4JM1A

Crystal structure of a protein with alpha-lytic protease prodomain-like fold (bdi_0842) from parabacteroides distasonis atcc 8503 at 1.40 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
GADKYIDTITGFSCEKAAVTDNGFLVIAIDADSDSGYDMLASQFLEEAKKEGVSGLKGVLIVDIKNAKFEQGAVVGKRIGKAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BDI_0842) from Parabacteroides distasonis ATCC 8503 at 1.40 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.300 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jm1A00
4JM1A
chains in the Genus database with same CATH superfamily
3O2EA 1PG3A 4WS9A 2UUAC 3VNRA 2P2FA 5BR8C 5BSVA 3CQ2A 4G37A 4OYCA 4RVOA 4JI5C 4LE5A 3R9XA 4YY3C 5AE1A 2D28C 4PUIA 5T8SA 1TH5A 4JI0C 4HPVA 4NXNC 5KYTA 1KKGA 4U5YD 2CU6A 5GTDA 4DUYC 3UZ0A 4R1MA 2PROA 1GPMA 2KDNA 4TPSB 1K0RA 1JOSA 3LUSA 2YWCA 5A1GA 2CY1A 1N32C 3A25A 1HR0C 4D4IA 4G1IA 5BSWA 3NYQA 3LAXA 2D1TA 1VEHA 3VNQA 2JMPA 4X66C 1MDBA 1VLAA 2P20A 4ISBA 4EATA 2YWBA 2ZZNA 2VSQA 5IFIA 2D7VA 1MD9A 1LQLA 4L4QA 1ZB8A 2MCQA 4BC9A 2UUBC 4LF9C 4LF8C 4GKJC 3N2QA 3I07A 2ONFA 3EERA 3GR1A 3T1YC 1I94C 4LF4C 5BURA 4JI6C 4MTNA 4RMNA 4KTTA 3K6RA 4KHPC 1XMOC 2UXCC 1PG4A 3A9VA 4OX9C 2OPLB 2UUCC 2MM9A 4DUZC 4KTVA 1MXAA 3CW8X 1P7LA 2Y4OA 2QVXX 4RLQA 2VZEA 3AF5A 4LFBC 1XS3A 4DR5C 2ASBA 1O9TA 2AYAA 4G36A 3A4IA 2XR1A 3S82A 1N2FA 4DG8A 4B3TC 2UU9C 1FUGA 5AE3A 3IMLA 4DR4C 4JYAC 4RLFA 4LF7C 5FLXD 2Y27A 2D1RA 3R44A 1L2FA 1M6XA 4JI1C 5A1IA 4DV2C 4K0KC 4R1LA 5IT9D 1V26A 2VQFC 3A26A 4OXIA 5LMNC 2Z51A 2UXBC 4ZJZA 1XMQC 2E7GA 2E8FA 3TUFA 3TR3A 3E7WA 4FUQA 4X65C 3ETOA 1PU1A 1MDFA 1UWDA 2YCBA 4PUGA 4RVNA 3JAMD 4PHTA 4PZPA 3TDEA 4DR2C 3UEBA 2ATWA 3RG2A 1NY8A 1P4EA 3TQIA 4NDNA 3IPLA 1O93A 3UOWA 4B3RC 4LF6C 4LFCC 4DG9A 4LF5C 3L8CA 4GS5A 1XHJA 5BSMA 1ULTA 2Y4NA 1O92A 3RV2A 4DV4C 2OPLA 2P2QA 2P2MA 4AQYC 1ML8A 2HJGA 4JI3C 4D4GA 2V7BA 3ETCA 5BUQA 5LMUC 5H9UA 1AMUA 3IEVA 2YX1A 2QW0X 4JI7C 2D27A 1XNRC 4B3SC 1RY2A 2EGTA 5IWAC 2UXDC 3LNOA 1M6XC 4BC7A 5E7QA 3UX2A 3J80D 2WP0C 3E7XA 2ZZMA 2P2BA 2ZM6C 1XRBA 3R9WA 5T8TA 3CQ1A 2KZ0A 2VQEC 1HNWC 4B3MC 4DV7C 3SO4A 2KZFA 2P2JA 4ZLPA 4DCVA 4K0BA 3GPCA 4LFAC 2OBVA 4DV0C 2E5LC 5DV9A 2DPLA 2D1QA 2OO4A 2QL8A 4DCSA 3UX3A 4DV1C 4L7IA 4NXMC 1USPB 1V60A 1XRAA 1XNQC 1WCJA 5K85A 2E8CA 4IZ6A 1WH9A 3FCCA 3T1HC 2P02A 4DR7C 4GKKC 1IB8A 3H2TA 3L95X 4DR3C 1P4EC 1BA3A 1N34C 1N36C 2DYJA 2M5OA 5CZVA 3NPDA 4X64C 1QWIA 4FTFA 2HHHC 1T5DX 3DHVA 4JI4C 2CXCA 4JI8C 2WD9A 3AY0A 4D57A 1MKYA 4L2ZA 4BCAA 1HNZC 4WV3A 3PESA 2M5HA 3LNVA 2QVYX 1HH2P 3B7WA 3J81D 1FJGC 4DV5C 3PROC 2BJOA 5BUSA 2D1SA 4DV6C 4X62C 3C5EA 1WF3A 3KXWA 5ADZA 2DHMA 2BH1X 4I9FA 5KYVA 5CZXA 3NYRA 3EQ6A 2E0GA 1PA4A 4JM1A 1N33C 3GKUA 4IR7A 1MXBA 4RM3A 4BSZA 5KEIA 4DCTA 1O90A 4I9GA 4YHHC 3DAYA 4ODJA 1XRCA 5JRHA 4PUHA 4NOZA 3CW9A 2JNVA 1MXCA 4R0MA 1J5EC 2MMAB 3GR0A 4GXRA 2QVZX 4MH4A 4DCUA 3VNSA 4BBYA 5AE2A 4D56A 5BSRA 1RG9A 2NCLA 3OTOC 3FCEA 5A19A 1USPA 4DR6C 3I08A 1QM4A 4PROC 1LCIA 3AF6A 1V25A 1T5HX 2PT7G 3PBKA 3G7SA 4DV3C 1NYEA 4XX2A 1IBMC 4JI2C 3N54B 4JV5C 2F4VC 1EGAA 5BSUA 1HNXC 4DR1C 4FUTA 5A2QD 1IBLC 1ZB9A 2PN2A 5BSTA 3DLPX 3IEUA 3NI2A 2E8EA 5LCIA 1IBKC 4GXQA 5K8FA 3A9UA 1UKKA 1FLOA 3CQ3A 3LGXA 1YJ7A 3CJEA 4RM2A
chains in the Genus database with same CATH topology
1PG3A 4WS9A 2UUAC 3VNRA 2P2FA 5BR8C 5BSVA 4G37A 4OYCA 4RVOA 4JI5C 4LE5A 3R9XA 4YY3C 5AE1A 2D28C 5T8SA 4JI0C 4HPVA 4NXNC 5KYTA 1KKGA 4U5YD 5GTDA 4DUYC 3UZ0A 4R1MA 2PROA 1GPMA 4TPSB 1K0RA 1JOSA 3LUSA 2YWCA 5A1GA 2CY1A 1N32C 1HR0C 4D4IA 4G1IA 5BSWA 3NYQA 3LAXA 2D1TA 3VNQA 2JMPA 4X66C 1MDBA 1VLAA 2P20A 4ISBA 4EATA 2YWBA 2VSQA 5IFIA 2D7VA 1MD9A 1LQLA 4L4QA 1ZB8A 4BC9A 2UUBC 4LF9C 4LF8C 4GKJC 3N2QA 3I07A 2ONFA 3EERA 3GR1A 3T1YC 1I94C 4LF4C 5BURA 4JI6C 4MTNA 4RMNA 4KTTA 4KHPC 1XMOC 2UXCC 1PG4A 3A9VA 4OX9C 2OPLB 2UUCC 4DUZC 4KTVA 1MXAA 3CW8X 1P7LA 2Y4OA 2QVXX 4RLQA 2VZEA 3AF5A 4LFBC 4DR5C 2ASBA 1O9TA 2AYAA 4G36A 3A4IA 2XR1A 3S82A 1N2FA 4DG8A 4B3TC 2UU9C 1FUGA 5AE3A 3IMLA 4DR4C 4JYAC 4RLFA 4LF7C 5FLXD 2Y27A 2D1RA 3R44A 1L2FA 4JI1C 5A1IA 4DV2C 4K0KC 4R1LA 5IT9D 1V26A 2VQFC 4OXIA 5LMNC 2UXBC 4ZJZA 1XMQC 2E7GA 2E8FA 3TUFA 3E7WA 4FUQA 4X65C 3ETOA 1MDFA 2YCBA 4RVNA 3JAMD 4PHTA 4PZPA 3TDEA 4DR2C 2ATWA 3RG2A 3TQIA 4NDNA 3IPLA 1O93A 3UOWA 4B3RC 4LF6C 4LFCC 4DG9A 4LF5C 3L8CA 4GS5A 5BSMA 1ULTA 2Y4NA 1O92A 3RV2A 4DV4C 2OPLA 2P2QA 2P2MA 4AQYC 1ML8A 2HJGA 4JI3C 4D4GA 2V7BA 3ETCA 5BUQA 5LMUC 5H9UA 1AMUA 3IEVA 4JI7C 2QW0X 1XNRC 2D27A 4B3SC 1RY2A 2EGTA 5IWAC 2UXDC 4BC7A 5E7QA 3J80D 2WP0C 3E7XA 2P2BA 2ZM6C 1XRBA 3R9WA 5T8TA 2VQEC 1HNWC 4B3MC 4DV7C 3SO4A 2KZFA 2P2JA 4ZLPA 4DCVA 4K0BA 3GPCA 4LFAC 2OBVA 4DV0C 2E5LC 5DV9A 2D1QA 2DPLA 2OO4A 2QL8A 4DCSA 4DV1C 4L7IA 4NXMC 1USPB 1XRAA 1XNQC 5K85A 2E8CA 4IZ6A 1WH9A 3FCCA 3T1HC 2P02A 4DR7C 4GKKC 3H2TA 3L95X 4DR3C 1BA3A 1N34C 1N36C 2DYJA 5CZVA 3NPDA 4X64C 1QWIA 4FTFA 2HHHC 1T5DX 3DHVA 4JI4C 2CXCA 4JI8C 2WD9A 4D57A 1MKYA 4L2ZA 4BCAA 1HNZC 4WV3A 3PESA 3LNVA 2QVYX 1HH2P 3B7WA 3J81D 1FJGC 4DV5C 3PROC 2BJOA 5BUSA 2D1SA 4DV6C 4X62C 3C5EA 1WF3A 3KXWA 5ADZA 2BH1X 4I9FA 5KYVA 5CZXA 3NYRA 3EQ6A 2E0GA 1PA4A 4JM1A 1N33C 3GKUA 4IR7A 1MXBA 4RM3A 4BSZA 5KEIA 4DCTA 1O90A 4I9GA 4YHHC 3DAYA 4ODJA 1XRCA 5JRHA 4NOZA 3CW9A 1MXCA 4R0MA 1J5EC 3GR0A 4GXRA 2QVZX 4MH4A 4DCUA 3VNSA 4BBYA 5AE2A 4D56A 5BSRA 1RG9A 3OTOC 3FCEA 5A19A 1USPA 4DR6C 3I08A 1QM4A 4PROC 1LCIA 3AF6A 1V25A 1T5HX 2PT7G 3PBKA 3G7SA 4DV3C 1NYEA 4XX2A 1IBMC 4JI2C 3N54B 4JV5C 2F4VC 1EGAA 5BSUA 1HNXC 4DR1C 4FUTA 5A2QD 1IBLC 1ZB9A 2PN2A 5BSTA 3DLPX 3IEUA 3NI2A 2E8EA 1IBKC 4GXQA 5K8FA 3A9UA 1UKKA 3LGXA 1YJ7A 3CJEA 4RM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JM1 A; 
#chains in the Genus database with same CATH topology
 3O2E A;  1PG3 A;  4WS9 A;  2UUA C;  3VNR A;  2P2F A;  5BR8 C;  5BSV A;  3CQ2 A;  4G37 A;  4OYC A;  4RVO A;  4JI5 C;  4LE5 A;  3R9X A;  4YY3 C;  5AE1 A;  2D28 C;  4PUI A;  5T8S A;  1TH5 A;  4JI0 C;  4HPV A;  4NXN C;  5KYT A;  1KKG A;  4U5Y D;  2CU6 A;  5GTD A;  4DUY C;  3UZ0 A;  4R1M A;  2PRO A;  1GPM A;  2KDN A;  4TPS B;  1K0R A;  1JOS A;  3LUS A;  2YWC A;  5A1G A;  2CY1 A;  1N32 C;  3A25 A;  1HR0 C;  4D4I A;  4G1I A;  5BSW A;  3NYQ A;  3LAX A;  2D1T A;  1VEH A;  3VNQ A;  2JMP A;  4X66 C;  1MDB A;  1VLA A;  2P20 A;  4ISB A;  4EAT A;  2YWB A;  2ZZN A;  2VSQ A;  5IFI A;  2D7V A;  1MD9 A;  1LQL A;  4L4Q A;  1ZB8 A;  2MCQ A;  4BC9 A;  2UUB C;  4LF9 C;  4LF8 C;  4GKJ C;  3N2Q A;  3I07 A;  2ONF A;  3EER A;  3GR1 A;  3T1Y C;  1I94 C;  4LF4 C;  5BUR A;  4JI6 C;  4MTN A;  4RMN A;  4KTT A;  3K6R A;  4KHP C;  1XMO C;  2UXC C;  1PG4 A;  3A9V A;  4OX9 C;  2OPL B;  2UUC C;  2MM9 A;  4DUZ C;  4KTV A;  1MXA A;  3CW8 X;  1P7L A;  2Y4O A;  2QVX X;  4RLQ A;  2VZE A;  3AF5 A;  4LFB C;  1XS3 A;  4DR5 C;  2ASB A;  1O9T A;  2AYA A;  4G36 A;  3A4I A;  2XR1 A;  3S82 A;  1N2F A;  4DG8 A;  4B3T C;  2UU9 C;  1FUG A;  5AE3 A;  3IML A;  4DR4 C;  4JYA C;  4RLF A;  4LF7 C;  5FLX D;  2Y27 A;  2D1R A;  3R44 A;  1L2F A;  1M6X A;  4JI1 C;  5A1I A;  4DV2 C;  4K0K C;  4R1L A;  5IT9 D;  1V26 A;  2VQF C;  3A26 A;  4OXI A;  5LMN C;  2Z51 A;  2UXB C;  4ZJZ A;  1XMQ C;  2E7G A;  2E8F A;  3TUF A;  3TR3 A;  3E7W A;  4FUQ A;  4X65 C;  3ETO A;  1PU1 A;  1MDF A;  1UWD A;  2YCB A;  4PUG A;  4RVN A;  3JAM D;  4PHT A;  4PZP A;  3TDE A;  4DR2 C;  3UEB A;  2ATW A;  3RG2 A;  1NY8 A;  1P4E A;  3TQI A;  4NDN A;  3IPL A;  1O93 A;  3UOW A;  4B3R C;  4LF6 C;  4LFC C;  4DG9 A;  4LF5 C;  3L8C A;  4GS5 A;  1XHJ A;  5BSM A;  1ULT A;  2Y4N A;  1O92 A;  3RV2 A;  4DV4 C;  2OPL A;  2P2Q A;  2P2M A;  4AQY C;  1ML8 A;  2HJG A;  4JI3 C;  4D4G A;  2V7B A;  3ETC A;  5BUQ A;  5LMU C;  5H9U A;  1AMU A;  3IEV A;  2YX1 A;  2QW0 X;  4JI7 C;  2D27 A;  1XNR C;  4B3S C;  1RY2 A;  2EGT A;  5IWA C;  2UXD C;  3LNO A;  1M6X C;  4BC7 A;  5E7Q A;  3UX2 A;  3J80 D;  2WP0 C;  3E7X A;  2ZZM A;  2P2B A;  2ZM6 C;  1XRB A;  3R9W A;  5T8T A;  3CQ1 A;  2KZ0 A;  2VQE C;  1HNW C;  4B3M C;  4DV7 C;  3SO4 A;  2KZF A;  2P2J A;  4ZLP A;  4DCV A;  4K0B A;  3GPC A;  4LFA C;  2OBV A;  4DV0 C;  2E5L C;  5DV9 A;  2DPL A;  2D1Q A;  2OO4 A;  2QL8 A;  4DCS A;  3UX3 A;  4DV1 C;  4L7I A;  4NXM C;  1USP B;  1V60 A;  1XRA A;  1XNQ C;  1WCJ A;  5K85 A;  2E8C A;  4IZ6 A;  1WH9 A;  3FCC A;  3T1H C;  2P02 A;  4DR7 C;  4GKK C;  1IB8 A;  3H2T A;  3L95 X;  4DR3 C;  1P4E C;  1BA3 A;  1N34 C;  1N36 C;  2DYJ A;  2M5O A;  5CZV A;  3NPD A;  4X64 C;  1QWI A;  4FTF A;  2HHH C;  1T5D X;  3DHV A;  4JI4 C;  2CXC A;  4JI8 C;  2WD9 A;  3AY0 A;  4D57 A;  1MKY A;  4L2Z A;  4BCA A;  1HNZ C;  4WV3 A;  3PES A;  2M5H A;  3LNV A;  2QVY X;  1HH2 P;  3B7W A;  3J81 D;  1FJG C;  4DV5 C;  3PRO C;  2BJO A;  5BUS A;  2D1S A;  4DV6 C;  4X62 C;  3C5E A;  1WF3 A;  3KXW A;  5ADZ A;  2DHM A;  2BH1 X;  4I9F A;  5KYV A;  5CZX A;  3NYR A;  3EQ6 A;  2E0G A;  1PA4 A;  4JM1 A;  1N33 C;  3GKU A;  4IR7 A;  1MXB A;  4RM3 A;  4BSZ A;  5KEI A;  4DCT A;  1O90 A;  4I9G A;  4YHH C;  3DAY A;  4ODJ A;  1XRC A;  5JRH A;  4PUH A;  4NOZ A;  3CW9 A;  2JNV A;  1MXC A;  4R0M A;  1J5E C;  2MMA B;  3GR0 A;  4GXR A;  2QVZ X;  4MH4 A;  4DCU A;  3VNS A;  4BBY A;  5AE2 A;  4D56 A;  5BSR A;  1RG9 A;  2NCL A;  3OTO C;  3FCE A;  5A19 A;  1USP A;  4DR6 C;  3I08 A;  1QM4 A;  4PRO C;  1LCI A;  3AF6 A;  1V25 A;  1T5H X;  2PT7 G;  3PBK A;  3G7S A;  4DV3 C;  1NYE A;  4XX2 A;  1IBM C;  4JI2 C;  3N54 B;  4JV5 C;  2F4V C;  1EGA A;  5BSU A;  1HNX C;  4DR1 C;  4FUT A;  5A2Q D;  1IBL C;  1ZB9 A;  2PN2 A;  5BST A;  3DLP X;  3IEU A;  3NI2 A;  2E8E A;  5LCI A;  1IBK C;  4GXQ A;  5K8F A;  3A9U A;  1UKK A;  1FLO A;  3CQ3 A;  3LGX A;  1YJ7 A;  3CJE A;  4RM2 A; 
#chains in the Genus database with same CATH homology
 1PG3 A;  4WS9 A;  2UUA C;  3VNR A;  2P2F A;  5BR8 C;  5BSV A;  4G37 A;  4OYC A;  4RVO A;  4JI5 C;  4LE5 A;  3R9X A;  4YY3 C;  5AE1 A;  2D28 C;  5T8S A;  4JI0 C;  4HPV A;  4NXN C;  5KYT A;  1KKG A;  4U5Y D;  5GTD A;  4DUY C;  3UZ0 A;  4R1M A;  2PRO A;  1GPM A;  4TPS B;  1K0R A;  1JOS A;  3LUS A;  2YWC A;  5A1G A;  2CY1 A;  1N32 C;  1HR0 C;  4D4I A;  4G1I A;  5BSW A;  3NYQ A;  3LAX A;  2D1T A;  3VNQ A;  2JMP A;  4X66 C;  1MDB A;  1VLA A;  2P20 A;  4ISB A;  4EAT A;  2YWB A;  2VSQ A;  5IFI A;  2D7V A;  1MD9 A;  1LQL A;  4L4Q A;  1ZB8 A;  4BC9 A;  2UUB C;  4LF9 C;  4LF8 C;  4GKJ C;  3N2Q A;  3I07 A;  2ONF A;  3EER A;  3GR1 A;  3T1Y C;  1I94 C;  4LF4 C;  5BUR A;  4JI6 C;  4MTN A;  4RMN A;  4KTT A;  4KHP C;  1XMO C;  2UXC C;  1PG4 A;  3A9V A;  4OX9 C;  2OPL B;  2UUC C;  4DUZ C;  4KTV A;  1MXA A;  3CW8 X;  1P7L A;  2Y4O A;  2QVX X;  4RLQ A;  2VZE A;  3AF5 A;  4LFB C;  4DR5 C;  2ASB A;  1O9T A;  2AYA A;  4G36 A;  3A4I A;  2XR1 A;  3S82 A;  1N2F A;  4DG8 A;  4B3T C;  2UU9 C;  1FUG A;  5AE3 A;  3IML A;  4DR4 C;  4JYA C;  4RLF A;  4LF7 C;  5FLX D;  2Y27 A;  2D1R A;  3R44 A;  1L2F A;  4JI1 C;  5A1I A;  4DV2 C;  4K0K C;  4R1L A;  5IT9 D;  1V26 A;  2VQF C;  4OXI A;  5LMN C;  2UXB C;  4ZJZ A;  1XMQ C;  2E7G A;  2E8F A;  3TUF A;  3E7W A;  4FUQ A;  4X65 C;  3ETO A;  1MDF A;  2YCB A;  4RVN A;  3JAM D;  4PHT A;  4PZP A;  3TDE A;  4DR2 C;  2ATW A;  3RG2 A;  3TQI A;  4NDN A;  3IPL A;  1O93 A;  3UOW A;  4B3R C;  4LF6 C;  4LFC C;  4DG9 A;  4LF5 C;  3L8C A;  4GS5 A;  5BSM A;  1ULT A;  2Y4N A;  1O92 A;  3RV2 A;  4DV4 C;  2OPL A;  2P2Q A;  2P2M A;  4AQY C;  1ML8 A;  2HJG A;  4JI3 C;  4D4G A;  2V7B A;  3ETC A;  5BUQ A;  5LMU C;  5H9U A;  1AMU A;  3IEV A;  4JI7 C;  2QW0 X;  1XNR C;  2D27 A;  4B3S C;  1RY2 A;  2EGT A;  5IWA C;  2UXD C;  4BC7 A;  5E7Q A;  3J80 D;  2WP0 C;  3E7X A;  2P2B A;  2ZM6 C;  1XRB A;  3R9W A;  5T8T A;  2VQE C;  1HNW C;  4B3M C;  4DV7 C;  3SO4 A;  2KZF A;  2P2J A;  4ZLP A;  4DCV A;  4K0B A;  3GPC A;  4LFA C;  2OBV A;  4DV0 C;  2E5L C;  5DV9 A;  2D1Q A;  2DPL A;  2OO4 A;  2QL8 A;  4DCS A;  4DV1 C;  4L7I A;  4NXM C;  1USP B;  1XRA A;  1XNQ C;  5K85 A;  2E8C A;  4IZ6 A;  1WH9 A;  3FCC A;  3T1H C;  2P02 A;  4DR7 C;  4GKK C;  3H2T A;  3L95 X;  4DR3 C;  1BA3 A;  1N34 C;  1N36 C;  2DYJ A;  5CZV A;  3NPD A;  4X64 C;  1QWI A;  4FTF A;  2HHH C;  1T5D X;  3DHV A;  4JI4 C;  2CXC A;  4JI8 C;  2WD9 A;  4D57 A;  1MKY A;  4L2Z A;  4BCA A;  1HNZ C;  4WV3 A;  3PES A;  3LNV A;  2QVY X;  1HH2 P;  3B7W A;  3J81 D;  1FJG C;  4DV5 C;  3PRO C;  2BJO A;  5BUS A;  2D1S A;  4DV6 C;  4X62 C;  3C5E A;  1WF3 A;  3KXW A;  5ADZ A;  2BH1 X;  4I9F A;  5KYV A;  5CZX A;  3NYR A;  3EQ6 A;  2E0G A;  1PA4 A;  4JM1 A;  1N33 C;  3GKU A;  4IR7 A;  1MXB A;  4RM3 A;  4BSZ A;  5KEI A;  4DCT A;  1O90 A;  4I9G A;  4YHH C;  3DAY A;  4ODJ A;  1XRC A;  5JRH A;  4NOZ A;  3CW9 A;  1MXC A;  4R0M A;  1J5E C;  3GR0 A;  4GXR A;  2QVZ X;  4MH4 A;  4DCU A;  3VNS A;  4BBY A;  5AE2 A;  4D56 A;  5BSR A;  1RG9 A;  3OTO C;  3FCE A;  5A19 A;  1USP A;  4DR6 C;  3I08 A;  1QM4 A;  4PRO C;  1LCI A;  3AF6 A;  1V25 A;  1T5H X;  2PT7 G;  3PBK A;  3G7S A;  4DV3 C;  1NYE A;  4XX2 A;  1IBM C;  4JI2 C;  3N54 B;  4JV5 C;  2F4V C;  1EGA A;  5BSU A;  1HNX C;  4DR1 C;  4FUT A;  5A2Q D;  1IBL C;  1ZB9 A;  2PN2 A;  5BST A;  3DLP X;  3IEU A;  3NI2 A;  2E8E A;  1IBK C;  4GXQ A;  5K8F A;  3A9U A;  1UKK A;  3LGX A;  1YJ7 A;  3CJE A;  4RM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...