4JM1A

Crystal structure of a protein with alpha-lytic protease prodomain-like fold (bdi_0842) from parabacteroides distasonis atcc 8503 at 1.40 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
GADKYIDTITGFSCEKAAVTDNGFLVIAIDADSDSGYDMLASQFLEEAKKEGVSGLKGVLIVDIKNAKFEQGAVVGKRIGKAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BDI_0842) from Parabacteroides distasonis ATCC 8503 at 1.40 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.300 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jm1A00
4JM1A
chains in the Genus database with same CATH superfamily
4DCTA 4DV0C 5GTDA 3IMLA 1MXBA 4PZPA 4YY3C 2DPLA 4OYCA 2ZM6C 4BBYA 4LFAC 4LF7C 1XNRC 4R1MA 4BCAA 4X64C 1K0RA 5AE1A 3OTOC 2WD9A 1TH5A 1VLAA 4DR2C 1KKGA 2Y4OA 1O9TA 4B3SC 5KYTA 1GPMA 1WF3A 4LF6C 3K6RA 1LQLA 4AQYC 1USPA 4NDNA 5JRHA 1PG4A 4ZJZA 2JNVA 1M6XA 5A1GA 2MCQA 4BC7A 2P2MA 3CW9A 2UU9C 2QVXX 1ULTA 2QL8A 3E7XA 3DHVA 4RMNA 2D28C 3JAMD 4JI0C 5IT9D 4GXRA 2Y27A 4D4GA 3SO4A 4U5YD 1XHJA 2ZZMA 2VZEA 4PHTA 1XS3A 1P7LA 3FCEA 5IFIA 2EGTA 3VNQA 1EGAA 2UXCC 1XMOC 4DV7C 1HH2P 2HJGA 3GKUA 3ETOA 5K85A 3LNOA 1LCIA 4L4QA 1RY2A 4DR3C 2KZ0A 4RM3A 4BC9A 5DV9A 5ADZA 3NYQA 1FJGC 2XR1A 5BUQA 3PBKA 3J81D 4GXQA 5BSRA 5LMUC 3N54B 1N32C 2VSQA 3GR0A 3CQ2A 4PUGA 4DV2C 3TR3A 3I07A 4X62C 3GPCA 3A4IA 5A2QD 4R0MA 2D1RA 1XMQC 2M5HA 2CU6A 1UWDA 3IEUA 3N2QA 5K8FA 1M6XC 2VQEC 2P2BA 3T1HC 1T5DX 3B7WA 4LF5C 1PA4A 3RG2A 5CZVA 3S82A 3AF6A 3I08A 4MTNA 1P4EC 4I9FA 4B3MC 2YWCA 3R44A 3R9XA 2CY1A 2MM9A 5CZXA 5BSMA 3GR1A 3KXWA 4WV3A 2P20A 3O2EA 2OBVA 1V60A 4JI1C 3EQ6A 5BURA 4JI8C 2P2JA 2AYAA 4HPVA 2UXBC 3TQIA 4XX2A 1O92A 3UX3A 3A9VA 3C5EA 1V26A 3LUSA 4IR7A 4I9GA 3IPLA 3J80D 5FLXD 2E8CA 3RV2A 4DV3C 3E7WA 1L2FA 2E8FA 5AE2A 4KTVA 4WS9A 2E0GA 3UOWA 2E5LC 4FTFA 4G37A 4GKJC 2P2QA 4OXIA 2YCBA 1QWIA 3CQ3A 4JI4C 4DR1C 3A26A 5AE3A 4NXMC 2QVZX 4JI5C 1WH9A 2M5OA 2E8EA 4G1IA 4TPSB 5H9UA 1P4EA 1MD9A 1HR0C 2UXDC 5LMNC 1MXCA 1XRAA 3CQ1A 2NCLA 1FUGA 4LF8C 4B3TC 4PUIA 2UUBC 2ONFA 1I94C 3LAXA 2D7VA 3UZ0A 3UEBA 1HNWC 2DHMA 2PT7G 3R9WA 5BSWA 1USPB 4JI3C 2MMAB 2VQFC 4GKKC 1O90A 3A25A 4DUYC 1UKKA 4FUTA 2ASBA 4RVNA 4FUQA 2OO4A 4JM1A 3L8CA 4MH4A 2BH1X 2E7GA 1J5EC 2Z51A 3LGXA 1MKYA 2F4VC 4K0BA 3AY0A 5A19A 2D1SA 1NYEA 5T8TA 1ZB8A 1O93A 1N36C 3EERA 3H2TA 2D27A 4RLQA 3TDEA 2PN2A 1PG3A 2D1QA 3FCCA 3TUFA 3G7SA 2ZZNA 1PU1A 1ZB9A 4JI2C 4DV6C 1N34C 1MDFA 5KEIA 4RM2A 2P02A 2DYJA 4D56A 4L7IA 4DR4C 3VNSA 4GS5A 4DCUA 2YWBA 3UX2A 1FLOA 1BA3A 1N33C 2KZFA 3T1YC 5LCIA 4D57A 2QVYX 4JI7C 5T8SA 1QM4A 5BR8C 1N2FA 5BSTA 1IBMC 4B3RC 2HHHC 4LF4C 4PROC 2JMPA 1IBLC 1VEHA 4JV5C 1IBKC 2QW0X 1T5HX 1YJ7A 3NYRA 5BSVA 2YX1A 4G36A 5A1IA 1V25A 3NPDA 4RLFA 4X65C 1WCJA 4YHHC 2Y4NA 4R1LA 3DAYA 3CW8X 5IWAC 4OX9C 3NI2A 4ZLPA 4DCSA 1JOSA 4D4IA 4NXNC 4NOZA 1ML8A 2WP0C 4X66C 4ISBA 1RG9A 2UUCC 2OPLA 2V7BA 1HNZC 4L2ZA 4DV1C 1HNXC 2ATWA 1MXAA 2KDNA 1MDBA 4DV4C 3DLPX 1XRBA 3A9UA 3PESA 4EATA 4DUZC 3VNRA 5BSUA 4LF9C 4DCVA 2PROA 4DG9A 3IEVA 4DR5C 3PROC 2D1TA 4KHPC 2BJOA 2P2FA 3CJEA 4DR7C 4JYAC 5BUSA 4BSZA 3L95X 4K0KC 1XRCA 4RVOA 4LFCC 3AF5A 4IZ6A 2UUAC 4DV5C 4DR6C 1IB8A 4LE5A 4DG8A 5KYVA 2OPLB 4PUHA 1NY8A 1XNQC 4ODJA 4LFBC 3LNVA 1AMUA 4KTTA 5E7QA 2CXCA 3ETCA 4JI6C
chains in the Genus database with same CATH topology
4DCTA 4DV0C 5GTDA 3IMLA 1MXBA 4PZPA 4YY3C 2DPLA 4OYCA 2ZM6C 4BBYA 4LFAC 4LF7C 1XNRC 4R1MA 4BCAA 4X64C 1K0RA 5AE1A 3OTOC 2WD9A 1VLAA 4DR2C 1KKGA 2Y4OA 1O9TA 4B3SC 5KYTA 1GPMA 1WF3A 4LF6C 1LQLA 1USPA 4NDNA 4AQYC 5JRHA 1PG4A 4ZJZA 5A1GA 4BC7A 2P2MA 3CW9A 2UU9C 2QVXX 1ULTA 2QL8A 3E7XA 3DHVA 4RMNA 2D28C 3JAMD 4JI0C 5IT9D 4GXRA 2Y27A 4D4GA 3SO4A 4U5YD 2VZEA 4PHTA 1P7LA 3FCEA 5IFIA 2EGTA 3VNQA 1EGAA 2UXCC 1XMOC 4DV7C 1HH2P 2HJGA 3GKUA 3ETOA 5K85A 1LCIA 4L4QA 1RY2A 4DR3C 4RM3A 4BC9A 5DV9A 5ADZA 3NYQA 1FJGC 2XR1A 5BUQA 3PBKA 3J81D 4GXQA 5BSRA 5LMUC 3N54B 1N32C 2VSQA 3GR0A 4DV2C 3I07A 4X62C 3GPCA 3A4IA 5A2QD 4R0MA 2D1RA 1XMQC 3IEUA 3N2QA 5K8FA 2VQEC 2P2BA 3T1HC 1T5DX 3B7WA 4LF5C 1PA4A 3RG2A 5CZVA 3S82A 3AF6A 3I08A 4MTNA 4I9FA 4B3MC 2YWCA 3R44A 3R9XA 2CY1A 5CZXA 5BSMA 3GR1A 3KXWA 4WV3A 2P20A 2OBVA 4JI1C 3EQ6A 4JI8C 5BURA 2P2JA 2AYAA 4HPVA 2UXBC 3TQIA 4XX2A 1O92A 3A9VA 3C5EA 1V26A 3LUSA 4IR7A 4I9GA 3IPLA 3J80D 5FLXD 2E8CA 3RV2A 4DV3C 3E7WA 1L2FA 2E8FA 5AE2A 4KTVA 4WS9A 2E0GA 3UOWA 2E5LC 4FTFA 4G37A 4GKJC 2P2QA 4OXIA 2YCBA 1QWIA 4JI4C 4DR1C 5AE3A 4NXMC 2QVZX 4JI5C 1WH9A 2E8EA 4G1IA 4TPSB 5H9UA 1MD9A 1HR0C 2UXDC 5LMNC 1MXCA 1XRAA 1FUGA 4LF8C 4B3TC 2UUBC 2ONFA 1I94C 3LAXA 2D7VA 3UZ0A 1HNWC 2PT7G 3R9WA 5BSWA 1USPB 4JI3C 2VQFC 4GKKC 1O90A 4DUYC 1UKKA 4FUTA 2ASBA 4RVNA 4FUQA 2OO4A 4JM1A 3L8CA 4MH4A 2BH1X 2E7GA 1J5EC 3LGXA 1MKYA 2F4VC 4K0BA 5A19A 2D1SA 1NYEA 5T8TA 1ZB8A 1O93A 1N36C 3EERA 3H2TA 2D27A 4RLQA 3TDEA 2PN2A 1PG3A 2D1QA 3FCCA 3TUFA 3G7SA 1ZB9A 4JI2C 4DV6C 1N34C 1MDFA 5KEIA 4RM2A 2P02A 2DYJA 4D56A 4L7IA 4DR4C 3VNSA 4GS5A 4DCUA 2YWBA 1BA3A 1N33C 2KZFA 3T1YC 4D57A 2QVYX 4JI7C 5T8SA 1QM4A 5BR8C 1N2FA 5BSTA 1IBMC 4B3RC 2HHHC 4LF4C 4PROC 2JMPA 1IBLC 4JV5C 1IBKC 2QW0X 1T5HX 1YJ7A 3NYRA 5BSVA 4G36A 5A1IA 1V25A 3NPDA 4RLFA 4X65C 4YHHC 2Y4NA 4R1LA 3DAYA 3CW8X 5IWAC 4OX9C 3NI2A 4ZLPA 4DCSA 1JOSA 4D4IA 4NXNC 4NOZA 1ML8A 2WP0C 4X66C 4ISBA 1RG9A 2UUCC 2OPLA 2V7BA 1HNZC 4L2ZA 4DV1C 1HNXC 2ATWA 1MXAA 1MDBA 4DV4C 3DLPX 1XRBA 3A9UA 3PESA 4EATA 4DUZC 3VNRA 5BSUA 4LF9C 4DCVA 2PROA 4DG9A 3IEVA 4DR5C 3PROC 2D1TA 4KHPC 2BJOA 2P2FA 3CJEA 4DR7C 4JYAC 5BUSA 4BSZA 3L95X 4K0KC 1XRCA 4RVOA 4LFCC 3AF5A 4IZ6A 2UUAC 4DV5C 4DR6C 4LE5A 4DG8A 5KYVA 2OPLB 1XNQC 4ODJA 4LFBC 3LNVA 1AMUA 4KTTA 5E7QA 2CXCA 3ETCA 4JI6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JM1 A; 
#chains in the Genus database with same CATH topology
 4DCT A;  4DV0 C;  5GTD A;  3IML A;  1MXB A;  4PZP A;  4YY3 C;  2DPL A;  4OYC A;  2ZM6 C;  4BBY A;  4LFA C;  4LF7 C;  1XNR C;  4R1M A;  4BCA A;  4X64 C;  1K0R A;  5AE1 A;  3OTO C;  2WD9 A;  1TH5 A;  1VLA A;  4DR2 C;  1KKG A;  2Y4O A;  1O9T A;  4B3S C;  5KYT A;  1GPM A;  1WF3 A;  4LF6 C;  3K6R A;  1LQL A;  4AQY C;  1USP A;  4NDN A;  5JRH A;  1PG4 A;  4ZJZ A;  2JNV A;  1M6X A;  5A1G A;  2MCQ A;  4BC7 A;  2P2M A;  3CW9 A;  2UU9 C;  2QVX X;  1ULT A;  2QL8 A;  3E7X A;  3DHV A;  4RMN A;  2D28 C;  3JAM D;  4JI0 C;  5IT9 D;  4GXR A;  2Y27 A;  4D4G A;  3SO4 A;  4U5Y D;  1XHJ A;  2ZZM A;  2VZE A;  4PHT A;  1XS3 A;  1P7L A;  3FCE A;  5IFI A;  2EGT A;  3VNQ A;  1EGA A;  2UXC C;  1XMO C;  4DV7 C;  1HH2 P;  2HJG A;  3GKU A;  3ETO A;  5K85 A;  3LNO A;  1LCI A;  4L4Q A;  1RY2 A;  4DR3 C;  2KZ0 A;  4RM3 A;  4BC9 A;  5DV9 A;  5ADZ A;  3NYQ A;  1FJG C;  2XR1 A;  5BUQ A;  3PBK A;  3J81 D;  4GXQ A;  5BSR A;  5LMU C;  3N54 B;  1N32 C;  2VSQ A;  3GR0 A;  3CQ2 A;  4PUG A;  4DV2 C;  3TR3 A;  3I07 A;  4X62 C;  3GPC A;  3A4I A;  5A2Q D;  4R0M A;  2D1R A;  1XMQ C;  2M5H A;  2CU6 A;  1UWD A;  3IEU A;  3N2Q A;  5K8F A;  1M6X C;  2VQE C;  2P2B A;  3T1H C;  1T5D X;  3B7W A;  4LF5 C;  1PA4 A;  3RG2 A;  5CZV A;  3S82 A;  3AF6 A;  3I08 A;  4MTN A;  1P4E C;  4I9F A;  4B3M C;  2YWC A;  3R44 A;  3R9X A;  2CY1 A;  2MM9 A;  5CZX A;  5BSM A;  3GR1 A;  3KXW A;  4WV3 A;  2P20 A;  3O2E A;  2OBV A;  1V60 A;  4JI1 C;  3EQ6 A;  5BUR A;  4JI8 C;  2P2J A;  2AYA A;  4HPV A;  2UXB C;  3TQI A;  4XX2 A;  1O92 A;  3UX3 A;  3A9V A;  3C5E A;  1V26 A;  3LUS A;  4IR7 A;  4I9G A;  3IPL A;  3J80 D;  5FLX D;  2E8C A;  3RV2 A;  4DV3 C;  3E7W A;  1L2F A;  2E8F A;  5AE2 A;  4KTV A;  4WS9 A;  2E0G A;  3UOW A;  2E5L C;  4FTF A;  4G37 A;  4GKJ C;  2P2Q A;  4OXI A;  2YCB A;  1QWI A;  3CQ3 A;  4JI4 C;  4DR1 C;  3A26 A;  5AE3 A;  4NXM C;  2QVZ X;  4JI5 C;  1WH9 A;  2M5O A;  2E8E A;  4G1I A;  4TPS B;  5H9U A;  1P4E A;  1MD9 A;  1HR0 C;  2UXD C;  5LMN C;  1MXC A;  1XRA A;  3CQ1 A;  2NCL A;  1FUG A;  4LF8 C;  4B3T C;  4PUI A;  2UUB C;  2ONF A;  1I94 C;  3LAX A;  2D7V A;  3UZ0 A;  3UEB A;  1HNW C;  2DHM A;  2PT7 G;  3R9W A;  5BSW A;  1USP B;  4JI3 C;  2MMA B;  2VQF C;  4GKK C;  1O90 A;  3A25 A;  4DUY C;  1UKK A;  4FUT A;  2ASB A;  4RVN A;  4FUQ A;  2OO4 A;  4JM1 A;  3L8C A;  4MH4 A;  2BH1 X;  2E7G A;  1J5E C;  2Z51 A;  3LGX A;  1MKY A;  2F4V C;  4K0B A;  3AY0 A;  5A19 A;  2D1S A;  1NYE A;  5T8T A;  1ZB8 A;  1O93 A;  1N36 C;  3EER A;  3H2T A;  2D27 A;  4RLQ A;  3TDE A;  2PN2 A;  1PG3 A;  2D1Q A;  3FCC A;  3TUF A;  3G7S A;  2ZZN A;  1PU1 A;  1ZB9 A;  4JI2 C;  4DV6 C;  1N34 C;  1MDF A;  5KEI A;  4RM2 A;  2P02 A;  2DYJ A;  4D56 A;  4L7I A;  4DR4 C;  3VNS A;  4GS5 A;  4DCU A;  2YWB A;  3UX2 A;  1FLO A;  1BA3 A;  1N33 C;  2KZF A;  3T1Y C;  5LCI A;  4D57 A;  2QVY X;  4JI7 C;  5T8S A;  1QM4 A;  5BR8 C;  1N2F A;  5BST A;  1IBM C;  4B3R C;  2HHH C;  4LF4 C;  4PRO C;  2JMP A;  1IBL C;  1VEH A;  4JV5 C;  1IBK C;  2QW0 X;  1T5H X;  1YJ7 A;  3NYR A;  5BSV A;  2YX1 A;  4G36 A;  5A1I A;  1V25 A;  3NPD A;  4RLF A;  4X65 C;  1WCJ A;  4YHH C;  2Y4N A;  4R1L A;  3DAY A;  3CW8 X;  5IWA C;  4OX9 C;  3NI2 A;  4ZLP A;  4DCS A;  1JOS A;  4D4I A;  4NXN C;  4NOZ A;  1ML8 A;  2WP0 C;  4X66 C;  4ISB A;  1RG9 A;  2UUC C;  2OPL A;  2V7B A;  1HNZ C;  4L2Z A;  4DV1 C;  1HNX C;  2ATW A;  1MXA A;  2KDN A;  1MDB A;  4DV4 C;  3DLP X;  1XRB A;  3A9U A;  3PES A;  4EAT A;  4DUZ C;  3VNR A;  5BSU A;  4LF9 C;  4DCV A;  2PRO A;  4DG9 A;  3IEV A;  4DR5 C;  3PRO C;  2D1T A;  4KHP C;  2BJO A;  2P2F A;  3CJE A;  4DR7 C;  4JYA C;  5BUS A;  4BSZ A;  3L95 X;  4K0K C;  1XRC A;  4RVO A;  4LFC C;  3AF5 A;  4IZ6 A;  2UUA C;  4DV5 C;  4DR6 C;  1IB8 A;  4LE5 A;  4DG8 A;  5KYV A;  2OPL B;  4PUH A;  1NY8 A;  1XNQ C;  4ODJ A;  4LFB C;  3LNV A;  1AMU A;  4KTT A;  5E7Q A;  2CXC A;  3ETC A;  4JI6 C; 
#chains in the Genus database with same CATH homology
 4DCT A;  4DV0 C;  5GTD A;  3IML A;  1MXB A;  4PZP A;  4YY3 C;  2DPL A;  4OYC A;  2ZM6 C;  4BBY A;  4LFA C;  4LF7 C;  1XNR C;  4R1M A;  4BCA A;  4X64 C;  1K0R A;  5AE1 A;  3OTO C;  2WD9 A;  1VLA A;  4DR2 C;  1KKG A;  2Y4O A;  1O9T A;  4B3S C;  5KYT A;  1GPM A;  1WF3 A;  4LF6 C;  1LQL A;  1USP A;  4NDN A;  4AQY C;  5JRH A;  1PG4 A;  4ZJZ A;  5A1G A;  4BC7 A;  2P2M A;  3CW9 A;  2UU9 C;  2QVX X;  1ULT A;  2QL8 A;  3E7X A;  3DHV A;  4RMN A;  2D28 C;  3JAM D;  4JI0 C;  5IT9 D;  4GXR A;  2Y27 A;  4D4G A;  3SO4 A;  4U5Y D;  2VZE A;  4PHT A;  1P7L A;  3FCE A;  5IFI A;  2EGT A;  3VNQ A;  1EGA A;  2UXC C;  1XMO C;  4DV7 C;  1HH2 P;  2HJG A;  3GKU A;  3ETO A;  5K85 A;  1LCI A;  4L4Q A;  1RY2 A;  4DR3 C;  4RM3 A;  4BC9 A;  5DV9 A;  5ADZ A;  3NYQ A;  1FJG C;  2XR1 A;  5BUQ A;  3PBK A;  3J81 D;  4GXQ A;  5BSR A;  5LMU C;  3N54 B;  1N32 C;  2VSQ A;  3GR0 A;  4DV2 C;  3I07 A;  4X62 C;  3GPC A;  3A4I A;  5A2Q D;  4R0M A;  2D1R A;  1XMQ C;  3IEU A;  3N2Q A;  5K8F A;  2VQE C;  2P2B A;  3T1H C;  1T5D X;  3B7W A;  4LF5 C;  1PA4 A;  3RG2 A;  5CZV A;  3S82 A;  3AF6 A;  3I08 A;  4MTN A;  4I9F A;  4B3M C;  2YWC A;  3R44 A;  3R9X A;  2CY1 A;  5CZX A;  5BSM A;  3GR1 A;  3KXW A;  4WV3 A;  2P20 A;  2OBV A;  4JI1 C;  3EQ6 A;  4JI8 C;  5BUR A;  2P2J A;  2AYA A;  4HPV A;  2UXB C;  3TQI A;  4XX2 A;  1O92 A;  3A9V A;  3C5E A;  1V26 A;  3LUS A;  4IR7 A;  4I9G A;  3IPL A;  3J80 D;  5FLX D;  2E8C A;  3RV2 A;  4DV3 C;  3E7W A;  1L2F A;  2E8F A;  5AE2 A;  4KTV A;  4WS9 A;  2E0G A;  3UOW A;  2E5L C;  4FTF A;  4G37 A;  4GKJ C;  2P2Q A;  4OXI A;  2YCB A;  1QWI A;  4JI4 C;  4DR1 C;  5AE3 A;  4NXM C;  2QVZ X;  4JI5 C;  1WH9 A;  2E8E A;  4G1I A;  4TPS B;  5H9U A;  1MD9 A;  1HR0 C;  2UXD C;  5LMN C;  1MXC A;  1XRA A;  1FUG A;  4LF8 C;  4B3T C;  2UUB C;  2ONF A;  1I94 C;  3LAX A;  2D7V A;  3UZ0 A;  1HNW C;  2PT7 G;  3R9W A;  5BSW A;  1USP B;  4JI3 C;  2VQF C;  4GKK C;  1O90 A;  4DUY C;  1UKK A;  4FUT A;  2ASB A;  4RVN A;  4FUQ A;  2OO4 A;  4JM1 A;  3L8C A;  4MH4 A;  2BH1 X;  2E7G A;  1J5E C;  3LGX A;  1MKY A;  2F4V C;  4K0B A;  5A19 A;  2D1S A;  1NYE A;  5T8T A;  1ZB8 A;  1O93 A;  1N36 C;  3EER A;  3H2T A;  2D27 A;  4RLQ A;  3TDE A;  2PN2 A;  1PG3 A;  2D1Q A;  3FCC A;  3TUF A;  3G7S A;  1ZB9 A;  4JI2 C;  4DV6 C;  1N34 C;  1MDF A;  5KEI A;  4RM2 A;  2P02 A;  2DYJ A;  4D56 A;  4L7I A;  4DR4 C;  3VNS A;  4GS5 A;  4DCU A;  2YWB A;  1BA3 A;  1N33 C;  2KZF A;  3T1Y C;  4D57 A;  2QVY X;  4JI7 C;  5T8S A;  1QM4 A;  5BR8 C;  1N2F A;  5BST A;  1IBM C;  4B3R C;  2HHH C;  4LF4 C;  4PRO C;  2JMP A;  1IBL C;  4JV5 C;  1IBK C;  2QW0 X;  1T5H X;  1YJ7 A;  3NYR A;  5BSV A;  4G36 A;  5A1I A;  1V25 A;  3NPD A;  4RLF A;  4X65 C;  4YHH C;  2Y4N A;  4R1L A;  3DAY A;  3CW8 X;  5IWA C;  4OX9 C;  3NI2 A;  4ZLP A;  4DCS A;  1JOS A;  4D4I A;  4NXN C;  4NOZ A;  1ML8 A;  2WP0 C;  4X66 C;  4ISB A;  1RG9 A;  2UUC C;  2OPL A;  2V7B A;  1HNZ C;  4L2Z A;  4DV1 C;  1HNX C;  2ATW A;  1MXA A;  1MDB A;  4DV4 C;  3DLP X;  1XRB A;  3A9U A;  3PES A;  4EAT A;  4DUZ C;  3VNR A;  5BSU A;  4LF9 C;  4DCV A;  2PRO A;  4DG9 A;  3IEV A;  4DR5 C;  3PRO C;  2D1T A;  4KHP C;  2BJO A;  2P2F A;  3CJE A;  4DR7 C;  4JYA C;  5BUS A;  4BSZ A;  3L95 X;  4K0K C;  1XRC A;  4RVO A;  4LFC C;  3AF5 A;  4IZ6 A;  2UUA C;  4DV5 C;  4DR6 C;  4LE5 A;  4DG8 A;  5KYV A;  2OPL B;  1XNQ C;  4ODJ A;  4LFB C;  3LNV A;  1AMU A;  4KTT A;  5E7Q A;  2CXC A;  3ETC A;  4JI6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...