYC 1A98A 4MP8A 3DZCA 4LJ7A 3WGYA 3S6JA 4JL8A 3PD7A 4JI4C 4FSHA 1QP0A 1KOFA 1G8KA 2WHRA 4NULA 3GPIA 3KAPA 2IU3A 3KEMA 1UDXA 4FCWA 4MCIA 3V8VA 5EI5A 1XJ5A 3HTXA 2HJ9A 1JB9A 1Z82A 3OIUA 4UASA 3IAM1 2HMYB 4X7BA 4I9FA 2QRPA 2TMYA 3SLRA 821PA 1N3LA 1XD2B 2GRJA 4GQBA 4EKGA 2PROA 1SIOA 2C5GA 5JJKA 1XMOC 4HZUB 3AFGA 4JVSB 4PLVA 4RIIA 3MLEA 1E4EA 4HP8A 2JGIA 2FKAA 4J1TA 3RFUA 4MQFA 2ZXUA 4AZTA 5I7UA 1TAQA 3N8GA 1GL3A 4ODJA 1AKWA 2B25A 2JGAA 1J22A 2BEKA 3A0RB 3P2KA 4NKRA 4RMJA 3DNMA 2GHQA 2WE7A 3OZVA 4UDNA 5HFAA 5SY6A 5KVSA 5FDFA 3Q72A 4QATA 4RAOA 4UEQA 3RVQA 2EV9A 1IMOA 4MGHA 5LP6B 5L6LB 4LF6B 4NV3A 5AH0A 1AQYA 1GPMA 2P6NA 2XGOA 1RC1A 1VBKA 3SYMA 4JP3A 2FFJA 5CYOA 1NVBA 2BFAA 3D7NA 5T41A 5TVGA 3WYEA 3SHWA 1YVPA 4N0MA 4LXQA 1BNCA 3HI6A 4KYTA 4BTLA 1PW5A 1IXZA 1TDJA 3G2QA 5EQFA 1QYDA 5D51S 5T4FA 3GUYA 4L4RA 1G8JA 1ZW1A 3ICPA 3O2NA 4A1OA 2CJWA 2O54A 1N5KA 1B15A 5CU7A 4E4YA 2W93A 3IP3A 1O89A 3DMDA 2COEA 3PX2A 1GDTA 1QZZA 3GA0A 4RNCA 1WE2A 1PR4A 4BMNA 5AKHA 4JOSA 3V4OA 2A57A 4KH1A 2V7QA 1QK5A 2YMLA 5DVZA 7MHTA 3MRSA 4Y1RB 3BF8A 1PFVA 4KPUA 4RDXA 1LQ2A 5TR9A 2BFDA 1ZG3A 1ID8A 2RC5A 2D1TA 3N2EA 3KBOA 4H1UA 1FXWA 4PG6A 1K75A 2IL1A 2UXCC 2B7CA 2OAP1 4NNOA 5E3IA 5BRNA 3VKFA 4L8GA 4LK3A 4G0PA 4Z1MA 1TK3A 1M5TA 4XYGA 1PJ4A 4L4UA 1XD9A 3EIFA 5AIAA 3UKDA 4DLYA 2XR1A 2G9QA 3FWKA 3IVMA 4KVZA 2XNDA 2Q3JA 5AP9A 3TM4A 1GILA 2L17A 2VAMA 1AV7A 5JPDA 2PYZA 1SOUA 2QEQA 4ND8A 4XDHA 4AUNA 1PJZA 4BSZA 2EZ9A 3D2AA 3EJ6A 4GR9A 3C6BA 1U5BA 1N2SA 4HDMA 1WVIA 1E89A 2EEZA 4EB3A 5K0TA 1GL7A 2G71A 5JYDA 1WULS 3L05A 1HWYA 3B85A 3L18A 4G25A 4E46A 4KL8S 4XJVA 1DKQA 3DXZA 2A88A 2XUAA 3UUWA 4GOKA 4BVKA 3SYKA 1L5KA 1FYEA 1ZN9A 1NJSA 4WL0A 5KHOC 1DTEA 1R8YA 2IHKA 3IE0A 4HNHA 1NYRA 3DTNA 3E22A 4WCFC 1U6KA 1IG3A 3ABOB 4OQEA 3G23A 4BE9A 5JYEA 4H27A 4ZOLA 2JGDB 1F0NA 2X9QA 3DTTA 3ENVA 4R8SA 1DUSA 5EL0A 3RIYA 1QWIA 4R1QA 3RE1A 2KLHA 4M46A 1KH1A 3KQSA 2QMOA 2A4MA 1XVVA 2YHBA 2BOVA 5DNWA 3TGWA 1LJLA 1T2EA 1BMDA 1A9TA 2HHCA 2Y0DA 5E3HA 1P80A 2FGKA 2JZCA 2FB9A 2BM9A 4HLNA 4QPPA 1VLHA 5K01A 3DV0B 3PNLA 2LNDA 5F4BA 2GN0A 2PM8A 3RVSA 1NTOA 1XA3A 3KKKA 3L1HA 3VR3D 3K3PA 4PZYA 2B4QA 3M9XA 5L4SA 1DL5A 1N2BA 1RIIA 3UJHA 4I6JA 1C8KA 1M76A 3QUCA 3WWCA 1L3BA 1P77A 4R2MA 3SY8A 1WLYA 5SYMA 2DHRA 1SQFA 5TQ2A 4A73A 3RT7A 1BS9A 1C8LA 4YJHA 1Q74A 1LRLA 2OB1A 4QGHA 5JR3A 2OCLA 2XYPA 3W7VA 5KVVA 2FZWA 3ETGA 3KHKA 2Z08A 4C1BA 5ETJA 2RIRA 3BQNB 4RPGA 1II0A 1T9CA 1P5FA 2Y9PB 3NCTA 4V0QA 3TE7A 4PN3A 2GJSA 1LGYA 5FR2A 3ETHA 5DM4A 1F6BA 2P62A 2HCTA 1MO3A 3I6MA 3KO8A 3PEUA 3UK7A 5CYPA 4AY4A 1FU4A 1EIWA 5H7XA 1SXIA 1VZ3A 3DEHA 2CNBA 2WD7A 2FDRA 1TIBA 3CRRA 4G09A 4O3MA 5AI5A 5MN6A 4WN9B 3D02A 3DAFA 4MMXB 5BYKA 2RJ3A 1XK7A 2RHBA 2NU9A 3AR4A 5H82A 1A50B 4DWJA 2RHGB 4DIBA 1KAQA 4XD2A 2IXGA 1I6MA 1EFVB 1OLXB 2CZCA 2QRMA 1ZRMA 2Q27A 3MLBA 4BNXA 5LBIA 1UXOA 1H85A 1NVAA 1VLQA 1KWKA 2JI9A 2OAGA 2G1JA 3NOXA 5ES4B 2GPTA 2GHIA 4RK7A 4UEKA 2HF2A 1ODTC 2ZTMA 3DT6A 4OMFG 4E22A 2C0QA 3LTNC 4C2TA 4UDYX 5IF9A 4KE8A 4PPFA 3CVVA 4XI9A 5CLHA 1RM5A 1U2ZA 3UG6A 4CM5A 2V0CA 4B74A 4OX9Y 4B47A 4OF4A 4LPSA 2HXSA 4U63A 1A9QA 5AXAA 1P45A 2C5LA 2P68A 3M5WA 4E88A 2HMUA 2KB0A 1CQZA 4W1QA 2E5LB 1H6CA 4OHRA 4R8RA 2W0SA 1DLIA 1IJEA 4UNNA 1P1KA 3Q9NA 3QU4A 5FI1B 5FOWA 1NXXA 1RP1A 3CJQA 3TXYA 1YRBA 3JALA 1ULBA 1JJ7A 4HLDA 1H1DA 5JYBA 4X1IB 2VTBA 4RHTA 4TWJA 1TLLA 3D3KA 2VBCA 2HTFA 4YALA 1XYGA 2QXUA 4NG4A 3MZ0A 1P2FA 2FK7A 3MTQA 2C4TA 2VHYA 4RF5A 3I3SR 2JI4A 2BGKA 3MJHA 4FN5A 4ISBA 5DB4A 2P4EA 3CM0A 1JR4A 4WK0B 2O8EB 1KF0A 1CRZA 1UC8A 2FWPA 5SYNA 4BBZA 1KS9A 2RARA 2IDZA 4DL9A 1G0OA 1HNZC 3ZTYA 2WMDA 4K9LA 3QMVA 5ALXA 1NJ5A 4KR9A 5JXHA 5EP2A 1CD5A 3TBFA 4YHHB 5IHXA 2I66A 1T15A 4EI8A 2BD0A 4R3UC 2AZMA 4QU0A 4P4UA 3WMGA 4RIHA 1T5IA 1KOLA 4Z7JA 3BBLA 5ELMA 2JK0A 3QXSA 3ECSA 3QEMA 4Y67A 3OP1A 1LB1B 3ITEA 2NAPA 2QRVA 4DPMA 5DLDA 2XWPA 4UTNA 3SM3A 2OPLB 2JC3A 4KYVA 3M34A 3EZ9A 5HVNA 3M9LA 4Y2SA 2CV1A 1Y7HA 2D8AA 5GV8A 2GEVA 1C7FA 2ZUBA 3K05A 4I50F 4D5EA 4EJSB 1EESA 1QO0A 1ISMA 1SOWA 1CE8A 4IXNA 3UX2A 3CX3A 5TB5A 1NY6A 2JATA 3GB9A 5HZKA 3WL8A 1S96A 4AMBA 3V1LA 5G4KA 3TUJC 2ONZA 4LJ9A 3L02A 3IOEA 4ADSG 1ISGA 1LK5A 4XPIB 3SHFA 1KC3A 2HJSA 1WCJA 4FUTA 3Q4GA 3RNOA 1XAIA 5DGIA 3TLJA 3G6WA 4E7PA 3FTQA 2WYWA 1DX9A 3R5JA 3KUXA 5DGDA 1UFOA 4HVCA 2Y76A 1N6IA 5JCPA 5F2NA 1OLUB 2A35A 4BFZA 4JEUA 3RS2A 9LDBA 1ZWLA 3FUCA 4TQ9A 1XTKA 1VM6A 1E8MA 4KX3A 2JAXA 2DR3A 2PJDA 2O3UA 3DL7A 2XE6A 1UBOS 3NAQA 4JYPA 4KI0A 4LE0A 4TVKA 2GOYA 2BR3A 4MO9A 1ZM2A 4FKZA 4OJNA 5EZQA 3ROKA 2Q29A 1EFDN 2FWRA 2WU3A 3B6KA 1KHHA 3K16A 1XIVA 1G8SA 4DCGA 1PJCA 5ARBA 4PX3A 5MN4A 1SB9A 1NIJA 4PC3A 5E7QA 3EZ6A 4I5DA 4MB2A 5AVZA 5ITSA 5M5BA 1FTQA 3COJA 4CEHB 1NBME 3PFBA 5CG2A 3R5SA 1G21B 3B2NA 1RYEA 1X1CA 3P5SA 2CE2X 3N76A 4X1YA 4N49A 1XP8A 1Q1QA 2QJWA 1O2DA 4YN3A 5FAKA 4IH1A 3EAGA 3K1YA 4HAOA 3EUAA 1OTYA 1E60A 5E1MA 4Z9BA 3E5NA 1RXCA 1PT5A 5HJ2A 3QUSA 1I3OA 1NXTA 2OZLB 5TF4A 3CNNA 3PC6A 1KL7A 2AMJA 4LPKA 5T64A 4ZDIA 1CUWA 2R48A 1SVUA 3OFVA 5EFZA 2QBYA 2X4LA 5IVHA 1JI0A 1W96A 2C29D 1E2KA 4BTVA 3I5MA 1NQUA 3C74A 4YRZA 2ZRCA 3L0CA 1LA2A 1PNOA 4JQCA 5LMNB 3AHEA 3D3QA 2R5NA 3H84A 2AUNA 4IG4A 2C5AA 3GJSA 3EVDA 3Q0IA 1U4SA 3ZNOA 1UQUA 2WAOA 2WTEA 4XTRA 3S7ZA 3G2HA 5JZBA 5ALWA 2CFSA 5U1PA 1OI4A 3IT0A 1EGHA 1S3IA 1TMYA 2FAXA 3KYCA 4P4TA 2QRUA 5FV7A 3ROMA 5AM2A 2WP8J 2XI4A 2N9UA 2WYOA 3KU1A 3HEMA 2XCTB 3NGLA 4W7HA 2P5YA 5AOCA 3AM5A 1JXQA 4UHJA 4N9QA 1QIEA 1QMGA 3PFWO 1XGKA 4OBXA 3WJ2A 2CMHA 3AOEC 2B6NA 5BRAA 1GFIA 2JVIA 3AFHA 2QGZA 3CQ9A 3FF4A 3ZY6A 4BFTA 4IWXA 1E0AA 4P0PB 1HQKA 1M2VB 4K26A 1F7VA 1DIOB 1PNQA 1YAJA 4YDQA 3UMYA 5JS1A 721PA 3W8DA 2IYEA 3BWDD 3DNPA 4YPOA 2NTJA 4AY6A 1UDBA 1US8B 4K3VA 1QH8B 1NBMD 3DULA 2HSZA 3WZ2A 3QWBA 2XCSB 1EK5A 2ZIFA 4JUCA 2HQ1A 3HJNA 1TAUA 3HGQA 1UMCA 3IMGA 4ZO6A 6GPBA 2XA1A 1WDTA 1LPBB 1BD3A 5HK8A 2IODA 4DYDA 1B93A 3L4BA 1XDBA 4BV2A 3QPVA 1SXJB 1FNBA 2ZI3A 5DPMA 4CU2A 2DLCX 4IUYA 2XMDA 1TC1A 4JUBA 5CB4B 2HJHA 1CHNA 4IQ0A 2YXEA 4JU8A 2GKSA 1MVNA 4GUDA 1LPMA 2FY8A 5TQ0B 4ZI7A 4OXQA 3JQGA 3ONDA 4QBFA 4D56A 2DR0A 1J42A 3I61A 1XEXB 5MN5A 3CKLA 3KOYA 2R60A 1HT3A 2W8BB 3R5KA 5J5CA 1XWIA 1U2DA 4ZHQB 4WSOA 5TPZD 3U1TA 3USCS 1JVNA 2VNHA 3TD2A 2QVCA 3PF8A 4A8JB 4R2JA 1HNXC 5AW9A 3H7AA 3A6JA 1AUQA 1PNVA 1SVWA 3UWSA 4DIEA 1U8CB 3S2UA 2QF7A 1NV9A 3CX4A 4UOEA 2YNMD 1N7IA 1A82A 1KXJA 2CHEA 3KQQA 3JS5A 4KFSA 1BD4A 3ZR4B 1TM5E 3ODGA 4DOMA 4G1IA 1VE9A 4JXKA 2F8LA 3DFZA 4PYIA 2AB0A 4BFYA 2ODNA 4DM7A 1P1CA 1MRZA 2XMRA 4Q3EA 1T0IA 1E3EA 1KIAA 4RV9A 4XJXA 4DXDA 4Q4CA 1R6DA 1E59A 4MYDA 1BVHA 1W5TA 1VB5A 1RHQA 2AQKA 1UXIA 4Q3LA 4XM0A 2H0AA 3S2SA 4V3BA 1XHJA 1LWNA 5HKKA 2EWMA 2QTNA 5T4HA 1RQ7A 5BPFA 1LVGA 1DOZA 4PGHA 3C7AA 2WWFA 5NULA 1FTNA 3EE6A 2HD4A 3AI3A 3OQ1A 3ORQA 3WNCA 2YUIA 4AF7A 1IHOA 3HJGA 5IABA 1ZVKA 3QLVA 5T8KC 3EXIB 2XVYA 3B70A 3URKA 4BKMA 4JLWA 3SNKA 2I4MA 4X6XA 2V7EA 5K8FA 1YU9A 2NWQA 1Z7GA 3L7JA 4LV5B 4RE6A 2R8EA 4R3WA 1E2UA 2DTXA 1RPNA 3DCJA 3LNVA 1NM5A 2I4RA 1E1QD 1X3LA 2WK1A 2ZYIA 3WX0A 4OBWA 2Y05A 3EZ2A 4II2A 4LY6A 5GJCA 1Z0ZA 1EFUA 3LOPA 1QKJA 2NSHA 1UK7A 2JFOA 2JF0A 4ZEMA 3VXKA 1TUIA 3B6EA 2X42A 2VJQA 2JAWA 2L18A 2WD8A 4RAQA 3OICA 1QQBA 2CL6X 2MOKA 2P9CA 1KAHA 1G6Q1 3V4FA 3WK6A 3SU8A 4YCDA 1U28C 2XLBA 2NO0A 2XE7A 4MR8A 2X8AA 4Q82A 5D6NA 5G3YA 2GK6A 4NRDA 4FGLA 1QB7A 3VR2A 3EUEA 4BMOB 1KERA 1WZNA 3AP3A 1AUPA 1W1UA 3CH6A 1P31A 1W5EA 2UVQA 2XDAA 4KCGA 3IMCA 2H11A 1QUFA 4I1RA 2FZGA 5E2BA 2B1RA 1JTVA 3VSAA 4EPXA 3VJMA 4XVCA 2KDNA 1SWVA 4MPPA 2FWBA 2DBZA 4R84A 2P27A 4TQGA 3B1YA 4G1FA 2CJWB 3DC7A 4MVXA 4MV1A 3B13B 3SJCA 1WG8A 4HGYA 5IVPA 3SVTA 3HMKA 4JJAA 1OW3B 2IW1A 3FNEA 5JD3A 3CIOA 4BQOA 4XQ0A 1GPBA 1N3BA 1XWFA 4JI3C 1XDUA 2GAIA 2WWHA 5DP2A 3UAZA 3H2YA 4HFMA 3OIVA 4KRXA 1KP9A 2GEKA 3P2OA 5B36A 1YC2A 3M4XA 1RBQA 3QEKA 4OLFA 1E3LA 3HWX1 4DIFA 5ALKA 1P1BA 3S29A 2ECPA 4KPUB 4LOJA 5EHIA 2WJPA 2BFDB 2OA0A 5L45A 3V2GA 1ZIXA 4F8YA 4EOGA 4JJEA 1EWKA 5JAHA 5IEBA 1B26A 5GINE 4D79A 2XMGA 3RABA 2H4JA 5C0OE 2C58A 3PEFA 3EBPA 3ZQUA 4B2PA 4BLQA 4LDNA 1NMEA 3QEAZ 2WSSD 5DOZA 4CF6A 4GDMA 2CDBA 2OHHA 2BWJA 2OV3A 3TTUA 3W5CA 3PGVA 3HJAA 3SIPA 4GKAA 4IILA 2VQEC 2A78A 1ECJA 1X1DA 1GEGA 2JJ1A 1CS0A 3FYCA 3HS3A 3HWWA 5EUBA 5M04A 4H15A 1KVUA 2CDCA 3N6VA 4A82A 1U5BB 4DTCA 3PLRA 4B5LA 2HDHA 4HDMB 2B5VA 1X9GA 1YCDA 4UAGA 2I7TA 2N47A 2QTHA 3R6DA 5LXTF 3T4XA 4EFNA 5ADUS 2DCMA 4FR2A 3E8SA 4RK4A 4WJLA 4BNUA 4B3RB 2WIAA 3ENZA 1M34A 3GEBA 3OEED 3GJ4A 4K1LA 1I4EB 2ODQA 1XMIA 5K2MA 2OV4A 4WOCA 2AI2A 2D4HA 2JANA 2I2BA 4MCAA 2P11A 2R8XA 4ZVPA 5J1SB 2P3LA 1TB4A 3ILXA 3E22B 1XRBA 1NUUA 2Z57A 4JT4A 1SKYB 2BKVA 3T7SA 5ABPA 5EJIA 3ETCA 1UEJA 4M1MA 2LIVA 1UPXA 1XRPA 4BNZA 4RK0A 2C2ZA 4Y2VA 3PBKA 4B09A 4KHPC 2CV0A 4N47A 1E5DA 2ZFUA 4J1QA 4LRXA 4EG3A 5F76A 5ALGA 4D26A 2F1JA 3B3JA 2GZHA 3CW8X 4MVCA 3BD6A 4EVSA 3F46A 5GJBA 1U04A 5ER6A 4YRBA 1RPJA 4JX9A 1QVWA 2FU5C 2ONCA 3BH6A 3O2QB 3ZD8A 4L50A 3NT5A 4QUBA 4EHJA 2Z6QA 3EXFA 3MM4A 1JEQB 1Z68A 3VR0A 1UKBA 1OYYA 4PFKA 4U1RA 4CDMA 3FDZB 1IY9A 2GO7A 4PV7A 2J0QA 4RHYA 2VIIA 4H59A 5FBWB 3ILHA 4ZO4A 3AI1A 2WT8A 1KU6A 1YI1A 4N18A 3OSZA 5FBLB 5TQ2B 1JVSA 3U3XA 1GCOA 3WNVA 4F4CA 5H9VA 4U7GA 4MUFA 4K88A 4YRTA 4XDGA 4YIKA 3A9TA 4FHFA 1WMFA 5TNXA 4WA7A 1CK4A 4RGBA 1KEZA 5LLTA 1PT8A 5SY9A 3W6ZA 1IEWA 4LC0A 2IELA 2F3QA 1Q0LA 1NJFA 2C97A 4TKVB 3FHLA 3KSBC 4N41A 2W6NA 3RAJA 1IN1A 4U2EA 3OO1A 1VGRA 3LCCA 3A3PA 3OF5A 4UCXA 5AKKA 3ACDA 3RU9A 4G41A 5FR1A 4LUCA 2I4IA 4INOA 4CF5A 4JS0A 1PX2A 4ZWNA 4EY8A 4FE4A 5IAOA 4MZXA 2VQSA 2O2YA 2JPDA 3PIDA 1WUTA 1E2PA 4LYDA 1PD1A 2NU9B 1C7ZA 4W6ZA 3AQIA 2GHTA 3WRXA 3E0XA 4HWGA 2OBNA 4LKRA 1PR2A 2Y2VA 3F1KA 4M87A 4NMMA 2PKQP 3FVQA 1EAYA 1W1IA 4RD4A 1CX9B 4E2WA 1E63A 3HVUA 1AD2A 3O8NA 4RVFA 3DCNA 2B92A 4XJTA 2X4DA 4Q3DA 5AICA 1R5BA 3RS8A 1SHJA 2I78A 2VF7A 5CM2Z 4BX0A 3LOQA 5IRCD 3A1UA 3KYJB 3P20A 1YUNA 2Q8PA 2X0NA 2HOQA 3FPBA 5AI0A 3SBEA 2ZJ0A 1FFEA 3ZWNA 5IDWA 2VDOB 2E1PA 4U6SA 4Q5IA 4G0VA 1YULA 1OU4A 2HWKA 5HF9A 4LDJA 3CKYA 1EE2A 3EIUA 2FN3A 1SKBA 4M6WA 1NJGA 1T6YA 2P9EA 3OQ6A 3NC0C 5LYJA 4CFSA 3Q2OA 4BEBA 4E5DA 3O84A 3X1WA 3S0JA 2PUDA 2DWOA 1VXRA 3G9QA 1KFKB 3IOCA 5GVSA 1XD8A 2NTVA 3LKVA 4ZZIA 1U81A 4UTVA 3IOYA 4D9NA 1W4CA 4NCKA