4JM1A

Crystal structure of a protein with alpha-lytic protease prodomain-like fold (bdi_0842) from parabacteroides distasonis atcc 8503 at 1.40 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
GADKYIDTITGFSCEKAAVTDNGFLVIAIDADSDSGYDMLASQFLEEAKKEGVSGLKGVLIVDIKNAKFEQGAVVGKRIGKAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BDI_0842) from Parabacteroides distasonis ATCC 8503 at 1.40 A resolution
rcsb
source organism Parabacteroides distasonis
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.300 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jm1A00
4JM1A
chains in the Genus database with same CATH superfamily
4PHTA 4DR3C 2D1SA 1XRAA 4D57A 1IBMC 4JI8C 3NPDA 2OPLA 4DV0C 4BBYA 4HPVA 2Y4NA 1IBLC 3N2QA 2E8FA 4GKJC 1IB8A 2VSQA 4JI7C 4JI1C 3CQ1A 3A26A 1RG9A 3OTOC 1BA3A 5ADZA 3B7WA 4JI5C 1USPB 4B3RC 3R9WA 2CU6A 2YX1A 2PT7G 1PA4A 4DV2C 5A2QD 2D1QA 2XR1A 1XMQC 1N34C 3J80D 4XX2A 4RLQA 4DCUA 1L2FA 4DV6C 4LE5A 3VNSA 1FUGA 2V7BA 2VQFC 3E7XA 2PROA 4NXMC 5A19A 5IWAC 5KEIA 3JAMD 3CW9A 4MTNA 4BC9A 2OO4A 1FLOA 4JI6C 1MXBA 2Y27A 4L2ZA 4NDNA 5BUSA 2UUBC 2VZEA 4X64C 2P2JA 2HJGA 2BH1X 5LMNC 4FTFA 3RV2A 4DUYC 3G7SA 1LCIA 4I9GA 5BSVA 2E7GA 4LF4C 2OPLB 4DCTA 1MDBA 4AQYC 5BR8C 1MXCA 5IFIA 2D1RA 4U5YD 2YCBA 2QW0X 2E0GA 4RVNA 3CQ2A 3TQIA 4JI2C 1O92A 2BJOA 3NI2A 3PBKA 4I9FA 3R44A 1J5EC 3A4IA 3FCEA 4JI4C 2E8CA 2VQEC 3R9XA 1WF3A 3VNQA 5E7QA 3J81D 1GPMA 4L7IA 1I94C 1IBKC 4RLFA 3UX2A 1YJ7A 5BSMA 1HH2P 3SO4A 2CXCA 4DV7C 3T1HC 2ZZNA 5A1GA 3DAYA 4DR6C 5AE2A 1M6XA 3I08A 1EGAA 2ZM6C 1MKYA 1PU1A 1V60A 2JNVA 4OXIA 3CJEA 4IZ6A 1QM4A 1RY2A 1V25A 4KTTA 2MM9A 2NCLA 2P2MA 5FLXD 3IMLA 3N54B 2E5LC 4RM3A 1QWIA 4PZPA 2UXDC 1ZB9A 4OYCA 2JMPA 2UUAC 4B3TC 3EQ6A 4RMNA 5KYVA 1T5DX 4BC7A 1T5HX 5LCIA 1VEHA 4PUHA 2KDNA 4DG9A 4GKKC 4LFCC 2P2QA 2HHHC 5LMUC 3UX3A 4GXRA 2QVZX 2YWCA 4JYAC 4NOZA 5T8SA 2DYJA 4DCSA 1P4EC 4KTVA 5AE3A 2P2BA 3UZ0A 3KXWA 3TDEA 2ONFA 2CY1A 4WV3A 5BURA 1UWDA 3DHVA 4RM2A 5KYTA 5BSTA 5DV9A 2P2FA 1XRBA 4LF6C 4DV4C 4DG8A 1N36C 2YWBA 4G37A 1XNRC 3S82A 5BSUA 3LGXA 4DR1C 2AYAA 1LQLA 1MXAA 1HNXC 3DLPX 1AMUA 3ETCA 4G1IA 2QVYX 1WCJA 2KZ0A 4MH4A 4K0KC 4LF8C 1ZB8A 4FUQA 3CW8X 1ULTA 4ZLPA 4DR5C 4R1MA 2E8EA 2Y4OA 3GKUA 2EGTA 3EERA 4ODJA 1ML8A 3IEUA 4PUIA 3NYRA 4L4QA 2D27A 1O90A 3TUFA 1TH5A 4LFAC 3FCCA 1XRCA 3A9VA 1P7LA 5CZXA 2P02A 4BSZA 4R0MA 4DR2C 4DV5C 5JRHA 4DUZC 1VLAA 4X62C 4GS5A 1HR0C 4ISBA 2P20A 4IR7A 4LF7C 2M5HA 4D56A 2WD9A 4LFBC 2KZFA 1PG4A 3A25A 1HNWC 4OX9C 5BUQA 1WH9A 1NY8A 3IEVA 3AF6A 1MDFA 5A1IA 3I07A 3UOWA 2D7VA 5CZVA 1PG3A 2UUCC 4D4IA 3GR1A 3T1YC 2UXCC 1UKKA 3PROC 1V26A 4X66C 1MD9A 3O2EA 1KKGA 2MMAB 1K0RA 4PUGA 3H2TA 4G36A 4JI0C 5GTDA 3UEBA 3L95X 4EATA 2D28C 4LF5C 2OBVA 1XS3A 3IPLA 2UU9C 1N33C 1O9TA 2DPLA 4TPSB 3LNOA 4K0BA 4YHHC 2D1TA 3NYQA 4YY3C 5K8FA 4FUTA 3VNRA 3L8CA 4NXNC 4X65C 1M6XC 1XHJA 3AF5A 4R1LA 4PROC 2ATWA 4JI3C 5AE1A 5H9UA 5IT9D 2Z51A 4DV3C 3CQ3A 4GXQA 2QVXX 2PN2A 5K85A 1HNZC 3A9UA 2QL8A 4DV1C 5BSRA 4ZJZA 3AY0A 2WP0C 1O93A 4BCAA 3ETOA 2ASBA 2F4VC 4KHPC 3GPCA 1FJGC 4LF9C 3C5EA 1N32C 2DHMA 4WS9A 3RG2A 1USPA 4JM1A 3K6RA 4B3MC 4JV5C 2MCQA 1XMOC 1JOSA 1N2FA 4DR7C 2M5OA 3LNVA 4DR4C 4D4GA 5BSWA 2UXBC 4DCVA 1P4EA 1NYEA 4B3SC 2ZZMA 3GR0A 5T8TA 1XNQC 3PESA 3LAXA 3LUSA 3E7WA 3TR3A 4RVOA
chains in the Genus database with same CATH topology
4PHTA 4DR3C 2D1SA 1XRAA 4D57A 1IBMC 4JI8C 3NPDA 2OPLA 4DV0C 4BBYA 4HPVA 2Y4NA 1IBLC 3N2QA 2E8FA 4GKJC 2VSQA 4JI7C 4JI1C 1RG9A 3OTOC 1BA3A 5ADZA 3B7WA 4JI5C 1USPB 4B3RC 3R9WA 2PT7G 1PA4A 4DV2C 5A2QD 2D1QA 2XR1A 1XMQC 1N34C 3J80D 4XX2A 4RLQA 4DCUA 1L2FA 4DV6C 4LE5A 3VNSA 1FUGA 2V7BA 2VQFC 3E7XA 2PROA 4NXMC 5A19A 5IWAC 5KEIA 3JAMD 3CW9A 4MTNA 4BC9A 2OO4A 4JI6C 1MXBA 2Y27A 4L2ZA 4NDNA 5BUSA 2UUBC 2VZEA 4X64C 2P2JA 2HJGA 2BH1X 5LMNC 4FTFA 3RV2A 4DUYC 3G7SA 1LCIA 4I9GA 5BSVA 2E7GA 4LF4C 2OPLB 4DCTA 1MDBA 4AQYC 5BR8C 1MXCA 5IFIA 2D1RA 4U5YD 2YCBA 2QW0X 2E0GA 4RVNA 3TQIA 4JI2C 1O92A 2BJOA 3NI2A 3PBKA 4I9FA 3R44A 1J5EC 3A4IA 3FCEA 4JI4C 2E8CA 2VQEC 3R9XA 1WF3A 3VNQA 5E7QA 3J81D 1GPMA 4L7IA 1I94C 1IBKC 4RLFA 1YJ7A 5BSMA 1HH2P 3SO4A 2CXCA 4DV7C 3T1HC 5A1GA 3DAYA 4DR6C 5AE2A 3I08A 1EGAA 2ZM6C 1MKYA 4OXIA 4IZ6A 1QM4A 1RY2A 1V25A 4KTTA 2P2MA 5FLXD 3IMLA 3N54B 2E5LC 4RM3A 1QWIA 4PZPA 2UXDC 1ZB9A 4OYCA 2JMPA 2UUAC 4B3TC 3EQ6A 4RMNA 5KYVA 1T5DX 4BC7A 1T5HX 4DG9A 4GKKC 4LFCC 2P2QA 2HHHC 5LMUC 4GXRA 2QVZX 2YWCA 4JYAC 4NOZA 5T8SA 2DYJA 4DCSA 4KTVA 5AE3A 2P2BA 3UZ0A 3KXWA 3TDEA 2ONFA 2CY1A 4WV3A 5BURA 3DHVA 4RM2A 5KYTA 5BSTA 5DV9A 2P2FA 1XRBA 4LF6C 4DV4C 4DG8A 1N36C 2YWBA 4G37A 1XNRC 3S82A 5BSUA 3LGXA 4DR1C 2AYAA 1LQLA 1MXAA 1HNXC 3DLPX 1AMUA 3ETCA 4G1IA 2QVYX 4MH4A 4K0KC 4LF8C 1ZB8A 4FUQA 3CW8X 1ULTA 4ZLPA 4DR5C 4R1MA 2E8EA 2Y4OA 3GKUA 2EGTA 3EERA 4ODJA 1ML8A 3IEUA 3NYRA 4L4QA 2D27A 1O90A 3TUFA 4LFAC 3FCCA 1XRCA 3A9VA 1P7LA 5CZXA 2P02A 4BSZA 4R0MA 4DR2C 4DV5C 5JRHA 4DUZC 1VLAA 4X62C 4GS5A 1HR0C 4ISBA 2P20A 4IR7A 4LF7C 4D56A 4LFBC 2WD9A 2KZFA 1PG4A 1HNWC 4OX9C 5BUQA 1WH9A 3IEVA 3AF6A 1MDFA 5A1IA 3I07A 3UOWA 2D7VA 5CZVA 1PG3A 2UUCC 4D4IA 3GR1A 3T1YC 2UXCC 1UKKA 3PROC 1V26A 4X66C 1MD9A 1KKGA 1K0RA 3H2TA 4G36A 4JI0C 5GTDA 3L95X 4EATA 2D28C 4LF5C 2OBVA 3IPLA 2UU9C 1N33C 1O9TA 2DPLA 4TPSB 4YHHC 4K0BA 2D1TA 3NYQA 4YY3C 5K8FA 4FUTA 3VNRA 3L8CA 4NXNC 4X65C 3AF5A 4R1LA 4PROC 2ATWA 4JI3C 5AE1A 5H9UA 5IT9D 4DV3C 4GXQA 2QVXX 2PN2A 5K85A 1HNZC 3A9UA 2QL8A 4DV1C 5BSRA 4ZJZA 2WP0C 1O93A 4BCAA 3ETOA 2ASBA 2F4VC 4KHPC 3GPCA 1FJGC 4LF9C 3C5EA 1N32C 4WS9A 3RG2A 1USPA 4JM1A 4B3MC 4JV5C 1XMOC 1JOSA 1N2FA 4DR7C 3LNVA 4DR4C 4D4GA 5BSWA 2UXBC 4DCVA 1NYEA 4B3SC 3GR0A 5T8TA 1XNQC 3PESA 3LAXA 3LUSA 3E7WA 3CJEA 4RVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JM1 A; 
#chains in the Genus database with same CATH topology
 4PHT A;  4DR3 C;  2D1S A;  1XRA A;  4D57 A;  1IBM C;  4JI8 C;  3NPD A;  2OPL A;  4DV0 C;  4BBY A;  4HPV A;  2Y4N A;  1IBL C;  3N2Q A;  2E8F A;  4GKJ C;  1IB8 A;  2VSQ A;  4JI7 C;  4JI1 C;  3CQ1 A;  3A26 A;  1RG9 A;  3OTO C;  1BA3 A;  5ADZ A;  3B7W A;  4JI5 C;  1USP B;  4B3R C;  3R9W A;  2CU6 A;  2YX1 A;  2PT7 G;  1PA4 A;  4DV2 C;  5A2Q D;  2D1Q A;  2XR1 A;  1XMQ C;  1N34 C;  3J80 D;  4XX2 A;  4RLQ A;  4DCU A;  1L2F A;  4DV6 C;  4LE5 A;  3VNS A;  1FUG A;  2V7B A;  2VQF C;  3E7X A;  2PRO A;  4NXM C;  5A19 A;  5IWA C;  5KEI A;  3JAM D;  3CW9 A;  4MTN A;  4BC9 A;  2OO4 A;  1FLO A;  4JI6 C;  1MXB A;  2Y27 A;  4L2Z A;  4NDN A;  5BUS A;  2UUB C;  2VZE A;  4X64 C;  2P2J A;  2HJG A;  2BH1 X;  5LMN C;  4FTF A;  3RV2 A;  4DUY C;  3G7S A;  1LCI A;  4I9G A;  5BSV A;  2E7G A;  4LF4 C;  2OPL B;  4DCT A;  1MDB A;  4AQY C;  5BR8 C;  1MXC A;  5IFI A;  2D1R A;  4U5Y D;  2YCB A;  2QW0 X;  2E0G A;  4RVN A;  3CQ2 A;  3TQI A;  4JI2 C;  1O92 A;  2BJO A;  3NI2 A;  3PBK A;  4I9F A;  3R44 A;  1J5E C;  3A4I A;  3FCE A;  4JI4 C;  2E8C A;  2VQE C;  3R9X A;  1WF3 A;  3VNQ A;  5E7Q A;  3J81 D;  1GPM A;  4L7I A;  1I94 C;  1IBK C;  4RLF A;  3UX2 A;  1YJ7 A;  5BSM A;  1HH2 P;  3SO4 A;  2CXC A;  4DV7 C;  3T1H C;  2ZZN A;  5A1G A;  3DAY A;  4DR6 C;  5AE2 A;  1M6X A;  3I08 A;  1EGA A;  2ZM6 C;  1MKY A;  1PU1 A;  1V60 A;  2JNV A;  4OXI A;  3CJE A;  4IZ6 A;  1QM4 A;  1RY2 A;  1V25 A;  4KTT A;  2MM9 A;  2NCL A;  2P2M A;  5FLX D;  3IML A;  3N54 B;  2E5L C;  4RM3 A;  1QWI A;  4PZP A;  2UXD C;  1ZB9 A;  4OYC A;  2JMP A;  2UUA C;  4B3T C;  3EQ6 A;  4RMN A;  5KYV A;  1T5D X;  4BC7 A;  1T5H X;  5LCI A;  1VEH A;  4PUH A;  2KDN A;  4DG9 A;  4GKK C;  4LFC C;  2P2Q A;  2HHH C;  5LMU C;  3UX3 A;  4GXR A;  2QVZ X;  2YWC A;  4JYA C;  4NOZ A;  5T8S A;  2DYJ A;  4DCS A;  1P4E C;  4KTV A;  5AE3 A;  2P2B A;  3UZ0 A;  3KXW A;  3TDE A;  2ONF A;  2CY1 A;  4WV3 A;  5BUR A;  1UWD A;  3DHV A;  4RM2 A;  5KYT A;  5BST A;  5DV9 A;  2P2F A;  1XRB A;  4LF6 C;  4DV4 C;  4DG8 A;  1N36 C;  2YWB A;  4G37 A;  1XNR C;  3S82 A;  5BSU A;  3LGX A;  4DR1 C;  2AYA A;  1LQL A;  1MXA A;  1HNX C;  3DLP X;  1AMU A;  3ETC A;  4G1I A;  2QVY X;  1WCJ A;  2KZ0 A;  4MH4 A;  4K0K C;  4LF8 C;  1ZB8 A;  4FUQ A;  3CW8 X;  1ULT A;  4ZLP A;  4DR5 C;  4R1M A;  2E8E A;  2Y4O A;  3GKU A;  2EGT A;  3EER A;  4ODJ A;  1ML8 A;  3IEU A;  4PUI A;  3NYR A;  4L4Q A;  2D27 A;  1O90 A;  3TUF A;  1TH5 A;  4LFA C;  3FCC A;  1XRC A;  3A9V A;  1P7L A;  5CZX A;  2P02 A;  4BSZ A;  4R0M A;  4DR2 C;  4DV5 C;  5JRH A;  4DUZ C;  1VLA A;  4X62 C;  4GS5 A;  1HR0 C;  4ISB A;  2P20 A;  4IR7 A;  4LF7 C;  2M5H A;  4D56 A;  2WD9 A;  4LFB C;  2KZF A;  1PG4 A;  3A25 A;  1HNW C;  4OX9 C;  5BUQ A;  1WH9 A;  1NY8 A;  3IEV A;  3AF6 A;  1MDF A;  5A1I A;  3I07 A;  3UOW A;  2D7V A;  5CZV A;  1PG3 A;  2UUC C;  4D4I A;  3GR1 A;  3T1Y C;  2UXC C;  1UKK A;  3PRO C;  1V26 A;  4X66 C;  1MD9 A;  3O2E A;  1KKG A;  2MMA B;  1K0R A;  4PUG A;  3H2T A;  4G36 A;  4JI0 C;  5GTD A;  3UEB A;  3L95 X;  4EAT A;  2D28 C;  4LF5 C;  2OBV A;  1XS3 A;  3IPL A;  2UU9 C;  1N33 C;  1O9T A;  2DPL A;  4TPS B;  3LNO A;  4K0B A;  4YHH C;  2D1T A;  3NYQ A;  4YY3 C;  5K8F A;  4FUT A;  3VNR A;  3L8C A;  4NXN C;  4X65 C;  1M6X C;  1XHJ A;  3AF5 A;  4R1L A;  4PRO C;  2ATW A;  4JI3 C;  5AE1 A;  5H9U A;  5IT9 D;  2Z51 A;  4DV3 C;  3CQ3 A;  4GXQ A;  2QVX X;  2PN2 A;  5K85 A;  1HNZ C;  3A9U A;  2QL8 A;  4DV1 C;  5BSR A;  4ZJZ A;  3AY0 A;  2WP0 C;  1O93 A;  4BCA A;  3ETO A;  2ASB A;  2F4V C;  4KHP C;  3GPC A;  1FJG C;  4LF9 C;  3C5E A;  1N32 C;  2DHM A;  4WS9 A;  3RG2 A;  1USP A;  4JM1 A;  3K6R A;  4B3M C;  4JV5 C;  2MCQ A;  1XMO C;  1JOS A;  1N2F A;  4DR7 C;  2M5O A;  3LNV A;  4DR4 C;  4D4G A;  5BSW A;  2UXB C;  4DCV A;  1P4E A;  1NYE A;  4B3S C;  2ZZM A;  3GR0 A;  5T8T A;  1XNQ C;  3PES A;  3LAX A;  3LUS A;  3E7W A;  3TR3 A;  4RVO A; 
#chains in the Genus database with same CATH homology
 4PHT A;  4DR3 C;  2D1S A;  1XRA A;  4D57 A;  1IBM C;  4JI8 C;  3NPD A;  2OPL A;  4DV0 C;  4BBY A;  4HPV A;  2Y4N A;  1IBL C;  3N2Q A;  2E8F A;  4GKJ C;  2VSQ A;  4JI7 C;  4JI1 C;  1RG9 A;  3OTO C;  1BA3 A;  5ADZ A;  3B7W A;  4JI5 C;  1USP B;  4B3R C;  3R9W A;  2PT7 G;  1PA4 A;  4DV2 C;  5A2Q D;  2D1Q A;  2XR1 A;  1XMQ C;  1N34 C;  3J80 D;  4XX2 A;  4RLQ A;  4DCU A;  1L2F A;  4DV6 C;  4LE5 A;  3VNS A;  1FUG A;  2V7B A;  2VQF C;  3E7X A;  2PRO A;  4NXM C;  5A19 A;  5IWA C;  5KEI A;  3JAM D;  3CW9 A;  4MTN A;  4BC9 A;  2OO4 A;  4JI6 C;  1MXB A;  2Y27 A;  4L2Z A;  4NDN A;  5BUS A;  2UUB C;  2VZE A;  4X64 C;  2P2J A;  2HJG A;  2BH1 X;  5LMN C;  4FTF A;  3RV2 A;  4DUY C;  3G7S A;  1LCI A;  4I9G A;  5BSV A;  2E7G A;  4LF4 C;  2OPL B;  4DCT A;  1MDB A;  4AQY C;  5BR8 C;  1MXC A;  5IFI A;  2D1R A;  4U5Y D;  2YCB A;  2QW0 X;  2E0G A;  4RVN A;  3TQI A;  4JI2 C;  1O92 A;  2BJO A;  3NI2 A;  3PBK A;  4I9F A;  3R44 A;  1J5E C;  3A4I A;  3FCE A;  4JI4 C;  2E8C A;  2VQE C;  3R9X A;  1WF3 A;  3VNQ A;  5E7Q A;  3J81 D;  1GPM A;  4L7I A;  1I94 C;  1IBK C;  4RLF A;  1YJ7 A;  5BSM A;  1HH2 P;  3SO4 A;  2CXC A;  4DV7 C;  3T1H C;  5A1G A;  3DAY A;  4DR6 C;  5AE2 A;  3I08 A;  1EGA A;  2ZM6 C;  1MKY A;  4OXI A;  4IZ6 A;  1QM4 A;  1RY2 A;  1V25 A;  4KTT A;  2P2M A;  5FLX D;  3IML A;  3N54 B;  2E5L C;  4RM3 A;  1QWI A;  4PZP A;  2UXD C;  1ZB9 A;  4OYC A;  2JMP A;  2UUA C;  4B3T C;  3EQ6 A;  4RMN A;  5KYV A;  1T5D X;  4BC7 A;  1T5H X;  4DG9 A;  4GKK C;  4LFC C;  2P2Q A;  2HHH C;  5LMU C;  4GXR A;  2QVZ X;  2YWC A;  4JYA C;  4NOZ A;  5T8S A;  2DYJ A;  4DCS A;  4KTV A;  5AE3 A;  2P2B A;  3UZ0 A;  3KXW A;  3TDE A;  2ONF A;  2CY1 A;  4WV3 A;  5BUR A;  3DHV A;  4RM2 A;  5KYT A;  5BST A;  5DV9 A;  2P2F A;  1XRB A;  4LF6 C;  4DV4 C;  4DG8 A;  1N36 C;  2YWB A;  4G37 A;  1XNR C;  3S82 A;  5BSU A;  3LGX A;  4DR1 C;  2AYA A;  1LQL A;  1MXA A;  1HNX C;  3DLP X;  1AMU A;  3ETC A;  4G1I A;  2QVY X;  4MH4 A;  4K0K C;  4LF8 C;  1ZB8 A;  4FUQ A;  3CW8 X;  1ULT A;  4ZLP A;  4DR5 C;  4R1M A;  2E8E A;  2Y4O A;  3GKU A;  2EGT A;  3EER A;  4ODJ A;  1ML8 A;  3IEU A;  3NYR A;  4L4Q A;  2D27 A;  1O90 A;  3TUF A;  4LFA C;  3FCC A;  1XRC A;  3A9V A;  1P7L A;  5CZX A;  2P02 A;  4BSZ A;  4R0M A;  4DR2 C;  4DV5 C;  5JRH A;  4DUZ C;  1VLA A;  4X62 C;  4GS5 A;  1HR0 C;  4ISB A;  2P20 A;  4IR7 A;  4LF7 C;  4D56 A;  4LFB C;  2WD9 A;  2KZF A;  1PG4 A;  1HNW C;  4OX9 C;  5BUQ A;  1WH9 A;  3IEV A;  3AF6 A;  1MDF A;  5A1I A;  3I07 A;  3UOW A;  2D7V A;  5CZV A;  1PG3 A;  2UUC C;  4D4I A;  3GR1 A;  3T1Y C;  2UXC C;  1UKK A;  3PRO C;  1V26 A;  4X66 C;  1MD9 A;  1KKG A;  1K0R A;  3H2T A;  4G36 A;  4JI0 C;  5GTD A;  3L95 X;  4EAT A;  2D28 C;  4LF5 C;  2OBV A;  3IPL A;  2UU9 C;  1N33 C;  1O9T A;  2DPL A;  4TPS B;  4YHH C;  4K0B A;  2D1T A;  3NYQ A;  4YY3 C;  5K8F A;  4FUT A;  3VNR A;  3L8C A;  4NXN C;  4X65 C;  3AF5 A;  4R1L A;  4PRO C;  2ATW A;  4JI3 C;  5AE1 A;  5H9U A;  5IT9 D;  4DV3 C;  4GXQ A;  2QVX X;  2PN2 A;  5K85 A;  1HNZ C;  3A9U A;  2QL8 A;  4DV1 C;  5BSR A;  4ZJZ A;  2WP0 C;  1O93 A;  4BCA A;  3ETO A;  2ASB A;  2F4V C;  4KHP C;  3GPC A;  1FJG C;  4LF9 C;  3C5E A;  1N32 C;  4WS9 A;  3RG2 A;  1USP A;  4JM1 A;  4B3M C;  4JV5 C;  1XMO C;  1JOS A;  1N2F A;  4DR7 C;  3LNV A;  4DR4 C;  4D4G A;  5BSW A;  2UXB C;  4DCV A;  1NYE A;  4B3S C;  3GR0 A;  5T8T A;  1XNQ C;  3PES A;  3LAX A;  3LUS A;  3E7W A;  3CJE A;  4RVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...