1QWIA

Crystal structure of e. coli osmc
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
b'TIHKKGQAHWESDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords osmotically inducible protein
publication title Structural and functional features of the Escherichia coli hydroperoxide resistance protein OsmC
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydroperoxide reductase
total genus 37
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1qwiA00
4NOZA 4DV4C 4OX9C 1FJGC 1LQLA 4DV3C 1HR0C 4DV0C 4X66C 1XNQC 1HH2P 2KZFA 2JMPA 2OPLB 4B3MC 4JI0C 2PT7G 1XMQC 4LFBC 4GKKC 5IT9D 2ASBA 2E8EA 1K0RA 1USPA 1IBMC 3T1HC 2E5LC 4JI7C 1KKGA 4DV2C 4B3SC 4JI1C 4JI3C 3EERA 4DCSA 2HHHC 4LF7C 1HNWC 2E7GA 4LF6C 4X65C 5LMNC 1ZB8A 3AF5A 3CJEA 3I07A 1N36C 2OPLA 2E8CA 1XMOC 2D7VA 2UUBC 4B3TC 3IEUA 2YCBA 4DR5C 4KHPC 1HNZC 3R9XA 4DCTA 4JYAC 2HJGA 1UKKA 2UXBC 3T1YC 1N2FA 4JI4C 2CXCA 5IWAC 4LF9C 5A2QD 1N34C 2ZM6C 2VQEC 2F4VC 5BR8C 2XR1A 1XNRC 2UUCC 4LF8C 4DR3C 1PA4A 1IBKC 4DCVA 4DUYC 4BSZA 1EGAA 2BJOA 1L2FA 3OTOC 4AQYC 3GKUA 4JI5C 4MH4A 4DCUA 4K0KC 4DV5C 2DYJA 4DV7C 2E8FA 4YHHC 2UU9C 5FLXD 1N33C 1ML8A 2QL8A 4DR1C 4LF4C 4DR7C 4JV5C 3JAMD 1MKYA 4DV1C 4DV6C 3J81D 2PN2A 4GKJC 4MTNA 3AF6A 4DUZC 4DR4C 4DR6C 1NYEA 1HNXC 2EGTA 4JI8C 4X64C 2VQFC 2UUAC 3IEVA 4LF5C 4YY3C 1J5EC 3LUSA 4LFAC 1VLAA 1I94C 1WH9A 4XX2A 4JI2C 5LMUC 2UXCC 4NXNC 1QWIA 3J80D 1JOSA 4JI6C 2ATWA 3R9WA 1ZB9A 2CY1A 1N32C 4X62C 4LFCC 4NXMC 2UXDC 1USPB 1WF3A 1IBLC 2ONFA 4DR2C 4B3RC
chains in the Genus database with same CATH superfamily
4NOZA 1FJGC 2VSQA 4DV3C 1HH2P 2KZFA 2JMPA 2OPLB 3CQ3A 2ZZNA 4RMNA 4D4GA 5IT9D 2D27A 4PROC 4K0BA 4R0MA 3I08A 4DV2C 4JI1C 3NPDA 1QM4A 5LMNC 3AF5A 5CZVA 3UX3A 4RVOA 1N36C 4L7IA 2D7VA 2QVZX 1T5DX 2DPLA 4G1IA 3IEUA 2WD9A 4JYAC 1UKKA 4JI4C 5IWAC 3R44A 1N34C 3PBKA 2XR1A 1BA3A 1PA4A 3S82A 2P2JA 4FUQA 3UZ0A 2BJOA 3OTOC 3TUFA 2Y27A 4PHTA 1V25A 1T5HX 2CU6A 4I9GA 5BSMA 1P4EA 4LF4C 5K85A 4DR7C 4JV5C 3FCCA 2OBVA 1MKYA 3A26A 1WCJA 2MCQA 3J81D 4D57A 4GKJC 1NYEA 1XRBA 2EGTA 4JI8C 3LNVA 1PG3A 2MM9A 3DHVA 4PZPA 3LUSA 1VLAA 3N2QA 4XX2A 4ZLPA 4JI2C 5LMUC 4FTFA 1RY2A 1JOSA 5A19A 4JI6C 2ATWA 3IMLA 3R9WA 2CY1A 4G36A 4X62C 2UXDC 1IBLC 4DR2C 4D56A 4DV4C 5BUQA 1LQLA 4U5YD 1VEHA 4JI0C 2AYAA 4PUHA 2OO4A 1XMQC 3GPCA 2VZEA 5T8TA 4LFBC 4GKKC 2ASBA 3LNOA 2QVXX 4JI7C 3T1HC 2E5LC 4B3SC 4LF7C 3EERA 2HHHC 1HNWC 2E7GA 4LF6C 4RLFA 3CQ2A 4LE5A 5T8SA 3EQ6A 2E8CA 1M6XA 2UUBC 2NCLA 3CQ1A 2Z51A 3N54B 4DR5C 3R9XA 4DCTA 1O92A 3T1YC 1N2FA 4D4IA 4LF9C 3ETOA 5BSUA 3UOWA 4LF8C 2E0GA 4BSZA 4GS5A 1AMUA 4DG9A 2YX1A 3GKUA 4JI5C 3C5EA 5CZXA 2DYJA 4NDNA 1NY8A 5FLXD 2P2QA 1N33C 1ML8A 5BSRA 2KDNA 2BH1X 3AY0A 1GPMA 4BCAA 5BSVA 4DR4C 4DR6C 4X64C 4G37A 4PUIA 5BSWA 3IEVA 3TDEA 4OYCA 4YY3C 5KEIA 2WP0C 3ETCA 1P4EC 3DAYA 5ADZA 1V26A 4RM3A 3J80D 3VNSA 5H9UA 2DHMA 3FCEA 4WV3A 1PU1A 1WF3A 4B3RC 4RLQA 1YJ7A 1V60A 1HR0C 4DV0C 4KTTA 1TH5A 2V7BA 1XNQC 3RV2A 2Y4NA 3A4IA 1K0RA 2YWBA 3NI2A 4GXRA 1O9TA 1IBMC 1KKGA 5LCIA 1XHJA 2D1RA 3L95X 5BUSA 3A25A 1ZB8A 3CJEA 3RG2A 4ISBA 3G7SA 3O2EA 1MD9A 2PROA 1MXAA 4KHPC 1MXBA 4BBYA 1O90A 1XS3A 2HJGA 2QW0X 4TPSB 5GTDA 3GR1A 2JNVA 5KYVA 5A2QD 2ZM6C 2F4VC 3E7XA 4ZJZA 2M5HA 1UWDA 1XNRC 2M5OA 3VNRA 2ZZMA 1FUGA 4KTVA 4DR3C 1IBKC 4DCVA 1EGAA 3PROC 1L2FA 2D1QA 4PUGA 4DCUA 3SO4A 4K0KC 3CW9A 2E8FA 2D28C 3TQIA 2QL8A 3E7WA 2P2FA 2P2MA 3H2TA 4RVNA 1XRAA 1FLOA 1MXCA 2PN2A 1RG9A 4ODJA 1MDBA 2VQFC 3UEBA 1J5EC 4LFAC 1LCIA 4NXNC 1O93A 3CW8X 3B7WA 2YWCA 4L2ZA 5A1IA 2MMAB 1ZB9A 1N32C 4NXMC 2ONFA 1XRCA 4RM2A 4OX9C 1MDFA 5DV9A 3NYQA 4X66C 4FUTA 5K8FA 3IPLA 4B3MC 5KYTA 1P7LA 5AE3A 2PT7G 3NYRA 2E8EA 1USPA 4I9FA 4JI3C 2D1TA 4DCSA 5A1GA 4WS9A 4X65C 3I07A 2P20A 2OPLA 1XMOC 1ULTA 4B3TC 2YCBA 4DG8A 1HNZC 2UXBC 2CXCA 3GR0A 4BC7A 2VQEC 5BR8C 2UUCC 4DUYC 5BURA 4AQYC 3DLPX 4L4QA 4HPVA 3VNQA 4MH4A 3PESA 4DV5C 4R1MA 4BC9A 4DV7C 4YHHC 1IB8A 2UU9C 4DR1C 3KXWA 3L8CA 3JAMD 4EATA 4DV1C 4DV6C 5BSTA 3TR3A 4MTNA 4GXQA 3AF6A 4DUZC 5IFIA 1HNXC 3A9UA 2UUAC 2KZ0A 2Y4OA 3K6RA 5E7QA 3A9VA 4LF5C 1M6XC 2QVYX 1I94C 1WH9A 4OXIA 2D1SA 2UXCC 4IZ6A 3LAXA 1QWIA 4JM1A 4IR7A 2P2BA 2P02A 1PG4A 5AE2A 4LFCC 3UX2A 1USPB 5JRHA 3LGXA 5AE1A 4R1LA
chains in the Genus database with same CATH topology
4NOZA 1FJGC 2VSQA 4DV3C 1HH2P 2KZFA 2JMPA 2OPLB 4RMNA 4D4GA 5IT9D 2D27A 4PROC 4K0BA 4R0MA 3I08A 4DV2C 4JI1C 3NPDA 1QM4A 5LMNC 3AF5A 5CZVA 4RVOA 1N36C 4L7IA 2D7VA 2QVZX 1T5DX 2DPLA 4G1IA 3IEUA 2WD9A 4JYAC 1UKKA 4JI4C 5IWAC 3R44A 1N34C 3PBKA 2XR1A 1BA3A 1PA4A 3S82A 2P2JA 4FUQA 3UZ0A 2BJOA 3OTOC 3TUFA 2Y27A 4PHTA 1V25A 1T5HX 4I9GA 5BSMA 4LF4C 5K85A 4DR7C 4JV5C 3FCCA 2OBVA 1MKYA 3J81D 4D57A 4GKJC 1NYEA 1XRBA 2EGTA 4JI8C 3LNVA 1PG3A 3DHVA 4PZPA 3LUSA 1VLAA 3N2QA 4XX2A 4ZLPA 4JI2C 5LMUC 4FTFA 1RY2A 1JOSA 5A19A 4JI6C 2ATWA 3IMLA 3R9WA 2CY1A 4G36A 4X62C 2UXDC 1IBLC 4DR2C 4D56A 4DV4C 5BUQA 1LQLA 4U5YD 4JI0C 2AYAA 2OO4A 1XMQC 3GPCA 2VZEA 5T8TA 4LFBC 4GKKC 2ASBA 2QVXX 4JI7C 3T1HC 2E5LC 4B3SC 4LF7C 3EERA 2HHHC 1HNWC 2E7GA 4LF6C 4RLFA 4LE5A 5T8SA 3EQ6A 2E8CA 2UUBC 3N54B 4DR5C 3R9XA 4DCTA 1O92A 3T1YC 1N2FA 4D4IA 4LF9C 3ETOA 5BSUA 3UOWA 4LF8C 2E0GA 4BSZA 4GS5A 1AMUA 4DG9A 3GKUA 4JI5C 3C5EA 5CZXA 2DYJA 4NDNA 5FLXD 2P2QA 1N33C 1ML8A 5BSRA 2BH1X 1GPMA 4BCAA 5BSVA 4DR4C 4DR6C 4X64C 4G37A 5BSWA 3IEVA 3TDEA 4OYCA 4YY3C 5KEIA 2WP0C 3ETCA 3DAYA 5ADZA 1V26A 4RM3A 3J80D 3VNSA 5H9UA 3FCEA 4WV3A 1WF3A 4B3RC 4RLQA 1YJ7A 1HR0C 4DV0C 4KTTA 2V7BA 1XNQC 3RV2A 2Y4NA 3A4IA 1K0RA 2YWBA 3NI2A 4GXRA 1O9TA 1IBMC 1KKGA 2D1RA 3L95X 5BUSA 1ZB8A 3CJEA 3RG2A 4ISBA 3G7SA 1MD9A 2PROA 1MXAA 4KHPC 1MXBA 4BBYA 1O90A 2HJGA 2QW0X 4TPSB 5GTDA 3GR1A 5KYVA 5A2QD 2ZM6C 2F4VC 3E7XA 4ZJZA 1XNRC 3VNRA 1FUGA 4KTVA 4DR3C 1IBKC 4DCVA 1EGAA 3PROC 1L2FA 2D1QA 4DCUA 3SO4A 4K0KC 3CW9A 2E8FA 2D28C 3TQIA 2QL8A 3E7WA 2P2FA 2P2MA 3H2TA 4RVNA 1XRAA 1MXCA 2PN2A 1RG9A 4ODJA 1MDBA 2VQFC 1J5EC 4LFAC 1LCIA 4NXNC 1O93A 3CW8X 3B7WA 2YWCA 4L2ZA 5A1IA 1ZB9A 1N32C 4NXMC 2ONFA 1XRCA 4RM2A 4OX9C 1MDFA 5DV9A 3NYQA 4X66C 4FUTA 5K8FA 3IPLA 4B3MC 5KYTA 1P7LA 5AE3A 2PT7G 3NYRA 2E8EA 1USPA 4I9FA 4JI3C 2D1TA 4DCSA 5A1GA 4WS9A 4X65C 3I07A 2P20A 2OPLA 1XMOC 1ULTA 4B3TC 2YCBA 4DG8A 1HNZC 2UXBC 2CXCA 3GR0A 4BC7A 2VQEC 5BR8C 2UUCC 4DUYC 5BURA 4AQYC 3DLPX 4L4QA 4HPVA 3VNQA 4MH4A 3PESA 4DV5C 4R1MA 4BC9A 4DV7C 4YHHC 2UU9C 4DR1C 3KXWA 3L8CA 3JAMD 4EATA 4DV1C 4DV6C 5BSTA 4MTNA 4GXQA 3AF6A 4DUZC 5IFIA 1HNXC 3A9UA 2UUAC 2Y4OA 5E7QA 3A9VA 4LF5C 2QVYX 1I94C 1WH9A 4OXIA 2D1SA 2UXCC 4IZ6A 3LAXA 1QWIA 4JM1A 4IR7A 2P2BA 2P02A 1PG4A 5AE2A 4LFCC 1USPB 5JRHA 3LGXA 5AE1A 4R1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  4DV4 C;  4OX9 C;  1FJG C;  1LQL A;  4DV3 C;  1HR0 C;  4DV0 C;  4X66 C;  1XNQ C;  1HH2 P;  2KZF A;  2JMP A;  2OPL B;  4B3M C;  4JI0 C;  2PT7 G;  1XMQ C;  4LFB C;  4GKK C;  5IT9 D;  2ASB A;  2E8E A;  1K0R A;  1USP A;  1IBM C;  3T1H C;  2E5L C;  4JI7 C;  1KKG A;  4DV2 C;  4B3S C;  4JI1 C;  4JI3 C;  3EER A;  4DCS A;  2HHH C;  4LF7 C;  1HNW C;  2E7G A;  4LF6 C;  4X65 C;  5LMN C;  1ZB8 A;  3AF5 A;  3CJE A;  3I07 A;  1N36 C;  2OPL A;  2E8C A;  1XMO C;  2D7V A;  2UUB C;  4B3T C;  3IEU A;  2YCB A;  4DR5 C;  4KHP C;  1HNZ C;  3R9X A;  4DCT A;  4JYA C;  2HJG A;  1UKK A;  2UXB C;  3T1Y C;  1N2F A;  4JI4 C;  2CXC A;  5IWA C;  4LF9 C;  5A2Q D;  1N34 C;  2ZM6 C;  2VQE C;  2F4V C;  5BR8 C;  2XR1 A;  1XNR C;  2UUC C;  4LF8 C;  4DR3 C;  1PA4 A;  1IBK C;  4DCV A;  4DUY C;  4BSZ A;  1EGA A;  2BJO A;  1L2F A;  3OTO C;  4AQY C;  3GKU A;  4JI5 C;  4MH4 A;  4DCU A;  4K0K C;  4DV5 C;  2DYJ A;  4DV7 C;  2E8F A;  4YHH C;  2UU9 C;  5FLX D;  1N33 C;  1ML8 A;  2QL8 A;  4DR1 C;  4LF4 C;  4DR7 C;  4JV5 C;  3JAM D;  1MKY A;  4DV1 C;  4DV6 C;  3J81 D;  2PN2 A;  4GKJ C;  4MTN A;  3AF6 A;  4DUZ C;  4DR4 C;  4DR6 C;  1NYE A;  1HNX C;  2EGT A;  4JI8 C;  4X64 C;  2VQF C;  2UUA C;  3IEV A;  4LF5 C;  4YY3 C;  1J5E C;  3LUS A;  4LFA C;  1VLA A;  1I94 C;  1WH9 A;  4XX2 A;  4JI2 C;  5LMU C;  2UXC C;  4NXN C;  1QWI A;  3J80 D;  1JOS A;  4JI6 C;  2ATW A;  3R9W A;  1ZB9 A;  2CY1 A;  1N32 C;  4X62 C;  4LFC C;  4NXM C;  2UXD C;  1USP B;  1WF3 A;  1IBL C;  2ONF A;  4DR2 C;  4B3R C; 
#chains in the Genus database with same CATH topology
 4NOZ A;  1FJG C;  2VSQ A;  4DV3 C;  1HH2 P;  2KZF A;  2JMP A;  2OPL B;  3CQ3 A;  2ZZN A;  4RMN A;  4D4G A;  5IT9 D;  2D27 A;  4PRO C;  4K0B A;  4R0M A;  3I08 A;  4DV2 C;  4JI1 C;  3NPD A;  1QM4 A;  5LMN C;  3AF5 A;  5CZV A;  3UX3 A;  4RVO A;  1N36 C;  4L7I A;  2D7V A;  2QVZ X;  1T5D X;  2DPL A;  4G1I A;  3IEU A;  2WD9 A;  4JYA C;  1UKK A;  4JI4 C;  5IWA C;  3R44 A;  1N34 C;  3PBK A;  2XR1 A;  1BA3 A;  1PA4 A;  3S82 A;  2P2J A;  4FUQ A;  3UZ0 A;  2BJO A;  3OTO C;  3TUF A;  2Y27 A;  4PHT A;  1V25 A;  1T5H X;  2CU6 A;  4I9G A;  5BSM A;  1P4E A;  4LF4 C;  5K85 A;  4DR7 C;  4JV5 C;  3FCC A;  2OBV A;  1MKY A;  3A26 A;  1WCJ A;  2MCQ A;  3J81 D;  4D57 A;  4GKJ C;  1NYE A;  1XRB A;  2EGT A;  4JI8 C;  3LNV A;  1PG3 A;  2MM9 A;  3DHV A;  4PZP A;  3LUS A;  1VLA A;  3N2Q A;  4XX2 A;  4ZLP A;  4JI2 C;  5LMU C;  4FTF A;  1RY2 A;  1JOS A;  5A19 A;  4JI6 C;  2ATW A;  3IML A;  3R9W A;  2CY1 A;  4G36 A;  4X62 C;  2UXD C;  1IBL C;  4DR2 C;  4D56 A;  4DV4 C;  5BUQ A;  1LQL A;  4U5Y D;  1VEH A;  4JI0 C;  2AYA A;  4PUH A;  2OO4 A;  1XMQ C;  3GPC A;  2VZE A;  5T8T A;  4LFB C;  4GKK C;  2ASB A;  3LNO A;  2QVX X;  4JI7 C;  3T1H C;  2E5L C;  4B3S C;  4LF7 C;  3EER A;  2HHH C;  1HNW C;  2E7G A;  4LF6 C;  4RLF A;  3CQ2 A;  4LE5 A;  5T8S A;  3EQ6 A;  2E8C A;  1M6X A;  2UUB C;  2NCL A;  3CQ1 A;  2Z51 A;  3N54 B;  4DR5 C;  3R9X A;  4DCT A;  1O92 A;  3T1Y C;  1N2F A;  4D4I A;  4LF9 C;  3ETO A;  5BSU A;  3UOW A;  4LF8 C;  2E0G A;  4BSZ A;  4GS5 A;  1AMU A;  4DG9 A;  2YX1 A;  3GKU A;  4JI5 C;  3C5E A;  5CZX A;  2DYJ A;  4NDN A;  1NY8 A;  5FLX D;  2P2Q A;  1N33 C;  1ML8 A;  5BSR A;  2KDN A;  2BH1 X;  3AY0 A;  1GPM A;  4BCA A;  5BSV A;  4DR4 C;  4DR6 C;  4X64 C;  4G37 A;  4PUI A;  5BSW A;  3IEV A;  3TDE A;  4OYC A;  4YY3 C;  5KEI A;  2WP0 C;  3ETC A;  1P4E C;  3DAY A;  5ADZ A;  1V26 A;  4RM3 A;  3J80 D;  3VNS A;  5H9U A;  2DHM A;  3FCE A;  4WV3 A;  1PU1 A;  1WF3 A;  4B3R C;  4RLQ A;  1YJ7 A;  1V60 A;  1HR0 C;  4DV0 C;  4KTT A;  1TH5 A;  2V7B A;  1XNQ C;  3RV2 A;  2Y4N A;  3A4I A;  1K0R A;  2YWB A;  3NI2 A;  4GXR A;  1O9T A;  1IBM C;  1KKG A;  5LCI A;  1XHJ A;  2D1R A;  3L95 X;  5BUS A;  3A25 A;  1ZB8 A;  3CJE A;  3RG2 A;  4ISB A;  3G7S A;  3O2E A;  1MD9 A;  2PRO A;  1MXA A;  4KHP C;  1MXB A;  4BBY A;  1O90 A;  1XS3 A;  2HJG A;  2QW0 X;  4TPS B;  5GTD A;  3GR1 A;  2JNV A;  5KYV A;  5A2Q D;  2ZM6 C;  2F4V C;  3E7X A;  4ZJZ A;  2M5H A;  1UWD A;  1XNR C;  2M5O A;  3VNR A;  2ZZM A;  1FUG A;  4KTV A;  4DR3 C;  1IBK C;  4DCV A;  1EGA A;  3PRO C;  1L2F A;  2D1Q A;  4PUG A;  4DCU A;  3SO4 A;  4K0K C;  3CW9 A;  2E8F A;  2D28 C;  3TQI A;  2QL8 A;  3E7W A;  2P2F A;  2P2M A;  3H2T A;  4RVN A;  1XRA A;  1FLO A;  1MXC A;  2PN2 A;  1RG9 A;  4ODJ A;  1MDB A;  2VQF C;  3UEB A;  1J5E C;  4LFA C;  1LCI A;  4NXN C;  1O93 A;  3CW8 X;  3B7W A;  2YWC A;  4L2Z A;  5A1I A;  2MMA B;  1ZB9 A;  1N32 C;  4NXM C;  2ONF A;  1XRC A;  4RM2 A;  4OX9 C;  1MDF A;  5DV9 A;  3NYQ A;  4X66 C;  4FUT A;  5K8F A;  3IPL A;  4B3M C;  5KYT A;  1P7L A;  5AE3 A;  2PT7 G;  3NYR A;  2E8E A;  1USP A;  4I9F A;  4JI3 C;  2D1T A;  4DCS A;  5A1G A;  4WS9 A;  4X65 C;  3I07 A;  2P20 A;  2OPL A;  1XMO C;  1ULT A;  4B3T C;  2YCB A;  4DG8 A;  1HNZ C;  2UXB C;  2CXC A;  3GR0 A;  4BC7 A;  2VQE C;  5BR8 C;  2UUC C;  4DUY C;  5BUR A;  4AQY C;  3DLP X;  4L4Q A;  4HPV A;  3VNQ A;  4MH4 A;  3PES A;  4DV5 C;  4R1M A;  4BC9 A;  4DV7 C;  4YHH C;  1IB8 A;  2UU9 C;  4DR1 C;  3KXW A;  3L8C A;  3JAM D;  4EAT A;  4DV1 C;  4DV6 C;  5BST A;  3TR3 A;  4MTN A;  4GXQ A;  3AF6 A;  4DUZ C;  5IFI A;  1HNX C;  3A9U A;  2UUA C;  2KZ0 A;  2Y4O A;  3K6R A;  5E7Q A;  3A9V A;  4LF5 C;  1M6X C;  2QVY X;  1I94 C;  1WH9 A;  4OXI A;  2D1S A;  2UXC C;  4IZ6 A;  3LAX A;  1QWI A;  4JM1 A;  4IR7 A;  2P2B A;  2P02 A;  1PG4 A;  5AE2 A;  4LFC C;  3UX2 A;  1USP B;  5JRH A;  3LGX A;  5AE1 A;  4R1L A; 
#chains in the Genus database with same CATH homology
 4NOZ A;  1FJG C;  2VSQ A;  4DV3 C;  1HH2 P;  2KZF A;  2JMP A;  2OPL B;  4RMN A;  4D4G A;  5IT9 D;  2D27 A;  4PRO C;  4K0B A;  4R0M A;  3I08 A;  4DV2 C;  4JI1 C;  3NPD A;  1QM4 A;  5LMN C;  3AF5 A;  5CZV A;  4RVO A;  1N36 C;  4L7I A;  2D7V A;  2QVZ X;  1T5D X;  2DPL A;  4G1I A;  3IEU A;  2WD9 A;  4JYA C;  1UKK A;  4JI4 C;  5IWA C;  3R44 A;  1N34 C;  3PBK A;  2XR1 A;  1BA3 A;  1PA4 A;  3S82 A;  2P2J A;  4FUQ A;  3UZ0 A;  2BJO A;  3OTO C;  3TUF A;  2Y27 A;  4PHT A;  1V25 A;  1T5H X;  4I9G A;  5BSM A;  4LF4 C;  5K85 A;  4DR7 C;  4JV5 C;  3FCC A;  2OBV A;  1MKY A;  3J81 D;  4D57 A;  4GKJ C;  1NYE A;  1XRB A;  2EGT A;  4JI8 C;  3LNV A;  1PG3 A;  3DHV A;  4PZP A;  3LUS A;  1VLA A;  3N2Q A;  4XX2 A;  4ZLP A;  4JI2 C;  5LMU C;  4FTF A;  1RY2 A;  1JOS A;  5A19 A;  4JI6 C;  2ATW A;  3IML A;  3R9W A;  2CY1 A;  4G36 A;  4X62 C;  2UXD C;  1IBL C;  4DR2 C;  4D56 A;  4DV4 C;  5BUQ A;  1LQL A;  4U5Y D;  4JI0 C;  2AYA A;  2OO4 A;  1XMQ C;  3GPC A;  2VZE A;  5T8T A;  4LFB C;  4GKK C;  2ASB A;  2QVX X;  4JI7 C;  3T1H C;  2E5L C;  4B3S C;  4LF7 C;  3EER A;  2HHH C;  1HNW C;  2E7G A;  4LF6 C;  4RLF A;  4LE5 A;  5T8S A;  3EQ6 A;  2E8C A;  2UUB C;  3N54 B;  4DR5 C;  3R9X A;  4DCT A;  1O92 A;  3T1Y C;  1N2F A;  4D4I A;  4LF9 C;  3ETO A;  5BSU A;  3UOW A;  4LF8 C;  2E0G A;  4BSZ A;  4GS5 A;  1AMU A;  4DG9 A;  3GKU A;  4JI5 C;  3C5E A;  5CZX A;  2DYJ A;  4NDN A;  5FLX D;  2P2Q A;  1N33 C;  1ML8 A;  5BSR A;  2BH1 X;  1GPM A;  4BCA A;  5BSV A;  4DR4 C;  4DR6 C;  4X64 C;  4G37 A;  5BSW A;  3IEV A;  3TDE A;  4OYC A;  4YY3 C;  5KEI A;  2WP0 C;  3ETC A;  3DAY A;  5ADZ A;  1V26 A;  4RM3 A;  3J80 D;  3VNS A;  5H9U A;  3FCE A;  4WV3 A;  1WF3 A;  4B3R C;  4RLQ A;  1YJ7 A;  1HR0 C;  4DV0 C;  4KTT A;  2V7B A;  1XNQ C;  3RV2 A;  2Y4N A;  3A4I A;  1K0R A;  2YWB A;  3NI2 A;  4GXR A;  1O9T A;  1IBM C;  1KKG A;  2D1R A;  3L95 X;  5BUS A;  1ZB8 A;  3CJE A;  3RG2 A;  4ISB A;  3G7S A;  1MD9 A;  2PRO A;  1MXA A;  4KHP C;  1MXB A;  4BBY A;  1O90 A;  2HJG A;  2QW0 X;  4TPS B;  5GTD A;  3GR1 A;  5KYV A;  5A2Q D;  2ZM6 C;  2F4V C;  3E7X A;  4ZJZ A;  1XNR C;  3VNR A;  1FUG A;  4KTV A;  4DR3 C;  1IBK C;  4DCV A;  1EGA A;  3PRO C;  1L2F A;  2D1Q A;  4DCU A;  3SO4 A;  4K0K C;  3CW9 A;  2E8F A;  2D28 C;  3TQI A;  2QL8 A;  3E7W A;  2P2F A;  2P2M A;  3H2T A;  4RVN A;  1XRA A;  1MXC A;  2PN2 A;  1RG9 A;  4ODJ A;  1MDB A;  2VQF C;  1J5E C;  4LFA C;  1LCI A;  4NXN C;  1O93 A;  3CW8 X;  3B7W A;  2YWC A;  4L2Z A;  5A1I A;  1ZB9 A;  1N32 C;  4NXM C;  2ONF A;  1XRC A;  4RM2 A;  4OX9 C;  1MDF A;  5DV9 A;  3NYQ A;  4X66 C;  4FUT A;  5K8F A;  3IPL A;  4B3M C;  5KYT A;  1P7L A;  5AE3 A;  2PT7 G;  3NYR A;  2E8E A;  1USP A;  4I9F A;  4JI3 C;  2D1T A;  4DCS A;  5A1G A;  4WS9 A;  4X65 C;  3I07 A;  2P20 A;  2OPL A;  1XMO C;  1ULT A;  4B3T C;  2YCB A;  4DG8 A;  1HNZ C;  2UXB C;  2CXC A;  3GR0 A;  4BC7 A;  2VQE C;  5BR8 C;  2UUC C;  4DUY C;  5BUR A;  4AQY C;  3DLP X;  4L4Q A;  4HPV A;  3VNQ A;  4MH4 A;  3PES A;  4DV5 C;  4R1M A;  4BC9 A;  4DV7 C;  4YHH C;  2UU9 C;  4DR1 C;  3KXW A;  3L8C A;  3JAM D;  4EAT A;  4DV1 C;  4DV6 C;  5BST A;  4MTN A;  4GXQ A;  3AF6 A;  4DUZ C;  5IFI A;  1HNX C;  3A9U A;  2UUA C;  2Y4O A;  5E7Q A;  3A9V A;  4LF5 C;  2QVY X;  1I94 C;  1WH9 A;  4OXI A;  2D1S A;  2UXC C;  4IZ6 A;  3LAX A;  1QWI A;  4JM1 A;  4IR7 A;  2P2B A;  2P02 A;  1PG4 A;  5AE2 A;  4LFC C;  1USP B;  5JRH A;  3LGX A;  5AE1 A;  4R1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...