4JM1A

Crystal structure of a protein with alpha-lytic protease prodomain-like fold (bdi_0842) from parabacteroides distasonis atcc 8503 at 1.40 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
GADKYIDTITGFSCEKAAVTDNGFLVIAIDADSDSGYDMLASQFLEEAKKEGVSGLKGVLIVDIKNAKFEQGAVVGKRIGKAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BDI_0842) from Parabacteroides distasonis ATCC 8503 at 1.40 A resolution
rcsb
source organism Parabacteroides distasonis
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 25
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.300 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4jm1A00
4JM1A
chains in the Genus database with same CATH superfamily
5T8TA 1LQLA 4NOZA 3L95X 2E0GA 4RVOA 4RMNA 2ATWA 2M5OA 4TPSB 2CU6A 1MD9A 1UKKA 4HPVA 4DV3C 4IZ6A 4JI2C 4X65C 1IBLC 4BC9A 3DLPX 4R0MA 1HR0C 3PBKA 1P4EA 5IWAC 1HH2P 4JI3C 2KZFA 2Z51A 1P4EC 4BC7A 2PN2A 4DUZC 4KHPC 5BSUA 2YWCA 4DV5C 5IFIA 1KKGA 3RG2A 1MKYA 3S82A 4LFBC 1NY8A 3R9WA 4KTVA 5A19A 4OYCA 2AYAA 1IBMC 2YWBA 1J5EC 2E8FA 3ETCA 3LNOA 5AE3A 5KYVA 3AF6A 1IBKC 3TR3A 4DV4C 4PHTA 2P20A 4DV2C 2KZ0A 4BSZA 3O2EA 3JAMD 1RY2A 3PESA 4JI0C 2ZM6C 3T1YC 3G7SA 1O9TA 4G1IA 1N32C 2ZZMA 1QWIA 2D7VA 4X62C 3GPCA 5T8SA 2YCBA 3UEBA 5LCIA 2PT7G 5BSRA 3R9XA 3A9UA 4EATA 4BCAA 2UXBC 5BUSA 4GKKC 4JI8C 4I9FA 2E5LC 4JM1A 3LGXA 1O93A 4FUTA 4D57A 3CQ1A 2D1QA 3E7XA 3A25A 4LFCC 4PROC 2Y4OA 3E7WA 5E7QA 4JI6C 1XRBA 4B3MC 5K85A 2M5HA 3KXWA 2DPLA 2DYJA 1IB8A 4U5YD 2KDNA 4WS9A 3CQ2A 4MH4A 4I9GA 2HJGA 4L7IA 3EERA 4LF4C 3K6RA 2UXCC 4RLQA 3A26A 1PG4A 4RLFA 2EGTA 2UUBC 4R1MA 3L8CA 4FTFA 5A2QD 3SO4A 4RM2A 4OX9C 4ZJZA 1QM4A 3IMLA 2JMPA 3AY0A 2QVXX 4XX2A 4DV1C 2VSQA 1HNZC 1M6XC 2P2QA 4PUGA 2QL8A 4D56A 4DR2C 4B3TC 1USPA 3I07A 3R44A 4PUHA 2NCLA 5BSMA 3UX2A 3EQ6A 4JI7C 1NYEA 1JOSA 2E7GA 2WD9A 2CXCA 3PROC 4LF7C 4JI5C 4DR5C 3AF5A 3C5EA 4D4GA 5BURA 4DV0C 1N36C 4DCSA 5A1GA 4DR3C 3N2QA 5LMUC 2D27A 5CZVA 2UUAC 2P2MA 4MTNA 4PZPA 1N34C 1MXBA 1YJ7A 3A9VA 2ASBA 1EGAA 3NYQA 2BJOA 1HNXC 4ZLPA 4GKJC 2QVZX 3DAYA 5BSTA 3IPLA 3RV2A 5AE2A 4IR7A 5GTDA 4L4QA 4DR1C 4DR6C 3FCEA 2Y27A 2UUCC 2OO4A 4DUYC 3CW9A 3IEUA 3LNVA 2HHHC 3VNQA 1N2FA 3VNSA 3B7WA 4YY3C 2OBVA 3UZ0A 4WV3A 3GKUA 2F4VC 1LCIA 1O92A 4DCTA 4YHHC 3TQIA 5BUQA 4L2ZA 2XR1A 1XNRC 4NXNC 2E8EA 4ODJA 4LE5A 5LMNC 3ETOA 4X66C 4LF5C 1ULTA 1WF3A 4RVNA 4BBYA 4X64C 1AMUA 5A1IA 1VEHA 4ISBA 2ONFA 2OPLB 5FLXD 3OTOC 4K0KC 2UXDC 1WH9A 4G37A 4NDNA 4GXRA 5AE1A 5JRHA 1HNWC 1XMQC 5CZXA 3DHVA 1XMOC 4PUIA 4LFAC 1ZB9A 1UWDA 1O90A 1ML8A 4D4IA 1FJGC 1FLOA 2D1TA 3CJEA 1RG9A 2CY1A 1USPB 2MM9A 4DG8A 2P2FA 4GXQA 4JV5C 3IEVA 1PG3A 3FCCA 1I94C 1V26A 1XS3A 3N54B 1XNQC 3NYRA 1XRAA 2VZEA 4DV7C 3GR0A 4DCUA 4KTTA 5BR8C 2P02A 4R1LA 3J80D 2QVYX 4RM3A 5BSWA 1MDFA 2BH1X 2MMAB 2Y4NA 3UX3A 4FUQA 3GR1A 4LF9C 2D1RA 1TH5A 5KEIA 3CW8X 5ADZA 4DCVA 3LUSA 1L2FA 4JI1C 1P7LA 1BA3A 2E8CA 2WP0C 1MDBA 1V25A 1N33C 1T5DX 1K0RA 5KYTA 2VQFC 1ZB8A 2PROA 1MXAA 1PU1A 2V7BA 2OPLA 5DV9A 4DR7C 4JI4C 4DR4C 1PA4A 1MXCA 1VLAA 4NXMC 2YX1A 4OXIA 4B3SC 1GPMA 4AQYC 3A4IA 3TDEA 4GS5A 1FUGA 1WCJA 5H9UA 4B3RC 2D1SA 4JYAC 4LF6C 2D28C 3H2TA 4LF8C 1T5HX 1XRCA 4DG9A 2JNVA 4DV6C 5BSVA 3LAXA 1XHJA 2QW0X 2P2BA 2UU9C 2DHMA 2ZZNA 3T1HC 3TUFA 3CQ3A 1V60A 5IT9D 3J81D 3UOWA 3NI2A 5K8FA 3VNRA 3I08A 3NPDA 1M6XA 4K0BA 2P2JA 2MCQA 4G36A 2VQEC
chains in the Genus database with same CATH topology
5T8TA 1LQLA 4NOZA 3L95X 2E0GA 4RVOA 4RMNA 2ATWA 4TPSB 1MD9A 1UKKA 4HPVA 4DV3C 4IZ6A 4JI2C 4X65C 1IBLC 4BC9A 3DLPX 4R0MA 1HR0C 3PBKA 5IWAC 1HH2P 4JI3C 2KZFA 4BC7A 2PN2A 4DUZC 4KHPC 5BSUA 2YWCA 4DV5C 5IFIA 1KKGA 3RG2A 1MKYA 3S82A 4LFBC 3R9WA 4KTVA 5A19A 4OYCA 2AYAA 1IBMC 2YWBA 1J5EC 2E8FA 3ETCA 5AE3A 5KYVA 3AF6A 1IBKC 4DV4C 4PHTA 2P20A 4DV2C 4BSZA 3JAMD 1RY2A 3PESA 4JI0C 2ZM6C 3T1YC 3G7SA 1O9TA 4G1IA 1N32C 1QWIA 2D7VA 4X62C 3GPCA 5T8SA 2YCBA 2PT7G 5BSRA 3R9XA 3A9UA 4EATA 4BCAA 2UXBC 5BUSA 4GKKC 4JI8C 4I9FA 2E5LC 4JM1A 3LGXA 1O93A 4FUTA 4D57A 2D1QA 3E7XA 4LFCC 4PROC 2Y4OA 3E7WA 5E7QA 4JI6C 1XRBA 4B3MC 5K85A 3KXWA 2DPLA 2DYJA 4U5YD 4WS9A 4MH4A 4I9GA 2HJGA 4L7IA 3EERA 4LF4C 2UXCC 4RLQA 1PG4A 4RLFA 2EGTA 2UUBC 4R1MA 3L8CA 4FTFA 5A2QD 3SO4A 4RM2A 4OX9C 4ZJZA 1QM4A 3IMLA 2JMPA 2QVXX 4XX2A 4DV1C 2VSQA 1HNZC 2P2QA 2QL8A 4D56A 4DR2C 4B3TC 1USPA 3I07A 3R44A 5BSMA 3EQ6A 4JI7C 1NYEA 1JOSA 2E7GA 2WD9A 2CXCA 3PROC 4LF7C 4JI5C 4DR5C 3AF5A 3C5EA 4D4GA 1N36C 5BURA 4DV0C 4DCSA 5A1GA 4DR3C 3N2QA 5LMUC 2D27A 5CZVA 2UUAC 2P2MA 4MTNA 4PZPA 1N34C 1MXBA 1YJ7A 3A9VA 2ASBA 1EGAA 1HNXC 3NYQA 2BJOA 4ZLPA 4GKJC 2QVZX 3DAYA 5BSTA 3IPLA 3RV2A 5AE2A 4IR7A 5GTDA 4L4QA 4DR1C 4DR6C 3FCEA 2Y27A 2UUCC 2OO4A 4DUYC 3CW9A 3IEUA 3LNVA 2HHHC 3VNQA 1N2FA 3VNSA 3B7WA 4YY3C 2OBVA 3UZ0A 4WV3A 3GKUA 2F4VC 1LCIA 1O92A 4DCTA 4YHHC 3TQIA 5BUQA 4L2ZA 2XR1A 1XNRC 4NXNC 2E8EA 4ODJA 4LE5A 5LMNC 3ETOA 4X66C 4LF5C 1ULTA 1WF3A 4RVNA 4BBYA 4X64C 1AMUA 5A1IA 4ISBA 2ONFA 2OPLB 5FLXD 3OTOC 4K0KC 2UXDC 1WH9A 4G37A 4NDNA 4GXRA 5AE1A 5JRHA 1HNWC 1XMQC 5CZXA 3DHVA 1XMOC 4LFAC 1ZB9A 1O90A 1ML8A 4D4IA 1FJGC 2D1TA 3CJEA 1RG9A 2CY1A 1USPB 4GXQA 2P2FA 4DG8A 4JV5C 3IEVA 1PG3A 3FCCA 1I94C 1V26A 3N54B 1XNQC 3NYRA 1XRAA 2VZEA 4DV7C 3GR0A 4DCUA 4KTTA 5BR8C 2P02A 4R1LA 3J80D 2QVYX 4RM3A 5BSWA 1MDFA 2BH1X 2Y4NA 4FUQA 3GR1A 4LF9C 2D1RA 5KEIA 3CW8X 5ADZA 4DCVA 3LUSA 1L2FA 4JI1C 1P7LA 1BA3A 2E8CA 2WP0C 1MDBA 1V25A 1N33C 1T5DX 1K0RA 5KYTA 2VQFC 1ZB8A 2PROA 1MXAA 2V7BA 2OPLA 5DV9A 4DR7C 4JI4C 4DR4C 1PA4A 1MXCA 1VLAA 4NXMC 4OXIA 4B3SC 1GPMA 4AQYC 3A4IA 3TDEA 4GS5A 1FUGA 5H9UA 4B3RC 2D1SA 4JYAC 4LF6C 2D28C 3H2TA 4LF8C 1T5HX 1XRCA 4DG9A 4DV6C 5BSVA 3LAXA 2QW0X 2P2BA 2UU9C 3T1HC 3TUFA 5IT9D 3J81D 3UOWA 3NI2A 5K8FA 3VNRA 3I08A 3NPDA 4K0BA 2P2JA 4G36A 2VQEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JM1 A; 
#chains in the Genus database with same CATH topology
 5T8T A;  1LQL A;  4NOZ A;  3L95 X;  2E0G A;  4RVO A;  4RMN A;  2ATW A;  2M5O A;  4TPS B;  2CU6 A;  1MD9 A;  1UKK A;  4HPV A;  4DV3 C;  4IZ6 A;  4JI2 C;  4X65 C;  1IBL C;  4BC9 A;  3DLP X;  4R0M A;  1HR0 C;  3PBK A;  1P4E A;  5IWA C;  1HH2 P;  4JI3 C;  2KZF A;  2Z51 A;  1P4E C;  4BC7 A;  2PN2 A;  4DUZ C;  4KHP C;  5BSU A;  2YWC A;  4DV5 C;  5IFI A;  1KKG A;  3RG2 A;  1MKY A;  3S82 A;  4LFB C;  1NY8 A;  3R9W A;  4KTV A;  5A19 A;  4OYC A;  2AYA A;  1IBM C;  2YWB A;  1J5E C;  2E8F A;  3ETC A;  3LNO A;  5AE3 A;  5KYV A;  3AF6 A;  1IBK C;  3TR3 A;  4DV4 C;  4PHT A;  2P20 A;  4DV2 C;  2KZ0 A;  4BSZ A;  3O2E A;  3JAM D;  1RY2 A;  3PES A;  4JI0 C;  2ZM6 C;  3T1Y C;  3G7S A;  1O9T A;  4G1I A;  1N32 C;  2ZZM A;  1QWI A;  2D7V A;  4X62 C;  3GPC A;  5T8S A;  2YCB A;  3UEB A;  5LCI A;  2PT7 G;  5BSR A;  3R9X A;  3A9U A;  4EAT A;  4BCA A;  2UXB C;  5BUS A;  4GKK C;  4JI8 C;  4I9F A;  2E5L C;  4JM1 A;  3LGX A;  1O93 A;  4FUT A;  4D57 A;  3CQ1 A;  2D1Q A;  3E7X A;  3A25 A;  4LFC C;  4PRO C;  2Y4O A;  3E7W A;  5E7Q A;  4JI6 C;  1XRB A;  4B3M C;  5K85 A;  2M5H A;  3KXW A;  2DPL A;  2DYJ A;  1IB8 A;  4U5Y D;  2KDN A;  4WS9 A;  3CQ2 A;  4MH4 A;  4I9G A;  2HJG A;  4L7I A;  3EER A;  4LF4 C;  3K6R A;  2UXC C;  4RLQ A;  3A26 A;  1PG4 A;  4RLF A;  2EGT A;  2UUB C;  4R1M A;  3L8C A;  4FTF A;  5A2Q D;  3SO4 A;  4RM2 A;  4OX9 C;  4ZJZ A;  1QM4 A;  3IML A;  2JMP A;  3AY0 A;  2QVX X;  4XX2 A;  4DV1 C;  2VSQ A;  1HNZ C;  1M6X C;  2P2Q A;  4PUG A;  2QL8 A;  4D56 A;  4DR2 C;  4B3T C;  1USP A;  3I07 A;  3R44 A;  4PUH A;  2NCL A;  5BSM A;  3UX2 A;  3EQ6 A;  4JI7 C;  1NYE A;  1JOS A;  2E7G A;  2WD9 A;  2CXC A;  3PRO C;  4LF7 C;  4JI5 C;  4DR5 C;  3AF5 A;  3C5E A;  4D4G A;  5BUR A;  4DV0 C;  1N36 C;  4DCS A;  5A1G A;  4DR3 C;  3N2Q A;  5LMU C;  2D27 A;  5CZV A;  2UUA C;  2P2M A;  4MTN A;  4PZP A;  1N34 C;  1MXB A;  1YJ7 A;  3A9V A;  2ASB A;  1EGA A;  3NYQ A;  2BJO A;  1HNX C;  4ZLP A;  4GKJ C;  2QVZ X;  3DAY A;  5BST A;  3IPL A;  3RV2 A;  5AE2 A;  4IR7 A;  5GTD A;  4L4Q A;  4DR1 C;  4DR6 C;  3FCE A;  2Y27 A;  2UUC C;  2OO4 A;  4DUY C;  3CW9 A;  3IEU A;  3LNV A;  2HHH C;  3VNQ A;  1N2F A;  3VNS A;  3B7W A;  4YY3 C;  2OBV A;  3UZ0 A;  4WV3 A;  3GKU A;  2F4V C;  1LCI A;  1O92 A;  4DCT A;  4YHH C;  3TQI A;  5BUQ A;  4L2Z A;  2XR1 A;  1XNR C;  4NXN C;  2E8E A;  4ODJ A;  4LE5 A;  5LMN C;  3ETO A;  4X66 C;  4LF5 C;  1ULT A;  1WF3 A;  4RVN A;  4BBY A;  4X64 C;  1AMU A;  5A1I A;  1VEH A;  4ISB A;  2ONF A;  2OPL B;  5FLX D;  3OTO C;  4K0K C;  2UXD C;  1WH9 A;  4G37 A;  4NDN A;  4GXR A;  5AE1 A;  5JRH A;  1HNW C;  1XMQ C;  5CZX A;  3DHV A;  1XMO C;  4PUI A;  4LFA C;  1ZB9 A;  1UWD A;  1O90 A;  1ML8 A;  4D4I A;  1FJG C;  1FLO A;  2D1T A;  3CJE A;  1RG9 A;  2CY1 A;  1USP B;  2MM9 A;  4DG8 A;  2P2F A;  4GXQ A;  4JV5 C;  3IEV A;  1PG3 A;  3FCC A;  1I94 C;  1V26 A;  1XS3 A;  3N54 B;  1XNQ C;  3NYR A;  1XRA A;  2VZE A;  4DV7 C;  3GR0 A;  4DCU A;  4KTT A;  5BR8 C;  2P02 A;  4R1L A;  3J80 D;  2QVY X;  4RM3 A;  5BSW A;  1MDF A;  2BH1 X;  2MMA B;  2Y4N A;  3UX3 A;  4FUQ A;  3GR1 A;  4LF9 C;  2D1R A;  1TH5 A;  5KEI A;  3CW8 X;  5ADZ A;  4DCV A;  3LUS A;  1L2F A;  4JI1 C;  1P7L A;  1BA3 A;  2E8C A;  2WP0 C;  1MDB A;  1V25 A;  1N33 C;  1T5D X;  1K0R A;  5KYT A;  2VQF C;  1ZB8 A;  2PRO A;  1MXA A;  1PU1 A;  2V7B A;  2OPL A;  5DV9 A;  4DR7 C;  4JI4 C;  4DR4 C;  1PA4 A;  1MXC A;  1VLA A;  4NXM C;  2YX1 A;  4OXI A;  4B3S C;  1GPM A;  4AQY C;  3A4I A;  3TDE A;  4GS5 A;  1FUG A;  1WCJ A;  5H9U A;  4B3R C;  2D1S A;  4JYA C;  4LF6 C;  2D28 C;  3H2T A;  4LF8 C;  1T5H X;  1XRC A;  4DG9 A;  2JNV A;  4DV6 C;  5BSV A;  3LAX A;  1XHJ A;  2QW0 X;  2P2B A;  2UU9 C;  2DHM A;  2ZZN A;  3T1H C;  3TUF A;  3CQ3 A;  1V60 A;  5IT9 D;  3J81 D;  3UOW A;  3NI2 A;  5K8F A;  3VNR A;  3I08 A;  3NPD A;  1M6X A;  4K0B A;  2P2J A;  2MCQ A;  4G36 A;  2VQE C; 
#chains in the Genus database with same CATH homology
 5T8T A;  1LQL A;  4NOZ A;  3L95 X;  2E0G A;  4RVO A;  4RMN A;  2ATW A;  4TPS B;  1MD9 A;  1UKK A;  4HPV A;  4DV3 C;  4IZ6 A;  4JI2 C;  4X65 C;  1IBL C;  4BC9 A;  3DLP X;  4R0M A;  1HR0 C;  3PBK A;  5IWA C;  1HH2 P;  4JI3 C;  2KZF A;  4BC7 A;  2PN2 A;  4DUZ C;  4KHP C;  5BSU A;  2YWC A;  4DV5 C;  5IFI A;  1KKG A;  3RG2 A;  1MKY A;  3S82 A;  4LFB C;  3R9W A;  4KTV A;  5A19 A;  4OYC A;  2AYA A;  1IBM C;  2YWB A;  1J5E C;  2E8F A;  3ETC A;  5AE3 A;  5KYV A;  3AF6 A;  1IBK C;  4DV4 C;  4PHT A;  2P20 A;  4DV2 C;  4BSZ A;  3JAM D;  1RY2 A;  3PES A;  4JI0 C;  2ZM6 C;  3T1Y C;  3G7S A;  1O9T A;  4G1I A;  1N32 C;  1QWI A;  2D7V A;  4X62 C;  3GPC A;  5T8S A;  2YCB A;  2PT7 G;  5BSR A;  3R9X A;  3A9U A;  4EAT A;  4BCA A;  2UXB C;  5BUS A;  4GKK C;  4JI8 C;  4I9F A;  2E5L C;  4JM1 A;  3LGX A;  1O93 A;  4FUT A;  4D57 A;  2D1Q A;  3E7X A;  4LFC C;  4PRO C;  2Y4O A;  3E7W A;  5E7Q A;  4JI6 C;  1XRB A;  4B3M C;  5K85 A;  3KXW A;  2DPL A;  2DYJ A;  4U5Y D;  4WS9 A;  4MH4 A;  4I9G A;  2HJG A;  4L7I A;  3EER A;  4LF4 C;  2UXC C;  4RLQ A;  1PG4 A;  4RLF A;  2EGT A;  2UUB C;  4R1M A;  3L8C A;  4FTF A;  5A2Q D;  3SO4 A;  4RM2 A;  4OX9 C;  4ZJZ A;  1QM4 A;  3IML A;  2JMP A;  2QVX X;  4XX2 A;  4DV1 C;  2VSQ A;  1HNZ C;  2P2Q A;  2QL8 A;  4D56 A;  4DR2 C;  4B3T C;  1USP A;  3I07 A;  3R44 A;  5BSM A;  3EQ6 A;  4JI7 C;  1NYE A;  1JOS A;  2E7G A;  2WD9 A;  2CXC A;  3PRO C;  4LF7 C;  4JI5 C;  4DR5 C;  3AF5 A;  3C5E A;  4D4G A;  1N36 C;  5BUR A;  4DV0 C;  4DCS A;  5A1G A;  4DR3 C;  3N2Q A;  5LMU C;  2D27 A;  5CZV A;  2UUA C;  2P2M A;  4MTN A;  4PZP A;  1N34 C;  1MXB A;  1YJ7 A;  3A9V A;  2ASB A;  1EGA A;  1HNX C;  3NYQ A;  2BJO A;  4ZLP A;  4GKJ C;  2QVZ X;  3DAY A;  5BST A;  3IPL A;  3RV2 A;  5AE2 A;  4IR7 A;  5GTD A;  4L4Q A;  4DR1 C;  4DR6 C;  3FCE A;  2Y27 A;  2UUC C;  2OO4 A;  4DUY C;  3CW9 A;  3IEU A;  3LNV A;  2HHH C;  3VNQ A;  1N2F A;  3VNS A;  3B7W A;  4YY3 C;  2OBV A;  3UZ0 A;  4WV3 A;  3GKU A;  2F4V C;  1LCI A;  1O92 A;  4DCT A;  4YHH C;  3TQI A;  5BUQ A;  4L2Z A;  2XR1 A;  1XNR C;  4NXN C;  2E8E A;  4ODJ A;  4LE5 A;  5LMN C;  3ETO A;  4X66 C;  4LF5 C;  1ULT A;  1WF3 A;  4RVN A;  4BBY A;  4X64 C;  1AMU A;  5A1I A;  4ISB A;  2ONF A;  2OPL B;  5FLX D;  3OTO C;  4K0K C;  2UXD C;  1WH9 A;  4G37 A;  4NDN A;  4GXR A;  5AE1 A;  5JRH A;  1HNW C;  1XMQ C;  5CZX A;  3DHV A;  1XMO C;  4LFA C;  1ZB9 A;  1O90 A;  1ML8 A;  4D4I A;  1FJG C;  2D1T A;  3CJE A;  1RG9 A;  2CY1 A;  1USP B;  4GXQ A;  2P2F A;  4DG8 A;  4JV5 C;  3IEV A;  1PG3 A;  3FCC A;  1I94 C;  1V26 A;  3N54 B;  1XNQ C;  3NYR A;  1XRA A;  2VZE A;  4DV7 C;  3GR0 A;  4DCU A;  4KTT A;  5BR8 C;  2P02 A;  4R1L A;  3J80 D;  2QVY X;  4RM3 A;  5BSW A;  1MDF A;  2BH1 X;  2Y4N A;  4FUQ A;  3GR1 A;  4LF9 C;  2D1R A;  5KEI A;  3CW8 X;  5ADZ A;  4DCV A;  3LUS A;  1L2F A;  4JI1 C;  1P7L A;  1BA3 A;  2E8C A;  2WP0 C;  1MDB A;  1V25 A;  1N33 C;  1T5D X;  1K0R A;  5KYT A;  2VQF C;  1ZB8 A;  2PRO A;  1MXA A;  2V7B A;  2OPL A;  5DV9 A;  4DR7 C;  4JI4 C;  4DR4 C;  1PA4 A;  1MXC A;  1VLA A;  4NXM C;  4OXI A;  4B3S C;  1GPM A;  4AQY C;  3A4I A;  3TDE A;  4GS5 A;  1FUG A;  5H9U A;  4B3R C;  2D1S A;  4JYA C;  4LF6 C;  2D28 C;  3H2T A;  4LF8 C;  1T5H X;  1XRC A;  4DG9 A;  4DV6 C;  5BSV A;  3LAX A;  2QW0 X;  2P2B A;  2UU9 C;  3T1H C;  3TUF A;  5IT9 D;  3J81 D;  3UOW A;  3NI2 A;  5K8F A;  3VNR A;  3I08 A;  3NPD A;  4K0B A;  2P2J A;  4G36 A;  2VQE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...