4JM1A

Crystal structure of a protein with alpha-lytic protease prodomain-like fold (bdi_0842) from parabacteroides distasonis atcc 8503 at 1.40 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
GADKYIDTITGFSCEKAAVTDNGFLVIAIDADSDSGYDMLASQFLEEAKKEGVSGLKGVLIVDIKNAKFEQGAVVGKRIGKAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal structure of a hypothetical protein (BDI_0842) from Parabacteroides distasonis ATCC 8503 at 1.40 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.300 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jm1A00
4JM1A
chains in the Genus database with same CATH superfamily
4X64C 4GKKC 2AYAA 4G36A 2P20A 2E7GA 2DHMA 1BA3A 3K6RA 1IBKC 1N33C 2UUBC 3TQIA 4LF7C 2QVZX 3CW8X 4I9FA 2D27A 3IEUA 4RM3A 4JI3C 4DCUA 4JV5C 3IMLA 5CZXA 2V7BA 4EATA 5BSTA 1UKKA 4OYCA 5BSRA 4D56A 4FUTA 4AQYC 3AF5A 5IT9D 5BUSA 2HJGA 4D57A 1PU1A 4LF5C 3TDEA 2UXCC 2WP0C 2MMAB 2Y4NA 4JI1C 4GKJC 1NY8A 1N36C 3L8CA 1WCJA 4R0MA 4MTNA 5KEIA 3UEBA 1T5DX 2OPLA 5K8FA 4DR7C 5AE2A 1VEHA 4PUGA 2DPLA 3N54B 2D28C 1XHJA 4RLFA 4B3SC 1O90A 4DCVA 5A1GA 4RM2A 3KXWA 4KTVA 5LMNC 3OTOC 4BBYA 4PHTA 2KDNA 3CQ1A 4D4GA 4FTFA 2E0GA 5GTDA 3A4IA 1L2FA 1O92A 2KZ0A 4DV3C 4BCAA 5T8SA 5ADZA 4RLQA 3UX3A 1GPMA 2UUAC 4JI5C 3UX2A 1EGAA 1N32C 5LMUC 2P2BA 3R44A 2Z51A 4LF6C 4DR3C 2EGTA 3S82A 2F4VC 3NYRA 5BUQA 3CW9A 4DV2C 2E8CA 1M6XA 3H2TA 1XS3A 3NPDA 4B3TC 4BSZA 3C5EA 3EQ6A 2UU9C 4KTTA 4JM1A 4NDNA 4LE5A 3IEVA 2P2QA 2JMPA 4GXRA 3LNOA 4DV7C 4B3RC 3FCCA 1XMOC 3A9UA 4LFCC 4L2ZA 1I94C 5KYTA 5DV9A 4LF9C 2E8FA 3NYQA 3I08A 4PZPA 1NYEA 4NXNC 5JRHA 1XRBA 2NCLA 3VNRA 1IBLC 2CXCA 1FUGA 1XNQC 3AF6A 4LFAC 2VZEA 1HNXC 2UXDC 1XRCA 2WD9A 4DR2C 4DR4C 1FLOA 3B7WA 3LNVA 4DG9A 4PUHA 1P4EA 2PROA 4YHHC 1RY2A 2QVYX 4WS9A 4DR5C 1XMQC 2CU6A 5AE3A 3PROC 1ZB9A 4OX9C 4HPVA 4X62C 2VQFC 4TPSB 4ZLPA 2D1TA 4JI8C 1HR0C 4BC9A 1MKYA 1USPB 3LAXA 3LGXA 5BR8C 4IZ6A 3I07A 4DR1C 1KKGA 4R1LA 5BSUA 4GXQA 4GS5A 3VNSA 1QWIA 3FCEA 1O9TA 2YWBA 5IWAC 4I9GA 4FUQA 5BSWA 4L4QA 3TUFA 3A9VA 4JI6C 2YWCA 3E7WA 4PUIA 5BSVA 4LFBC 4DR6C 4RMNA 3R9WA 3O2EA 2HHHC 3SO4A 3NI2A 2M5HA 1LQLA 2Y27A 2ASBA 2ATWA 2OBVA 4X66C 2OO4A 2E8EA 2XR1A 4PROC 1ZB8A 2ZZNA 1M6XC 2DYJA 1HH2P 1O93A 2P2MA 2YX1A 4DV5C 1JOSA 4RVNA 1VLAA 2QVXX 3RV2A 3A25A 3DLPX 2P02A 3CJEA 1RG9A 1V60A 4DV4C 1J5EC 2PT7G 3T1HC 3LUSA 5A1IA 4KHPC 3GKUA 4DUZC 3UZ0A 2MM9A 4JI7C 2VSQA 5IFIA 4K0KC 3AY0A 2UXBC 1AMUA 4DV6C 3JAMD 4XX2A 4NOZA 4D4IA 3EERA 1TH5A 4BC7A 4ISBA 1FJGC 1PG4A 5K85A 2PN2A 4U5YD 4R1MA 1HNWC 2D1QA 1P4EC 5CZVA 5AE1A 3GR1A 2D7VA 3CQ2A 1V25A 4DCSA 2D1SA 2ONFA 5T8TA 2JNVA 1ULTA 5E7QA 1QM4A 3PESA 3IPLA 2KZFA 4L7IA 4JI0C 5A19A 1N2FA 2BH1X 1WF3A 2MCQA 4MH4A 2OPLB 2CY1A 4JI4C 4DV1C 1HNZC 1YJ7A 1XNRC 1MXBA 2ZZMA 1USPA 3ETCA 3TR3A 3PBKA 4LF8C 2QL8A 1IB8A 1XRAA 1MXCA 4DG8A 3J80D 3VNQA 1WH9A 3N2QA 2ZM6C 1MXAA 4IR7A 4JI2C 5LCIA 3DAYA 3A26A 5BSMA 4X65C 4DUYC 4B3MC 2QW0X 1N34C 3UOWA 2D1RA 2E5LC 3CQ3A 1MD9A 4LF4C 1UWDA 4RVOA 4WV3A 4K0BA 5BURA 2M5OA 3GR0A 2UUCC 3E7XA 5KYVA 4ODJA 3J81D 4YY3C 3T1YC 1IBMC 3R9XA 4G37A 4NXMC 2YCBA 1K0RA 5A2QD 4OXIA 4JYAC 1PA4A 5FLXD 2VQEC 4DCTA 1MDFA 4G1IA 5H9UA 4DV0C 3ETOA 1MDBA 3GPCA 1LCIA 2BJOA 3DHVA 1ML8A 2P2FA 2P2JA 1P7LA 4ZJZA 1PG3A 2Y4OA 3L95X 3G7SA 3RG2A 1T5HX 1V26A
chains in the Genus database with same CATH topology
4X64C 4GKKC 2AYAA 4G36A 2P20A 2E7GA 1BA3A 1IBKC 1N33C 2UUBC 3TQIA 4LF7C 2QVZX 3CW8X 4I9FA 2D27A 3IEUA 4RM3A 4JI3C 4DCUA 4JV5C 3IMLA 5CZXA 2V7BA 4EATA 5BSTA 1UKKA 4OYCA 5BSRA 4D56A 4FUTA 4AQYC 3AF5A 5IT9D 5BUSA 2HJGA 4D57A 4LF5C 3TDEA 2UXCC 2WP0C 2Y4NA 4JI1C 4GKJC 1N36C 3L8CA 4R0MA 4MTNA 5KEIA 1T5DX 2OPLA 5K8FA 4DR7C 5AE2A 2DPLA 3N54B 2D28C 4B3SC 4RLFA 1O90A 4DCVA 5A1GA 4RM2A 3KXWA 4KTVA 5LMNC 3OTOC 4BBYA 4PHTA 4D4GA 4FTFA 2E0GA 5GTDA 3A4IA 1L2FA 1O92A 4DV3C 4BCAA 5T8SA 5ADZA 4RLQA 1GPMA 2UUAC 4JI5C 1EGAA 1N32C 5LMUC 2P2BA 3R44A 4LF6C 4DR3C 2EGTA 3S82A 2F4VC 3NYRA 5BUQA 3CW9A 4DV2C 2E8CA 3H2TA 3NPDA 4B3TC 4BSZA 3C5EA 3EQ6A 2UU9C 4KTTA 4JM1A 4NDNA 4LE5A 3IEVA 2P2QA 2JMPA 4GXRA 4DV7C 4B3RC 3FCCA 1XMOC 3A9UA 4LFCC 4L2ZA 1I94C 5KYTA 5DV9A 4LF9C 2E8FA 3NYQA 3I08A 4PZPA 1NYEA 4NXNC 5JRHA 1XRBA 3VNRA 1IBLC 2CXCA 1FUGA 1XNQC 3AF6A 4LFAC 2VZEA 1HNXC 2UXDC 1XRCA 2WD9A 4DR2C 4DR4C 3B7WA 3LNVA 4DG9A 2PROA 4YHHC 1RY2A 2QVYX 4WS9A 4DR5C 1XMQC 5AE3A 3PROC 1ZB9A 4OX9C 4HPVA 4X62C 2VQFC 4TPSB 4ZLPA 2D1TA 4JI8C 1HR0C 4BC9A 1MKYA 1USPB 3LAXA 3LGXA 5BR8C 4IZ6A 3I07A 4DR1C 1KKGA 4R1LA 5BSUA 4GXQA 4GS5A 3VNSA 1QWIA 3FCEA 1O9TA 2YWBA 5IWAC 4I9GA 4FUQA 5BSWA 4L4QA 3TUFA 3A9VA 4JI6C 2YWCA 3E7WA 5BSVA 4LFBC 4DR6C 4RMNA 3R9WA 2HHHC 3SO4A 3NI2A 1LQLA 2Y27A 2ASBA 2ATWA 2OBVA 4X66C 2OO4A 2E8EA 2XR1A 4PROC 1ZB8A 2DYJA 1HH2P 1O93A 2P2MA 4DV5C 1JOSA 4RVNA 1VLAA 2QVXX 3RV2A 3DLPX 2P02A 3CJEA 1RG9A 4DV4C 1J5EC 2PT7G 3T1HC 3LUSA 5A1IA 4KHPC 3GKUA 4DUZC 3UZ0A 4JI7C 2VSQA 5IFIA 4K0KC 2UXBC 1AMUA 4DV6C 3JAMD 4XX2A 4NOZA 4D4IA 3EERA 4BC7A 4ISBA 1FJGC 1PG4A 5K85A 2PN2A 4U5YD 4R1MA 1HNWC 2D1QA 5CZVA 5AE1A 3GR1A 2D7VA 1V25A 4DCSA 2D1SA 2ONFA 5T8TA 1ULTA 5E7QA 1QM4A 3PESA 3IPLA 2KZFA 4L7IA 4JI0C 5A19A 1N2FA 2BH1X 1WF3A 4MH4A 2OPLB 2CY1A 4JI4C 4DV1C 1HNZC 1YJ7A 1XNRC 1MXBA 1USPA 3ETCA 3PBKA 4LF8C 2QL8A 1XRAA 1MXCA 4DG8A 3J80D 3VNQA 1WH9A 3N2QA 2ZM6C 1MXAA 4IR7A 4JI2C 3DAYA 5BSMA 4X65C 4DUYC 4B3MC 2QW0X 1N34C 3UOWA 2D1RA 2E5LC 1MD9A 4LF4C 4RVOA 4WV3A 4K0BA 5BURA 3GR0A 2UUCC 3E7XA 5KYVA 4ODJA 3J81D 4YY3C 3T1YC 1IBMC 3R9XA 4G37A 4NXMC 2YCBA 1K0RA 5A2QD 4OXIA 4JYAC 1PA4A 5FLXD 2VQEC 4DCTA 1MDFA 4G1IA 5H9UA 4DV0C 3ETOA 1MDBA 3GPCA 1LCIA 2BJOA 3DHVA 1ML8A 2P2FA 2P2JA 1P7LA 4ZJZA 1PG3A 2Y4OA 3L95X 3G7SA 3RG2A 1T5HX 1V26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JM1 A; 
#chains in the Genus database with same CATH topology
 4X64 C;  4GKK C;  2AYA A;  4G36 A;  2P20 A;  2E7G A;  2DHM A;  1BA3 A;  3K6R A;  1IBK C;  1N33 C;  2UUB C;  3TQI A;  4LF7 C;  2QVZ X;  3CW8 X;  4I9F A;  2D27 A;  3IEU A;  4RM3 A;  4JI3 C;  4DCU A;  4JV5 C;  3IML A;  5CZX A;  2V7B A;  4EAT A;  5BST A;  1UKK A;  4OYC A;  5BSR A;  4D56 A;  4FUT A;  4AQY C;  3AF5 A;  5IT9 D;  5BUS A;  2HJG A;  4D57 A;  1PU1 A;  4LF5 C;  3TDE A;  2UXC C;  2WP0 C;  2MMA B;  2Y4N A;  4JI1 C;  4GKJ C;  1NY8 A;  1N36 C;  3L8C A;  1WCJ A;  4R0M A;  4MTN A;  5KEI A;  3UEB A;  1T5D X;  2OPL A;  5K8F A;  4DR7 C;  5AE2 A;  1VEH A;  4PUG A;  2DPL A;  3N54 B;  2D28 C;  1XHJ A;  4RLF A;  4B3S C;  1O90 A;  4DCV A;  5A1G A;  4RM2 A;  3KXW A;  4KTV A;  5LMN C;  3OTO C;  4BBY A;  4PHT A;  2KDN A;  3CQ1 A;  4D4G A;  4FTF A;  2E0G A;  5GTD A;  3A4I A;  1L2F A;  1O92 A;  2KZ0 A;  4DV3 C;  4BCA A;  5T8S A;  5ADZ A;  4RLQ A;  3UX3 A;  1GPM A;  2UUA C;  4JI5 C;  3UX2 A;  1EGA A;  1N32 C;  5LMU C;  2P2B A;  3R44 A;  2Z51 A;  4LF6 C;  4DR3 C;  2EGT A;  3S82 A;  2F4V C;  3NYR A;  5BUQ A;  3CW9 A;  4DV2 C;  2E8C A;  1M6X A;  3H2T A;  1XS3 A;  3NPD A;  4B3T C;  4BSZ A;  3C5E A;  3EQ6 A;  2UU9 C;  4KTT A;  4JM1 A;  4NDN A;  4LE5 A;  3IEV A;  2P2Q A;  2JMP A;  4GXR A;  3LNO A;  4DV7 C;  4B3R C;  3FCC A;  1XMO C;  3A9U A;  4LFC C;  4L2Z A;  1I94 C;  5KYT A;  5DV9 A;  4LF9 C;  2E8F A;  3NYQ A;  3I08 A;  4PZP A;  1NYE A;  4NXN C;  5JRH A;  1XRB A;  2NCL A;  3VNR A;  1IBL C;  2CXC A;  1FUG A;  1XNQ C;  3AF6 A;  4LFA C;  2VZE A;  1HNX C;  2UXD C;  1XRC A;  2WD9 A;  4DR2 C;  4DR4 C;  1FLO A;  3B7W A;  3LNV A;  4DG9 A;  4PUH A;  1P4E A;  2PRO A;  4YHH C;  1RY2 A;  2QVY X;  4WS9 A;  4DR5 C;  1XMQ C;  2CU6 A;  5AE3 A;  3PRO C;  1ZB9 A;  4OX9 C;  4HPV A;  4X62 C;  2VQF C;  4TPS B;  4ZLP A;  2D1T A;  4JI8 C;  1HR0 C;  4BC9 A;  1MKY A;  1USP B;  3LAX A;  3LGX A;  5BR8 C;  4IZ6 A;  3I07 A;  4DR1 C;  1KKG A;  4R1L A;  5BSU A;  4GXQ A;  4GS5 A;  3VNS A;  1QWI A;  3FCE A;  1O9T A;  2YWB A;  5IWA C;  4I9G A;  4FUQ A;  5BSW A;  4L4Q A;  3TUF A;  3A9V A;  4JI6 C;  2YWC A;  3E7W A;  4PUI A;  5BSV A;  4LFB C;  4DR6 C;  4RMN A;  3R9W A;  3O2E A;  2HHH C;  3SO4 A;  3NI2 A;  2M5H A;  1LQL A;  2Y27 A;  2ASB A;  2ATW A;  2OBV A;  4X66 C;  2OO4 A;  2E8E A;  2XR1 A;  4PRO C;  1ZB8 A;  2ZZN A;  1M6X C;  2DYJ A;  1HH2 P;  1O93 A;  2P2M A;  2YX1 A;  4DV5 C;  1JOS A;  4RVN A;  1VLA A;  2QVX X;  3RV2 A;  3A25 A;  3DLP X;  2P02 A;  3CJE A;  1RG9 A;  1V60 A;  4DV4 C;  1J5E C;  2PT7 G;  3T1H C;  3LUS A;  5A1I A;  4KHP C;  3GKU A;  4DUZ C;  3UZ0 A;  2MM9 A;  4JI7 C;  2VSQ A;  5IFI A;  4K0K C;  3AY0 A;  2UXB C;  1AMU A;  4DV6 C;  3JAM D;  4XX2 A;  4NOZ A;  4D4I A;  3EER A;  1TH5 A;  4BC7 A;  4ISB A;  1FJG C;  1PG4 A;  5K85 A;  2PN2 A;  4U5Y D;  4R1M A;  1HNW C;  2D1Q A;  1P4E C;  5CZV A;  5AE1 A;  3GR1 A;  2D7V A;  3CQ2 A;  1V25 A;  4DCS A;  2D1S A;  2ONF A;  5T8T A;  2JNV A;  1ULT A;  5E7Q A;  1QM4 A;  3PES A;  3IPL A;  2KZF A;  4L7I A;  4JI0 C;  5A19 A;  1N2F A;  2BH1 X;  1WF3 A;  2MCQ A;  4MH4 A;  2OPL B;  2CY1 A;  4JI4 C;  4DV1 C;  1HNZ C;  1YJ7 A;  1XNR C;  1MXB A;  2ZZM A;  1USP A;  3ETC A;  3TR3 A;  3PBK A;  4LF8 C;  2QL8 A;  1IB8 A;  1XRA A;  1MXC A;  4DG8 A;  3J80 D;  3VNQ A;  1WH9 A;  3N2Q A;  2ZM6 C;  1MXA A;  4IR7 A;  4JI2 C;  5LCI A;  3DAY A;  3A26 A;  5BSM A;  4X65 C;  4DUY C;  4B3M C;  2QW0 X;  1N34 C;  3UOW A;  2D1R A;  2E5L C;  3CQ3 A;  1MD9 A;  4LF4 C;  1UWD A;  4RVO A;  4WV3 A;  4K0B A;  5BUR A;  2M5O A;  3GR0 A;  2UUC C;  3E7X A;  5KYV A;  4ODJ A;  3J81 D;  4YY3 C;  3T1Y C;  1IBM C;  3R9X A;  4G37 A;  4NXM C;  2YCB A;  1K0R A;  5A2Q D;  4OXI A;  4JYA C;  1PA4 A;  5FLX D;  2VQE C;  4DCT A;  1MDF A;  4G1I A;  5H9U A;  4DV0 C;  3ETO A;  1MDB A;  3GPC A;  1LCI A;  2BJO A;  3DHV A;  1ML8 A;  2P2F A;  2P2J A;  1P7L A;  4ZJZ A;  1PG3 A;  2Y4O A;  3L95 X;  3G7S A;  3RG2 A;  1T5H X;  1V26 A; 
#chains in the Genus database with same CATH homology
 4X64 C;  4GKK C;  2AYA A;  4G36 A;  2P20 A;  2E7G A;  1BA3 A;  1IBK C;  1N33 C;  2UUB C;  3TQI A;  4LF7 C;  2QVZ X;  3CW8 X;  4I9F A;  2D27 A;  3IEU A;  4RM3 A;  4JI3 C;  4DCU A;  4JV5 C;  3IML A;  5CZX A;  2V7B A;  4EAT A;  5BST A;  1UKK A;  4OYC A;  5BSR A;  4D56 A;  4FUT A;  4AQY C;  3AF5 A;  5IT9 D;  5BUS A;  2HJG A;  4D57 A;  4LF5 C;  3TDE A;  2UXC C;  2WP0 C;  2Y4N A;  4JI1 C;  4GKJ C;  1N36 C;  3L8C A;  4R0M A;  4MTN A;  5KEI A;  1T5D X;  2OPL A;  5K8F A;  4DR7 C;  5AE2 A;  2DPL A;  3N54 B;  2D28 C;  4B3S C;  4RLF A;  1O90 A;  4DCV A;  5A1G A;  4RM2 A;  3KXW A;  4KTV A;  5LMN C;  3OTO C;  4BBY A;  4PHT A;  4D4G A;  4FTF A;  2E0G A;  5GTD A;  3A4I A;  1L2F A;  1O92 A;  4DV3 C;  4BCA A;  5T8S A;  5ADZ A;  4RLQ A;  1GPM A;  2UUA C;  4JI5 C;  1EGA A;  1N32 C;  5LMU C;  2P2B A;  3R44 A;  4LF6 C;  4DR3 C;  2EGT A;  3S82 A;  2F4V C;  3NYR A;  5BUQ A;  3CW9 A;  4DV2 C;  2E8C A;  3H2T A;  3NPD A;  4B3T C;  4BSZ A;  3C5E A;  3EQ6 A;  2UU9 C;  4KTT A;  4JM1 A;  4NDN A;  4LE5 A;  3IEV A;  2P2Q A;  2JMP A;  4GXR A;  4DV7 C;  4B3R C;  3FCC A;  1XMO C;  3A9U A;  4LFC C;  4L2Z A;  1I94 C;  5KYT A;  5DV9 A;  4LF9 C;  2E8F A;  3NYQ A;  3I08 A;  4PZP A;  1NYE A;  4NXN C;  5JRH A;  1XRB A;  3VNR A;  1IBL C;  2CXC A;  1FUG A;  1XNQ C;  3AF6 A;  4LFA C;  2VZE A;  1HNX C;  2UXD C;  1XRC A;  2WD9 A;  4DR2 C;  4DR4 C;  3B7W A;  3LNV A;  4DG9 A;  2PRO A;  4YHH C;  1RY2 A;  2QVY X;  4WS9 A;  4DR5 C;  1XMQ C;  5AE3 A;  3PRO C;  1ZB9 A;  4OX9 C;  4HPV A;  4X62 C;  2VQF C;  4TPS B;  4ZLP A;  2D1T A;  4JI8 C;  1HR0 C;  4BC9 A;  1MKY A;  1USP B;  3LAX A;  3LGX A;  5BR8 C;  4IZ6 A;  3I07 A;  4DR1 C;  1KKG A;  4R1L A;  5BSU A;  4GXQ A;  4GS5 A;  3VNS A;  1QWI A;  3FCE A;  1O9T A;  2YWB A;  5IWA C;  4I9G A;  4FUQ A;  5BSW A;  4L4Q A;  3TUF A;  3A9V A;  4JI6 C;  2YWC A;  3E7W A;  5BSV A;  4LFB C;  4DR6 C;  4RMN A;  3R9W A;  2HHH C;  3SO4 A;  3NI2 A;  1LQL A;  2Y27 A;  2ASB A;  2ATW A;  2OBV A;  4X66 C;  2OO4 A;  2E8E A;  2XR1 A;  4PRO C;  1ZB8 A;  2DYJ A;  1HH2 P;  1O93 A;  2P2M A;  4DV5 C;  1JOS A;  4RVN A;  1VLA A;  2QVX X;  3RV2 A;  3DLP X;  2P02 A;  3CJE A;  1RG9 A;  4DV4 C;  1J5E C;  2PT7 G;  3T1H C;  3LUS A;  5A1I A;  4KHP C;  3GKU A;  4DUZ C;  3UZ0 A;  4JI7 C;  2VSQ A;  5IFI A;  4K0K C;  2UXB C;  1AMU A;  4DV6 C;  3JAM D;  4XX2 A;  4NOZ A;  4D4I A;  3EER A;  4BC7 A;  4ISB A;  1FJG C;  1PG4 A;  5K85 A;  2PN2 A;  4U5Y D;  4R1M A;  1HNW C;  2D1Q A;  5CZV A;  5AE1 A;  3GR1 A;  2D7V A;  1V25 A;  4DCS A;  2D1S A;  2ONF A;  5T8T A;  1ULT A;  5E7Q A;  1QM4 A;  3PES A;  3IPL A;  2KZF A;  4L7I A;  4JI0 C;  5A19 A;  1N2F A;  2BH1 X;  1WF3 A;  4MH4 A;  2OPL B;  2CY1 A;  4JI4 C;  4DV1 C;  1HNZ C;  1YJ7 A;  1XNR C;  1MXB A;  1USP A;  3ETC A;  3PBK A;  4LF8 C;  2QL8 A;  1XRA A;  1MXC A;  4DG8 A;  3J80 D;  3VNQ A;  1WH9 A;  3N2Q A;  2ZM6 C;  1MXA A;  4IR7 A;  4JI2 C;  3DAY A;  5BSM A;  4X65 C;  4DUY C;  4B3M C;  2QW0 X;  1N34 C;  3UOW A;  2D1R A;  2E5L C;  1MD9 A;  4LF4 C;  4RVO A;  4WV3 A;  4K0B A;  5BUR A;  3GR0 A;  2UUC C;  3E7X A;  5KYV A;  4ODJ A;  3J81 D;  4YY3 C;  3T1Y C;  1IBM C;  3R9X A;  4G37 A;  4NXM C;  2YCB A;  1K0R A;  5A2Q D;  4OXI A;  4JYA C;  1PA4 A;  5FLX D;  2VQE C;  4DCT A;  1MDF A;  4G1I A;  5H9U A;  4DV0 C;  3ETO A;  1MDB A;  3GPC A;  1LCI A;  2BJO A;  3DHV A;  1ML8 A;  2P2F A;  2P2J A;  1P7L A;  4ZJZ A;  1PG3 A;  2Y4O A;  3L95 X;  3G7S A;  3RG2 A;  1T5H X;  1V26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...