1QWIA

Crystal structure of e. coli osmc
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
TIHKKGQAHWESDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional features of the Escherichia coli hydroperoxide resistance protein OsmC
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydroperoxide reductase
molecule keywords osmotically inducible protein
total genus 37
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1qwiA00
2ATWA 1IBLC 4NXMC 4LFAC 1HNXC 1ZB8A 3EERA 4LF6C 4YY3C 1N32C 4MH4A 1QWIA 4LF7C 4DCSA 2F4VC 3GKUA 4DR7C 2E8FA 4X64C 2E8EA 4LF5C 2ONFA 2E5LC 3R9XA 2QL8A 1HNZC 1LQLA 1USPB 4JI6C 4JI7C 5LMNC 4NOZA 3I07A 4DV6C 4DR3C 4X62C 2VQEC 2PN2A 1UKKA 4DV2C 4AQYC 5FLXD 4JYAC 2CXCA 4LF4C 1XMQC 1KKGA 4LF8C 1VLAA 4JI5C 4JI1C 2UUAC 2OPLA 3AF6A 4DCUA 1I94C 4YHHC 2HHHC 4DV1C 1USPA 4DUYC 4GKJC 2YCBA 2PT7G 4DUZC 4MTNA 4X66C 4B3RC 5IT9D 3AF5A 2UU9C 1FJGC 5LMUC 4LFCC 1IBKC 2UUCC 1HR0C 3J80D 1XNQC 2VQFC 2D7VA 2EGTA 1J5EC 4DV5C 3IEUA 2E7GA 1WH9A 1XMOC 4DV4C 3T1YC 3R9WA 4K0KC 1HNWC 4DR6C 2UXBC 4LF9C 2E8CA 4KHPC 4JI2C 2UXDC 1ZB9A 4B3SC 4DV7C 2BJOA 1L2FA 4B3TC 1NYEA 5A2QD 3CJEA 2DYJA 4JV5C 4JI3C 4BSZA 4DR5C 5BR8C 1IBMC 3OTOC 4OX9C 4DV0C 4JI0C 1N36C 4DR4C 1EGAA 4DR2C 4LFBC 1HH2P 1PA4A 4JI4C 3JAMD 3IEVA 1ML8A 2ASBA 2OPLB 1N2FA 1XNRC 2KZFA 3LUSA 4DCVA 4DV3C 2JMPA 5IWAC 3J81D 3T1HC 1MKYA 2HJGA 1WF3A 1N34C 4XX2A 4DCTA 4DR1C 4GKKC 2UXCC 1JOSA 2CY1A 4X65C 4B3MC 2XR1A 4NXNC 1N33C 1K0RA 2UUBC 4JI8C 2ZM6C
chains in the Genus database with same CATH superfamily
1AMUA 4LFAC 5CZVA 1ZB8A 4OYCA 3E7XA 3TUFA 2D1QA 5BURA 3GKUA 3LNOA 4X64C 2YX1A 4K0BA 2ONFA 2WD9A 3C5EA 1XS3A 4JI6C 4DV6C 4DR3C 3A26A 2VQEC 1UKKA 1LCIA 2CXCA 4LF4C 1VLAA 1XHJA 2OPLA 4RVNA 1IB8A 1I94C 5K85A 2HHHC 3L95X 5BUSA 3VNRA 4MTNA 4ODJA 1O92A 4PUGA 3FCEA 5IT9D 1WCJA 4D4IA 1MXAA 1IBKC 1BA3A 3L8CA 1J5EC 3IEUA 3R9WA 4DR6C 2UXBC 4LF9C 2E8CA 4FUTA 4JI2C 1ZB9A 3RV2A 4KTVA 4DG8A 1NYEA 5A2QD 3CJEA 4OXIA 1V60A 4DR5C 3A4IA 1IBMC 2P20A 3OTOC 3FCCA 4KTTA 1EGAA 3JAMD 3IEVA 1N2FA 4IR7A 1TH5A 2JMPA 5T8TA 3A9UA 2QVYX 3CW9A 3T1HC 2HJGA 4R0MA 1FLOA 3CQ2A 1MXBA 4FTFA 4R1LA 3A9VA 4ZLPA 3ETOA 2XR1A 4NXNC 2D1RA 4JI8C 5A1IA 3N2QA 4NXMC 3S82A 3B7WA 2ZZNA 5KYTA 5KEIA 5AE2A 4LF7C 4TPSB 4DCSA 3O2EA 5BSMA 3VNSA 3TQIA 3R9XA 2E5LC 4L7IA 3N54B 1HNZC 3ETCA 1LQLA 1V26A 5GTDA 4NOZA 4JYAC 1KKGA 4LF8C 3NYRA 3DAYA 3G7SA 5H9UA 4JM1A 5A19A 3AF6A 4IZ6A 4L4QA 2WP0C 1O9TA 2PT7G 1XRAA 3PROC 4B3RC 1MDFA 2D27A 4ZJZA 5LMUC 4LFCC 2CU6A 1XNQC 3PESA 5DV9A 2VQFC 2EGTA 4DV5C 2D1SA 1XMOC 4K0KC 1HNWC 3TDEA 2UXDC 4DV7C 1L2FA 4LE5A 2VZEA 1M6XA 1NY8A 4BSZA 1M6XC 5AE3A 2VSQA 4DV0C 5T8SA 4JI0C 5BSTA 4D57A 1MDBA 3GR0A 1HH2P 1PA4A 4FUQA 1ML8A 1V25A 2ASBA 1XNRC 3LUSA 3CW8X 3AY0A 1WF3A 1N34C 4XX2A 2QW0X 4DCTA 3UX2A 2CY1A 5BUQA 4B3MC 3LAXA 2QVXX 3R44A 2UUBC 2ZM6C 2ATWA 3EERA 3NYQA 2YWBA 2QVZX 4YY3C 3LGXA 4MH4A 4DG9A 3CQ1A 1RY2A 2DHMA 4DR7C 2E8FA 4LF5C 4GS5A 3UEBA 2BH1X 4BBYA 5ADZA 2QL8A 3K6RA 1USPB 5LMNC 3I07A 3UOWA 2Z51A 3UX3A 1O93A 5AE1A 1FUGA 4AQYC 3NPDA 1MD9A 1XMQC 3DHVA 5CZXA 2MM9A 4JI5C 4JI1C 4I9GA 4G37A 4DV1C 1PU1A 2ZZMA 4GKJC 2YCBA 2YWCA 4RLFA 2P02A 1VEHA 3DLPX 3KXWA 4X66C 3AF5A 5E7QA 1FJGC 1T5HX 2UUCC 2M5OA 3J80D 2D7VA 2D1TA 2Y4NA 4PUIA 5A1GA 2E7GA 1YJ7A 4DV4C 3T1YC 2Y4OA 3GPCA 4KHPC 4B3SC 2BJOA 3E7WA 5KYVA 2AYAA 4B3TC 5K8FA 4EATA 2DYJA 4JI3C 1O90A 5BR8C 5IFIA 2PROA 1N36C 4NDNA 4DR4C 4DR2C 3NI2A 4D56A 1UWDA 4DV3C 4BC9A 3LNVA 5IWAC 1MKYA 4GXQA 2MMAB 1GPMA 4DR1C 3PBKA 4GKKC 5BSVA 4X65C 2OO4A 1N33C 1K0RA 4PHTA 5LCIA 4WS9A 1IBLC 1QM4A 3EQ6A 1HNXC 1RG9A 4LF6C 1N32C 3A25A 1QWIA 4L2ZA 2F4VC 4G36A 1PG3A 2DPLA 4RM2A 2KDNA 2E8EA 4U5YD 4GXRA 4ISBA 1P7LA 2P2JA 4JI7C 4PZPA 4X62C 4RMNA 2PN2A 4DV2C 5FLXD 2D28C 4RVOA 2UUAC 4DCUA 4YHHC 1USPA 4DUYC 4PUHA 2OBVA 4DUZC 4R1MA 2MCQA 5BSRA 1PG4A 3SO4A 5BSUA 4WV3A 2UU9C 1XRCA 2KZ0A 2Y27A 1HR0C 4BC7A 2P2MA 3CQ3A 1WH9A 3GR1A 4G1IA 3RG2A 4HPVA 4BCAA 2V7BA 5BSWA 1MXCA 2P2FA 3IMLA 2M5HA 3IPLA 2E0GA 4JV5C 3I08A 4RLQA 1P4EA 3VNQA 2NCLA 4OX9C 1P4EC 4D4GA 4LFBC 4JI4C 4PROC 2OPLB 2KZFA 4DCVA 3TR3A 4I9FA 3UZ0A 3J81D 4RM3A 3H2TA 2P2QA 1ULTA 2P2BA 2JNVA 1XRBA 2UXCC 1JOSA 1T5DX 5JRHA
chains in the Genus database with same CATH topology
1AMUA 4LFAC 5CZVA 1ZB8A 4OYCA 3E7XA 3TUFA 2D1QA 5BURA 3GKUA 4X64C 4K0BA 2ONFA 2WD9A 3C5EA 4JI6C 4DV6C 4DR3C 2VQEC 1UKKA 1LCIA 2CXCA 4LF4C 1VLAA 2OPLA 4RVNA 1I94C 5K85A 2HHHC 3L95X 5BUSA 3VNRA 4MTNA 4ODJA 1O92A 3FCEA 5IT9D 4D4IA 1MXAA 1IBKC 1BA3A 3L8CA 1J5EC 3IEUA 3R9WA 4DR6C 2UXBC 4LF9C 2E8CA 4FUTA 4JI2C 1ZB9A 3RV2A 4KTVA 4DG8A 1NYEA 5A2QD 3CJEA 4OXIA 4DR5C 3A4IA 1IBMC 2P20A 3OTOC 3FCCA 4KTTA 1EGAA 3JAMD 3IEVA 1N2FA 4IR7A 2JMPA 5T8TA 3A9UA 3T1HC 2QVYX 3CW9A 2HJGA 4R0MA 1MXBA 4FTFA 4R1LA 3A9VA 4ZLPA 3ETOA 2XR1A 4NXNC 2D1RA 4JI8C 5A1IA 3N2QA 4NXMC 3S82A 3B7WA 5KYTA 5KEIA 5AE2A 4LF7C 4TPSB 4DCSA 5BSMA 3VNSA 3TQIA 3R9XA 2E5LC 4L7IA 3N54B 1HNZC 3ETCA 1LQLA 1V26A 5GTDA 4NOZA 4JYAC 1KKGA 4LF8C 3NYRA 3DAYA 3G7SA 5H9UA 4JM1A 5A19A 3AF6A 4IZ6A 4L4QA 2WP0C 1O9TA 2PT7G 1XRAA 3PROC 4B3RC 1MDFA 2D27A 4ZJZA 5LMUC 4LFCC 1XNQC 3PESA 5DV9A 2VQFC 2EGTA 4DV5C 2D1SA 1XMOC 4K0KC 1HNWC 3TDEA 2UXDC 4DV7C 1L2FA 4LE5A 2VZEA 4BSZA 5AE3A 2VSQA 4DV0C 5T8SA 4JI0C 5BSTA 4D57A 1MDBA 3GR0A 1HH2P 1PA4A 4FUQA 1ML8A 1V25A 2ASBA 1XNRC 3LUSA 3CW8X 1WF3A 1N34C 4XX2A 2QW0X 4DCTA 2CY1A 5BUQA 4B3MC 3LAXA 2QVXX 3R44A 2UUBC 2ZM6C 2ATWA 3EERA 3NYQA 2YWBA 2QVZX 4YY3C 3LGXA 4MH4A 4DG9A 1RY2A 4DR7C 2E8FA 4LF5C 4GS5A 2BH1X 4BBYA 5ADZA 2QL8A 1USPB 5LMNC 3I07A 3UOWA 1O93A 5AE1A 1FUGA 4AQYC 3NPDA 1MD9A 1XMQC 3DHVA 5CZXA 4JI5C 4JI1C 4I9GA 4G37A 4DV1C 4GKJC 2YCBA 2YWCA 4RLFA 2P02A 3DLPX 3KXWA 4X66C 3AF5A 5E7QA 1FJGC 1T5HX 2UUCC 3J80D 2D7VA 2D1TA 2Y4NA 5A1GA 2E7GA 1YJ7A 4DV4C 3T1YC 2Y4OA 3GPCA 4KHPC 4B3SC 2BJOA 3E7WA 5KYVA 2AYAA 4B3TC 5K8FA 4EATA 2DYJA 4JI3C 1O90A 5BR8C 5IFIA 2PROA 1N36C 4NDNA 4DR4C 4DR2C 3NI2A 4D56A 4DV3C 4BC9A 3LNVA 5IWAC 1MKYA 4GXQA 1GPMA 3PBKA 4DR1C 4GKKC 5BSVA 4X65C 2OO4A 1N33C 1K0RA 4PHTA 4WS9A 1IBLC 1QM4A 3EQ6A 1HNXC 1RG9A 4LF6C 1N32C 1QWIA 4L2ZA 2F4VC 4G36A 1PG3A 2DPLA 4RM2A 2E8EA 4U5YD 4GXRA 4ISBA 1P7LA 2P2JA 4JI7C 4PZPA 4X62C 4RMNA 2PN2A 4DV2C 5FLXD 2D28C 4RVOA 2UUAC 4DCUA 4YHHC 1USPA 4DUYC 2OBVA 4DUZC 4R1MA 5BSRA 1PG4A 3SO4A 5BSUA 4WV3A 2UU9C 1XRCA 2Y27A 1HR0C 4BC7A 2P2MA 1WH9A 3GR1A 4G1IA 3RG2A 4HPVA 4BCAA 2V7BA 5BSWA 1MXCA 2P2FA 3IMLA 3IPLA 2E0GA 4JV5C 3I08A 4RLQA 3VNQA 4OX9C 4D4GA 4LFBC 4JI4C 4PROC 2OPLB 2KZFA 4DCVA 4I9FA 3UZ0A 3J81D 4RM3A 3H2TA 2P2QA 1ULTA 2P2BA 1XRBA 2UXCC 1JOSA 1T5DX 5JRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATW A;  1IBL C;  4NXM C;  4LFA C;  1HNX C;  1ZB8 A;  3EER A;  4LF6 C;  4YY3 C;  1N32 C;  4MH4 A;  1QWI A;  4LF7 C;  4DCS A;  2F4V C;  3GKU A;  4DR7 C;  2E8F A;  4X64 C;  2E8E A;  4LF5 C;  2ONF A;  2E5L C;  3R9X A;  2QL8 A;  1HNZ C;  1LQL A;  1USP B;  4JI6 C;  4JI7 C;  5LMN C;  4NOZ A;  3I07 A;  4DV6 C;  4DR3 C;  4X62 C;  2VQE C;  2PN2 A;  1UKK A;  4DV2 C;  4AQY C;  5FLX D;  4JYA C;  2CXC A;  4LF4 C;  1XMQ C;  1KKG A;  4LF8 C;  1VLA A;  4JI5 C;  4JI1 C;  2UUA C;  2OPL A;  3AF6 A;  4DCU A;  1I94 C;  4YHH C;  2HHH C;  4DV1 C;  1USP A;  4DUY C;  4GKJ C;  2YCB A;  2PT7 G;  4DUZ C;  4MTN A;  4X66 C;  4B3R C;  5IT9 D;  3AF5 A;  2UU9 C;  1FJG C;  5LMU C;  4LFC C;  1IBK C;  2UUC C;  1HR0 C;  3J80 D;  1XNQ C;  2VQF C;  2D7V A;  2EGT A;  1J5E C;  4DV5 C;  3IEU A;  2E7G A;  1WH9 A;  1XMO C;  4DV4 C;  3T1Y C;  3R9W A;  4K0K C;  1HNW C;  4DR6 C;  2UXB C;  4LF9 C;  2E8C A;  4KHP C;  4JI2 C;  2UXD C;  1ZB9 A;  4B3S C;  4DV7 C;  2BJO A;  1L2F A;  4B3T C;  1NYE A;  5A2Q D;  3CJE A;  2DYJ A;  4JV5 C;  4JI3 C;  4BSZ A;  4DR5 C;  5BR8 C;  1IBM C;  3OTO C;  4OX9 C;  4DV0 C;  4JI0 C;  1N36 C;  4DR4 C;  1EGA A;  4DR2 C;  4LFB C;  1HH2 P;  1PA4 A;  4JI4 C;  3JAM D;  3IEV A;  1ML8 A;  2ASB A;  2OPL B;  1N2F A;  1XNR C;  2KZF A;  3LUS A;  4DCV A;  4DV3 C;  2JMP A;  5IWA C;  3J81 D;  3T1H C;  1MKY A;  2HJG A;  1WF3 A;  1N34 C;  4XX2 A;  4DCT A;  4DR1 C;  4GKK C;  2UXC C;  1JOS A;  2CY1 A;  4X65 C;  4B3M C;  2XR1 A;  4NXN C;  1N33 C;  1K0R A;  2UUB C;  4JI8 C;  2ZM6 C; 
#chains in the Genus database with same CATH topology
 1AMU A;  4LFA C;  5CZV A;  1ZB8 A;  4OYC A;  3E7X A;  3TUF A;  2D1Q A;  5BUR A;  3GKU A;  3LNO A;  4X64 C;  2YX1 A;  4K0B A;  2ONF A;  2WD9 A;  3C5E A;  1XS3 A;  4JI6 C;  4DV6 C;  4DR3 C;  3A26 A;  2VQE C;  1UKK A;  1LCI A;  2CXC A;  4LF4 C;  1VLA A;  1XHJ A;  2OPL A;  4RVN A;  1IB8 A;  1I94 C;  5K85 A;  2HHH C;  3L95 X;  5BUS A;  3VNR A;  4MTN A;  4ODJ A;  1O92 A;  4PUG A;  3FCE A;  5IT9 D;  1WCJ A;  4D4I A;  1MXA A;  1IBK C;  1BA3 A;  3L8C A;  1J5E C;  3IEU A;  3R9W A;  4DR6 C;  2UXB C;  4LF9 C;  2E8C A;  4FUT A;  4JI2 C;  1ZB9 A;  3RV2 A;  4KTV A;  4DG8 A;  1NYE A;  5A2Q D;  3CJE A;  4OXI A;  1V60 A;  4DR5 C;  3A4I A;  1IBM C;  2P20 A;  3OTO C;  3FCC A;  4KTT A;  1EGA A;  3JAM D;  3IEV A;  1N2F A;  4IR7 A;  1TH5 A;  2JMP A;  5T8T A;  3A9U A;  2QVY X;  3CW9 A;  3T1H C;  2HJG A;  4R0M A;  1FLO A;  3CQ2 A;  1MXB A;  4FTF A;  4R1L A;  3A9V A;  4ZLP A;  3ETO A;  2XR1 A;  4NXN C;  2D1R A;  4JI8 C;  5A1I A;  3N2Q A;  4NXM C;  3S82 A;  3B7W A;  2ZZN A;  5KYT A;  5KEI A;  5AE2 A;  4LF7 C;  4TPS B;  4DCS A;  3O2E A;  5BSM A;  3VNS A;  3TQI A;  3R9X A;  2E5L C;  4L7I A;  3N54 B;  1HNZ C;  3ETC A;  1LQL A;  1V26 A;  5GTD A;  4NOZ A;  4JYA C;  1KKG A;  4LF8 C;  3NYR A;  3DAY A;  3G7S A;  5H9U A;  4JM1 A;  5A19 A;  3AF6 A;  4IZ6 A;  4L4Q A;  2WP0 C;  1O9T A;  2PT7 G;  1XRA A;  3PRO C;  4B3R C;  1MDF A;  2D27 A;  4ZJZ A;  5LMU C;  4LFC C;  2CU6 A;  1XNQ C;  3PES A;  5DV9 A;  2VQF C;  2EGT A;  4DV5 C;  2D1S A;  1XMO C;  4K0K C;  1HNW C;  3TDE A;  2UXD C;  4DV7 C;  1L2F A;  4LE5 A;  2VZE A;  1M6X A;  1NY8 A;  4BSZ A;  1M6X C;  5AE3 A;  2VSQ A;  4DV0 C;  5T8S A;  4JI0 C;  5BST A;  4D57 A;  1MDB A;  3GR0 A;  1HH2 P;  1PA4 A;  4FUQ A;  1ML8 A;  1V25 A;  2ASB A;  1XNR C;  3LUS A;  3CW8 X;  3AY0 A;  1WF3 A;  1N34 C;  4XX2 A;  2QW0 X;  4DCT A;  3UX2 A;  2CY1 A;  5BUQ A;  4B3M C;  3LAX A;  2QVX X;  3R44 A;  2UUB C;  2ZM6 C;  2ATW A;  3EER A;  3NYQ A;  2YWB A;  2QVZ X;  4YY3 C;  3LGX A;  4MH4 A;  4DG9 A;  3CQ1 A;  1RY2 A;  2DHM A;  4DR7 C;  2E8F A;  4LF5 C;  4GS5 A;  3UEB A;  2BH1 X;  4BBY A;  5ADZ A;  2QL8 A;  3K6R A;  1USP B;  5LMN C;  3I07 A;  3UOW A;  2Z51 A;  3UX3 A;  1O93 A;  5AE1 A;  1FUG A;  4AQY C;  3NPD A;  1MD9 A;  1XMQ C;  3DHV A;  5CZX A;  2MM9 A;  4JI5 C;  4JI1 C;  4I9G A;  4G37 A;  4DV1 C;  1PU1 A;  2ZZM A;  4GKJ C;  2YCB A;  2YWC A;  4RLF A;  2P02 A;  1VEH A;  3DLP X;  3KXW A;  4X66 C;  3AF5 A;  5E7Q A;  1FJG C;  1T5H X;  2UUC C;  2M5O A;  3J80 D;  2D7V A;  2D1T A;  2Y4N A;  4PUI A;  5A1G A;  2E7G A;  1YJ7 A;  4DV4 C;  3T1Y C;  2Y4O A;  3GPC A;  4KHP C;  4B3S C;  2BJO A;  3E7W A;  5KYV A;  2AYA A;  4B3T C;  5K8F A;  4EAT A;  2DYJ A;  4JI3 C;  1O90 A;  5BR8 C;  5IFI A;  2PRO A;  1N36 C;  4NDN A;  4DR4 C;  4DR2 C;  3NI2 A;  4D56 A;  1UWD A;  4DV3 C;  4BC9 A;  3LNV A;  5IWA C;  1MKY A;  4GXQ A;  2MMA B;  1GPM A;  4DR1 C;  3PBK A;  4GKK C;  5BSV A;  4X65 C;  2OO4 A;  1N33 C;  1K0R A;  4PHT A;  5LCI A;  4WS9 A;  1IBL C;  1QM4 A;  3EQ6 A;  1HNX C;  1RG9 A;  4LF6 C;  1N32 C;  3A25 A;  1QWI A;  4L2Z A;  2F4V C;  4G36 A;  1PG3 A;  2DPL A;  4RM2 A;  2KDN A;  2E8E A;  4U5Y D;  4GXR A;  4ISB A;  1P7L A;  2P2J A;  4JI7 C;  4PZP A;  4X62 C;  4RMN A;  2PN2 A;  4DV2 C;  5FLX D;  2D28 C;  4RVO A;  2UUA C;  4DCU A;  4YHH C;  1USP A;  4DUY C;  4PUH A;  2OBV A;  4DUZ C;  4R1M A;  2MCQ A;  5BSR A;  1PG4 A;  3SO4 A;  5BSU A;  4WV3 A;  2UU9 C;  1XRC A;  2KZ0 A;  2Y27 A;  1HR0 C;  4BC7 A;  2P2M A;  3CQ3 A;  1WH9 A;  3GR1 A;  4G1I A;  3RG2 A;  4HPV A;  4BCA A;  2V7B A;  5BSW A;  1MXC A;  2P2F A;  3IML A;  2M5H A;  3IPL A;  2E0G A;  4JV5 C;  3I08 A;  4RLQ A;  1P4E A;  3VNQ A;  2NCL A;  4OX9 C;  1P4E C;  4D4G A;  4LFB C;  4JI4 C;  4PRO C;  2OPL B;  2KZF A;  4DCV A;  3TR3 A;  4I9F A;  3UZ0 A;  3J81 D;  4RM3 A;  3H2T A;  2P2Q A;  1ULT A;  2P2B A;  2JNV A;  1XRB A;  2UXC C;  1JOS A;  1T5D X;  5JRH A; 
#chains in the Genus database with same CATH homology
 1AMU A;  4LFA C;  5CZV A;  1ZB8 A;  4OYC A;  3E7X A;  3TUF A;  2D1Q A;  5BUR A;  3GKU A;  4X64 C;  4K0B A;  2ONF A;  2WD9 A;  3C5E A;  4JI6 C;  4DV6 C;  4DR3 C;  2VQE C;  1UKK A;  1LCI A;  2CXC A;  4LF4 C;  1VLA A;  2OPL A;  4RVN A;  1I94 C;  5K85 A;  2HHH C;  3L95 X;  5BUS A;  3VNR A;  4MTN A;  4ODJ A;  1O92 A;  3FCE A;  5IT9 D;  4D4I A;  1MXA A;  1IBK C;  1BA3 A;  3L8C A;  1J5E C;  3IEU A;  3R9W A;  4DR6 C;  2UXB C;  4LF9 C;  2E8C A;  4FUT A;  4JI2 C;  1ZB9 A;  3RV2 A;  4KTV A;  4DG8 A;  1NYE A;  5A2Q D;  3CJE A;  4OXI A;  4DR5 C;  3A4I A;  1IBM C;  2P20 A;  3OTO C;  3FCC A;  4KTT A;  1EGA A;  3JAM D;  3IEV A;  1N2F A;  4IR7 A;  2JMP A;  5T8T A;  3A9U A;  3T1H C;  2QVY X;  3CW9 A;  2HJG A;  4R0M A;  1MXB A;  4FTF A;  4R1L A;  3A9V A;  4ZLP A;  3ETO A;  2XR1 A;  4NXN C;  2D1R A;  4JI8 C;  5A1I A;  3N2Q A;  4NXM C;  3S82 A;  3B7W A;  5KYT A;  5KEI A;  5AE2 A;  4LF7 C;  4TPS B;  4DCS A;  5BSM A;  3VNS A;  3TQI A;  3R9X A;  2E5L C;  4L7I A;  3N54 B;  1HNZ C;  3ETC A;  1LQL A;  1V26 A;  5GTD A;  4NOZ A;  4JYA C;  1KKG A;  4LF8 C;  3NYR A;  3DAY A;  3G7S A;  5H9U A;  4JM1 A;  5A19 A;  3AF6 A;  4IZ6 A;  4L4Q A;  2WP0 C;  1O9T A;  2PT7 G;  1XRA A;  3PRO C;  4B3R C;  1MDF A;  2D27 A;  4ZJZ A;  5LMU C;  4LFC C;  1XNQ C;  3PES A;  5DV9 A;  2VQF C;  2EGT A;  4DV5 C;  2D1S A;  1XMO C;  4K0K C;  1HNW C;  3TDE A;  2UXD C;  4DV7 C;  1L2F A;  4LE5 A;  2VZE A;  4BSZ A;  5AE3 A;  2VSQ A;  4DV0 C;  5T8S A;  4JI0 C;  5BST A;  4D57 A;  1MDB A;  3GR0 A;  1HH2 P;  1PA4 A;  4FUQ A;  1ML8 A;  1V25 A;  2ASB A;  1XNR C;  3LUS A;  3CW8 X;  1WF3 A;  1N34 C;  4XX2 A;  2QW0 X;  4DCT A;  2CY1 A;  5BUQ A;  4B3M C;  3LAX A;  2QVX X;  3R44 A;  2UUB C;  2ZM6 C;  2ATW A;  3EER A;  3NYQ A;  2YWB A;  2QVZ X;  4YY3 C;  3LGX A;  4MH4 A;  4DG9 A;  1RY2 A;  4DR7 C;  2E8F A;  4LF5 C;  4GS5 A;  2BH1 X;  4BBY A;  5ADZ A;  2QL8 A;  1USP B;  5LMN C;  3I07 A;  3UOW A;  1O93 A;  5AE1 A;  1FUG A;  4AQY C;  3NPD A;  1MD9 A;  1XMQ C;  3DHV A;  5CZX A;  4JI5 C;  4JI1 C;  4I9G A;  4G37 A;  4DV1 C;  4GKJ C;  2YCB A;  2YWC A;  4RLF A;  2P02 A;  3DLP X;  3KXW A;  4X66 C;  3AF5 A;  5E7Q A;  1FJG C;  1T5H X;  2UUC C;  3J80 D;  2D7V A;  2D1T A;  2Y4N A;  5A1G A;  2E7G A;  1YJ7 A;  4DV4 C;  3T1Y C;  2Y4O A;  3GPC A;  4KHP C;  4B3S C;  2BJO A;  3E7W A;  5KYV A;  2AYA A;  4B3T C;  5K8F A;  4EAT A;  2DYJ A;  4JI3 C;  1O90 A;  5BR8 C;  5IFI A;  2PRO A;  1N36 C;  4NDN A;  4DR4 C;  4DR2 C;  3NI2 A;  4D56 A;  4DV3 C;  4BC9 A;  3LNV A;  5IWA C;  1MKY A;  4GXQ A;  1GPM A;  3PBK A;  4DR1 C;  4GKK C;  5BSV A;  4X65 C;  2OO4 A;  1N33 C;  1K0R A;  4PHT A;  4WS9 A;  1IBL C;  1QM4 A;  3EQ6 A;  1HNX C;  1RG9 A;  4LF6 C;  1N32 C;  1QWI A;  4L2Z A;  2F4V C;  4G36 A;  1PG3 A;  2DPL A;  4RM2 A;  2E8E A;  4U5Y D;  4GXR A;  4ISB A;  1P7L A;  2P2J A;  4JI7 C;  4PZP A;  4X62 C;  4RMN A;  2PN2 A;  4DV2 C;  5FLX D;  2D28 C;  4RVO A;  2UUA C;  4DCU A;  4YHH C;  1USP A;  4DUY C;  2OBV A;  4DUZ C;  4R1M A;  5BSR A;  1PG4 A;  3SO4 A;  5BSU A;  4WV3 A;  2UU9 C;  1XRC A;  2Y27 A;  1HR0 C;  4BC7 A;  2P2M A;  1WH9 A;  3GR1 A;  4G1I A;  3RG2 A;  4HPV A;  4BCA A;  2V7B A;  5BSW A;  1MXC A;  2P2F A;  3IML A;  3IPL A;  2E0G A;  4JV5 C;  3I08 A;  4RLQ A;  3VNQ A;  4OX9 C;  4D4G A;  4LFB C;  4JI4 C;  4PRO C;  2OPL B;  2KZF A;  4DCV A;  4I9F A;  3UZ0 A;  3J81 D;  4RM3 A;  3H2T A;  2P2Q A;  1ULT A;  2P2B A;  1XRB A;  2UXC C;  1JOS A;  1T5D X;  5JRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...