1QWIA

Crystal structure of e. coli osmc
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
TIHKKGQAHWESDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords osmotically inducible protein
publication title Structural and functional features of the Escherichia coli hydroperoxide resistance protein OsmC
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydroperoxide reductase
total genus 37
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1qwiA00
2UU9C 4JI0C 4BSZA 1ZB9A 4DV7C 5BR8C 5FLXD 1J5EC 5IWAC 1N32C 4JI7C 4DCSA 4LFBC 1XNRC 2EGTA 1JOSA 4LF9C 2OPLA 4DV1C 4YHHC 4DV3C 2F4VC 3J81D 3I07A 4B3SC 4DV6C 4NXNC 4JV5C 4DV5C 4LF6C 1NYEA 4JI5C 1XNQC 1VLAA 4JI6C 4YY3C 4DR3C 4DR6C 3IEVA 2UXBC 4DR2C 1XMOC 2ATWA 4DCVA 2PN2A 4DCTA 4MTNA 2CXCA 4OX9C 2E8CA 2XR1A 4B3TC 3AF6A 2UXCC 4DV4C 2KZFA 2UUCC 4DR4C 1I94C 1N2FA 1WH9A 4LF7C 1HR0C 4DR1C 1USPA 1K0RA 4MH4A 4JI3C 3GKUA 4GKKC 4KHPC 2E8EA 4DV0C 4DCUA 2CY1A 4JI8C 3T1YC 4K0KC 4B3MC 4JI1C 1QWIA 4LFAC 2DYJA 4NXMC 2ASBA 1EGAA 4GKJC 2E8FA 3AF5A 1PA4A 1IBMC 4B3RC 1ZB8A 1KKGA 1HNXC 5A2QD 2UXDC 3R9WA 3IEUA 4LFCC 2E5LC 1FJGC 2YCBA 2UUBC 4DV2C 5LMNC 3JAMD 3T1HC 4DR7C 4NOZA 2PT7G 2BJOA 4JYAC 3R9XA 2HHHC 2ZM6C 1MKYA 5LMUC 1N33C 4X64C 4DR5C 1LQLA 4LF8C 4X62C 4XX2A 1ML8A 4LF4C 2ONFA 2OPLB 1N36C 2HJGA 3J80D 3EERA 2VQFC 4DUZC 4AQYC 1HNZC 1N34C 1USPB 1UKKA 1WF3A 4JI4C 2D7VA 1IBLC 4LF5C 4X65C 3CJEA 3OTOC 4JI2C 2UUAC 5IT9D 4DUYC 2QL8A 1L2FA 2VQEC 4X66C 1XMQC 1IBKC 1HH2P 3LUSA 1HNWC 2JMPA 2E7GA
chains in the Genus database with same CATH superfamily
2DHMA 4JI0C 4ZJZA 5BR8C 1J5EC 2P02A 4DCSA 4LFBC 1XNRC 2YWBA 3S82A 2P2JA 4IZ6A 1XRCA 2P2QA 1JOSA 3E7XA 4RM2A 3B7WA 4YHHC 4DV3C 4G1IA 3J81D 5BUSA 4B3SC 1NYEA 4JI5C 1XNQC 5BUQA 2D1SA 1P4EC 2MCQA 4R1LA 5E7QA 4G37A 4BC9A 4GS5A 1XS3A 3TQIA 4PROC 4B3TC 2D1RA 2KZFA 4FTFA 4DR4C 1IB8A 1N2FA 3ETCA 1HR0C 1M6XA 4RVNA 4D4IA 3GKUA 4K0BA 3O2EA 4LFAC 2DYJA 4GKJC 2YWCA 3TR3A 3A25A 2Y4NA 3NYQA 2E5LC 2MM9A 1FJGC 2UUBC 3CQ3A 3G7SA 3RV2A 5K85A 5LMNC 3UX2A 4OXIA 1WCJA 5BSMA 5BSRA 3NPDA 5LCIA 4XX2A 3C5EA 3EERA 1N34C 3DLPX 1USPB 1WF3A 4JI4C 4LF5C 3A9UA 4JI2C 1QM4A 2UUAC 2QVZX 4OYCA 2QL8A 4DG8A 1HNWC 2UU9C 3DHVA 2OBVA 1O90A 4EATA 3PBKA 1ULTA 5KEIA 4WV3A 3NI2A 2OPLA 1NY8A 1XRBA 2P2BA 4R0MA 2P2MA 4L2ZA 4D56A 4KTTA 4ZLPA 3PROC 4RLQA 4RVOA 4GXQA 4DR6C 4PUIA 1XMOC 4DCVA 3CQ1A 4JM1A 5DV9A 4MTNA 4OX9C 4BCAA 2UUCC 1V60A 1WH9A 3EQ6A 4G36A 4LE5A 4DR1C 1USPA 5GTDA 1MDBA 4GKKC 2E8EA 2CY1A 1O92A 3GR0A 1M6XC 4K0KC 4B3MC 4NXMC 2ASBA 4DG9A 3UZ0A 5AE2A 2NCLA 2ZZMA 3H2TA 5A2QD 2E0GA 3IEUA 3UEBA 3UOWA 4LFCC 5T8SA 2YCBA 4L4QA 3A26A 3GPCA 4DR7C 5JRHA 4NOZA 2PT7G 3R9XA 2HHHC 2Z51A 4X64C 4BC7A 4X62C 3K6RA 3LNOA 2OPLB 1N36C 2HJGA 4U5YD 1XHJA 2VQFC 2M5HA 4AQYC 1HNZC 2P20A 1UKKA 3A4IA 3ETOA 1FLOA 4PUGA 1T5HX 3LUSA 4PUHA 1UWDA 2KZ0A 1T5DX 4BSZA 1ZB9A 3E7WA 4DV7C 2MMAB 5CZVA 5IWAC 1N32C 4IR7A 2EGTA 3FCCA 3TDEA 2D1QA 1MD9A 3IPLA 4LF9C 4DV1C 2VSQA 3I07A 4JV5C 3AY0A 4DV5C 3KXWA 5BSUA 1VLAA 4JI6C 4YY3C 4DR3C 2PN2A 4DCTA 1MXCA 4RM3A 2CXCA 1V26A 2E8CA 2DPLA 3AF6A 2UXCC 4DV4C 4FUQA 5AE3A 4D4GA 3N2QA 3GR1A 1K0RA 4MH4A 5K8FA 1GPMA 4NDNA 4KHPC 4RLFA 4DV0C 2BH1X 1MXBA 1AMUA 4JI8C 5BSWA 3SO4A 1VEHA 2OO4A 3L95X 1FUGA 4L7IA 2D1TA 5ADZA 3LNVA 2VZEA 2E8FA 2QVYX 3AF5A 5AE1A 1PA4A 2PROA 1IBMC 1KKGA 1ZB8A 5CZXA 4PHTA 3N54B 1RY2A 1LCIA 3DAYA 4DV2C 1RG9A 3CW9A 4TPSB 3TUFA 2KDNA 2V7BA 1YJ7A 2BJOA 4I9FA 4ISBA 2ZM6C 1MKYA 5LMUC 1LQLA 4LF8C 4LF4C 2D27A 3UX3A 2ONFA 4DUZC 1IBLC 1PU1A 4X65C 3CJEA 3OTOC 5BSVA 4DUYC 2VQEC 1IBKC 1HH2P 2JMPA 3A9VA 4PZPA 5A1IA 4RMNA 5T8TA 5FLXD 4JI7C 2QVXX 1PG3A 3VNQA 3I08A 1PG4A 4GXRA 1P4EA 4KTVA 2F4VC 2CU6A 2WD9A 4DV6C 4NXNC 4LF6C 3R44A 2JNVA 4FUTA 3IEVA 2UXBC 1TH5A 4DR2C 2ATWA 2ZZNA 2XR1A 1BA3A 4D57A 1I94C 1V25A 2Y27A 4LF7C 5BSTA 4I9GA 4JI3C 1O9TA 3PESA 3FCEA 2M5OA 4DCUA 3L8CA 3T1YC 4BBYA 1MXAA 4JI1C 1QWIA 1O93A 2D28C 4ODJA 5KYVA 1EGAA 1P7LA 5A1GA 4B3RC 2Y4OA 1HNXC 2UXDC 3R9WA 2P2FA 4HPVA 3RG2A 1XRAA 3JAMD 3T1HC 5A19A 5KYTA 3IMLA 4JYAC 3VNRA 4WS9A 2YX1A 1N33C 4DR5C 1MDFA 3CQ2A 1ML8A 3NYRA 5IFIA 3LAXA 3VNSA 3J80D 5BURA 2D7VA 2AYAA 2QW0X 5IT9D 2WP0C 5H9UA 1L2FA 1XMQC 4X66C 4R1MA 3LGXA 2E7GA 3CW8X
chains in the Genus database with same CATH topology
4JI0C 4ZJZA 5BR8C 1J5EC 2P02A 4DCSA 4LFBC 1XNRC 2YWBA 3S82A 2P2JA 4IZ6A 1XRCA 2P2QA 1JOSA 3E7XA 4RM2A 3B7WA 4YHHC 4DV3C 4G1IA 3J81D 5BUSA 4B3SC 1NYEA 4JI5C 1XNQC 5BUQA 2D1SA 4R1LA 5E7QA 4G37A 4BC9A 4GS5A 3TQIA 4B3TC 4PROC 2D1RA 2KZFA 4FTFA 4DR4C 1N2FA 3ETCA 1HR0C 4RVNA 4D4IA 3GKUA 4K0BA 4LFAC 2DYJA 4GKJC 2YWCA 2Y4NA 3NYQA 2E5LC 1FJGC 2UUBC 3G7SA 3RV2A 5K85A 5LMNC 4OXIA 5BSMA 5BSRA 3NPDA 4XX2A 3C5EA 3EERA 1N34C 3DLPX 1USPB 1WF3A 4JI4C 4LF5C 3A9UA 4JI2C 1QM4A 2UUAC 2QVZX 4OYCA 2QL8A 4DG8A 1HNWC 2UU9C 3DHVA 2OBVA 1O90A 4EATA 3PBKA 1ULTA 5KEIA 4WV3A 3NI2A 2OPLA 1XRBA 2P2BA 4R0MA 2P2MA 4L2ZA 4D56A 4KTTA 4ZLPA 3PROC 4RLQA 4RVOA 4GXQA 4DR6C 1XMOC 4DCVA 4JM1A 5DV9A 4MTNA 4OX9C 4BCAA 2UUCC 1WH9A 3EQ6A 4G36A 4LE5A 4DR1C 1USPA 5GTDA 1MDBA 4GKKC 2E8EA 2CY1A 1O92A 3GR0A 4K0KC 4B3MC 4NXMC 2ASBA 4DG9A 3UZ0A 5AE2A 3H2TA 5A2QD 2E0GA 3IEUA 3UOWA 4LFCC 5T8SA 2YCBA 4L4QA 3GPCA 4DR7C 5JRHA 4NOZA 2PT7G 3R9XA 2HHHC 4X64C 4BC7A 4X62C 2OPLB 1N36C 2HJGA 4U5YD 2VQFC 4AQYC 1HNZC 2P20A 1UKKA 3A4IA 3ETOA 1T5HX 3LUSA 1T5DX 4BSZA 1ZB9A 3E7WA 4DV7C 5CZVA 5IWAC 1N32C 4IR7A 2EGTA 3FCCA 3TDEA 2D1QA 1MD9A 3IPLA 4LF9C 4DV1C 2VSQA 3I07A 4JV5C 4DV5C 3KXWA 5BSUA 1VLAA 4JI6C 4YY3C 4DR3C 2PN2A 4DCTA 1MXCA 4RM3A 2CXCA 1V26A 2E8CA 2DPLA 3AF6A 2UXCC 4DV4C 4FUQA 5AE3A 4D4GA 3N2QA 3GR1A 1K0RA 4MH4A 5K8FA 1GPMA 4NDNA 4KHPC 4RLFA 4DV0C 2BH1X 1MXBA 1AMUA 4JI8C 5BSWA 3SO4A 2OO4A 3L95X 1FUGA 4L7IA 2D1TA 5ADZA 3LNVA 2VZEA 2E8FA 2QVYX 3AF5A 5AE1A 1PA4A 2PROA 1IBMC 1KKGA 1ZB8A 5CZXA 4PHTA 3N54B 1RY2A 1LCIA 3DAYA 4DV2C 1RG9A 3CW9A 4TPSB 3TUFA 2V7BA 1YJ7A 2BJOA 4I9FA 4ISBA 2ZM6C 1MKYA 5LMUC 1LQLA 4LF8C 4LF4C 2D27A 2ONFA 4DUZC 1IBLC 4X65C 3CJEA 3OTOC 5BSVA 4DUYC 2VQEC 1IBKC 1HH2P 2JMPA 3A9VA 4PZPA 5A1IA 4RMNA 5T8TA 5FLXD 4JI7C 2QVXX 1PG3A 3VNQA 3I08A 1PG4A 4GXRA 4KTVA 2F4VC 2WD9A 4DV6C 4NXNC 4LF6C 3R44A 4FUTA 3IEVA 2UXBC 4DR2C 2ATWA 2XR1A 1BA3A 4D57A 1I94C 1V25A 2Y27A 4LF7C 5BSTA 4I9GA 4JI3C 1O9TA 3PESA 3FCEA 4DCUA 3L8CA 3T1YC 4BBYA 1MXAA 4JI1C 1QWIA 1O93A 2D28C 4ODJA 5KYVA 1EGAA 1P7LA 5A1GA 4B3RC 2Y4OA 1HNXC 2UXDC 3R9WA 2P2FA 4HPVA 3RG2A 1XRAA 3JAMD 3T1HC 5A19A 5KYTA 3IMLA 4JYAC 3VNRA 4WS9A 1N33C 4DR5C 1MDFA 1ML8A 3NYRA 5IFIA 3LAXA 3VNSA 3J80D 5BURA 2D7VA 2AYAA 2QW0X 5IT9D 2WP0C 5H9UA 1L2FA 1XMQC 4X66C 4R1MA 3LGXA 2E7GA 3CW8X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 C;  4JI0 C;  4BSZ A;  1ZB9 A;  4DV7 C;  5BR8 C;  5FLX D;  1J5E C;  5IWA C;  1N32 C;  4JI7 C;  4DCS A;  4LFB C;  1XNR C;  2EGT A;  1JOS A;  4LF9 C;  2OPL A;  4DV1 C;  4YHH C;  4DV3 C;  2F4V C;  3J81 D;  3I07 A;  4B3S C;  4DV6 C;  4NXN C;  4JV5 C;  4DV5 C;  4LF6 C;  1NYE A;  4JI5 C;  1XNQ C;  1VLA A;  4JI6 C;  4YY3 C;  4DR3 C;  4DR6 C;  3IEV A;  2UXB C;  4DR2 C;  1XMO C;  2ATW A;  4DCV A;  2PN2 A;  4DCT A;  4MTN A;  2CXC A;  4OX9 C;  2E8C A;  2XR1 A;  4B3T C;  3AF6 A;  2UXC C;  4DV4 C;  2KZF A;  2UUC C;  4DR4 C;  1I94 C;  1N2F A;  1WH9 A;  4LF7 C;  1HR0 C;  4DR1 C;  1USP A;  1K0R A;  4MH4 A;  4JI3 C;  3GKU A;  4GKK C;  4KHP C;  2E8E A;  4DV0 C;  4DCU A;  2CY1 A;  4JI8 C;  3T1Y C;  4K0K C;  4B3M C;  4JI1 C;  1QWI A;  4LFA C;  2DYJ A;  4NXM C;  2ASB A;  1EGA A;  4GKJ C;  2E8F A;  3AF5 A;  1PA4 A;  1IBM C;  4B3R C;  1ZB8 A;  1KKG A;  1HNX C;  5A2Q D;  2UXD C;  3R9W A;  3IEU A;  4LFC C;  2E5L C;  1FJG C;  2YCB A;  2UUB C;  4DV2 C;  5LMN C;  3JAM D;  3T1H C;  4DR7 C;  4NOZ A;  2PT7 G;  2BJO A;  4JYA C;  3R9X A;  2HHH C;  2ZM6 C;  1MKY A;  5LMU C;  1N33 C;  4X64 C;  4DR5 C;  1LQL A;  4LF8 C;  4X62 C;  4XX2 A;  1ML8 A;  4LF4 C;  2ONF A;  2OPL B;  1N36 C;  2HJG A;  3J80 D;  3EER A;  2VQF C;  4DUZ C;  4AQY C;  1HNZ C;  1N34 C;  1USP B;  1UKK A;  1WF3 A;  4JI4 C;  2D7V A;  1IBL C;  4LF5 C;  4X65 C;  3CJE A;  3OTO C;  4JI2 C;  2UUA C;  5IT9 D;  4DUY C;  2QL8 A;  1L2F A;  2VQE C;  4X66 C;  1XMQ C;  1IBK C;  1HH2 P;  3LUS A;  1HNW C;  2JMP A;  2E7G A; 
#chains in the Genus database with same CATH topology
 2DHM A;  4JI0 C;  4ZJZ A;  5BR8 C;  1J5E C;  2P02 A;  4DCS A;  4LFB C;  1XNR C;  2YWB A;  3S82 A;  2P2J A;  4IZ6 A;  1XRC A;  2P2Q A;  1JOS A;  3E7X A;  4RM2 A;  3B7W A;  4YHH C;  4DV3 C;  4G1I A;  3J81 D;  5BUS A;  4B3S C;  1NYE A;  4JI5 C;  1XNQ C;  5BUQ A;  2D1S A;  1P4E C;  2MCQ A;  4R1L A;  5E7Q A;  4G37 A;  4BC9 A;  4GS5 A;  1XS3 A;  3TQI A;  4PRO C;  4B3T C;  2D1R A;  2KZF A;  4FTF A;  4DR4 C;  1IB8 A;  1N2F A;  3ETC A;  1HR0 C;  1M6X A;  4RVN A;  4D4I A;  3GKU A;  4K0B A;  3O2E A;  4LFA C;  2DYJ A;  4GKJ C;  2YWC A;  3TR3 A;  3A25 A;  2Y4N A;  3NYQ A;  2E5L C;  2MM9 A;  1FJG C;  2UUB C;  3CQ3 A;  3G7S A;  3RV2 A;  5K85 A;  5LMN C;  3UX2 A;  4OXI A;  1WCJ A;  5BSM A;  5BSR A;  3NPD A;  5LCI A;  4XX2 A;  3C5E A;  3EER A;  1N34 C;  3DLP X;  1USP B;  1WF3 A;  4JI4 C;  4LF5 C;  3A9U A;  4JI2 C;  1QM4 A;  2UUA C;  2QVZ X;  4OYC A;  2QL8 A;  4DG8 A;  1HNW C;  2UU9 C;  3DHV A;  2OBV A;  1O90 A;  4EAT A;  3PBK A;  1ULT A;  5KEI A;  4WV3 A;  3NI2 A;  2OPL A;  1NY8 A;  1XRB A;  2P2B A;  4R0M A;  2P2M A;  4L2Z A;  4D56 A;  4KTT A;  4ZLP A;  3PRO C;  4RLQ A;  4RVO A;  4GXQ A;  4DR6 C;  4PUI A;  1XMO C;  4DCV A;  3CQ1 A;  4JM1 A;  5DV9 A;  4MTN A;  4OX9 C;  4BCA A;  2UUC C;  1V60 A;  1WH9 A;  3EQ6 A;  4G36 A;  4LE5 A;  4DR1 C;  1USP A;  5GTD A;  1MDB A;  4GKK C;  2E8E A;  2CY1 A;  1O92 A;  3GR0 A;  1M6X C;  4K0K C;  4B3M C;  4NXM C;  2ASB A;  4DG9 A;  3UZ0 A;  5AE2 A;  2NCL A;  2ZZM A;  3H2T A;  5A2Q D;  2E0G A;  3IEU A;  3UEB A;  3UOW A;  4LFC C;  5T8S A;  2YCB A;  4L4Q A;  3A26 A;  3GPC A;  4DR7 C;  5JRH A;  4NOZ A;  2PT7 G;  3R9X A;  2HHH C;  2Z51 A;  4X64 C;  4BC7 A;  4X62 C;  3K6R A;  3LNO A;  2OPL B;  1N36 C;  2HJG A;  4U5Y D;  1XHJ A;  2VQF C;  2M5H A;  4AQY C;  1HNZ C;  2P20 A;  1UKK A;  3A4I A;  3ETO A;  1FLO A;  4PUG A;  1T5H X;  3LUS A;  4PUH A;  1UWD A;  2KZ0 A;  1T5D X;  4BSZ A;  1ZB9 A;  3E7W A;  4DV7 C;  2MMA B;  5CZV A;  5IWA C;  1N32 C;  4IR7 A;  2EGT A;  3FCC A;  3TDE A;  2D1Q A;  1MD9 A;  3IPL A;  4LF9 C;  4DV1 C;  2VSQ A;  3I07 A;  4JV5 C;  3AY0 A;  4DV5 C;  3KXW A;  5BSU A;  1VLA A;  4JI6 C;  4YY3 C;  4DR3 C;  2PN2 A;  4DCT A;  1MXC A;  4RM3 A;  2CXC A;  1V26 A;  2E8C A;  2DPL A;  3AF6 A;  2UXC C;  4DV4 C;  4FUQ A;  5AE3 A;  4D4G A;  3N2Q A;  3GR1 A;  1K0R A;  4MH4 A;  5K8F A;  1GPM A;  4NDN A;  4KHP C;  4RLF A;  4DV0 C;  2BH1 X;  1MXB A;  1AMU A;  4JI8 C;  5BSW A;  3SO4 A;  1VEH A;  2OO4 A;  3L95 X;  1FUG A;  4L7I A;  2D1T A;  5ADZ A;  3LNV A;  2VZE A;  2E8F A;  2QVY X;  3AF5 A;  5AE1 A;  1PA4 A;  2PRO A;  1IBM C;  1KKG A;  1ZB8 A;  5CZX A;  4PHT A;  3N54 B;  1RY2 A;  1LCI A;  3DAY A;  4DV2 C;  1RG9 A;  3CW9 A;  4TPS B;  3TUF A;  2KDN A;  2V7B A;  1YJ7 A;  2BJO A;  4I9F A;  4ISB A;  2ZM6 C;  1MKY A;  5LMU C;  1LQL A;  4LF8 C;  4LF4 C;  2D27 A;  3UX3 A;  2ONF A;  4DUZ C;  1IBL C;  1PU1 A;  4X65 C;  3CJE A;  3OTO C;  5BSV A;  4DUY C;  2VQE C;  1IBK C;  1HH2 P;  2JMP A;  3A9V A;  4PZP A;  5A1I A;  4RMN A;  5T8T A;  5FLX D;  4JI7 C;  2QVX X;  1PG3 A;  3VNQ A;  3I08 A;  1PG4 A;  4GXR A;  1P4E A;  4KTV A;  2F4V C;  2CU6 A;  2WD9 A;  4DV6 C;  4NXN C;  4LF6 C;  3R44 A;  2JNV A;  4FUT A;  3IEV A;  2UXB C;  1TH5 A;  4DR2 C;  2ATW A;  2ZZN A;  2XR1 A;  1BA3 A;  4D57 A;  1I94 C;  1V25 A;  2Y27 A;  4LF7 C;  5BST A;  4I9G A;  4JI3 C;  1O9T A;  3PES A;  3FCE A;  2M5O A;  4DCU A;  3L8C A;  3T1Y C;  4BBY A;  1MXA A;  4JI1 C;  1QWI A;  1O93 A;  2D28 C;  4ODJ A;  5KYV A;  1EGA A;  1P7L A;  5A1G A;  4B3R C;  2Y4O A;  1HNX C;  2UXD C;  3R9W A;  2P2F A;  4HPV A;  3RG2 A;  1XRA A;  3JAM D;  3T1H C;  5A19 A;  5KYT A;  3IML A;  4JYA C;  3VNR A;  4WS9 A;  2YX1 A;  1N33 C;  4DR5 C;  1MDF A;  3CQ2 A;  1ML8 A;  3NYR A;  5IFI A;  3LAX A;  3VNS A;  3J80 D;  5BUR A;  2D7V A;  2AYA A;  2QW0 X;  5IT9 D;  2WP0 C;  5H9U A;  1L2F A;  1XMQ C;  4X66 C;  4R1M A;  3LGX A;  2E7G A;  3CW8 X; 
#chains in the Genus database with same CATH homology
 4JI0 C;  4ZJZ A;  5BR8 C;  1J5E C;  2P02 A;  4DCS A;  4LFB C;  1XNR C;  2YWB A;  3S82 A;  2P2J A;  4IZ6 A;  1XRC A;  2P2Q A;  1JOS A;  3E7X A;  4RM2 A;  3B7W A;  4YHH C;  4DV3 C;  4G1I A;  3J81 D;  5BUS A;  4B3S C;  1NYE A;  4JI5 C;  1XNQ C;  5BUQ A;  2D1S A;  4R1L A;  5E7Q A;  4G37 A;  4BC9 A;  4GS5 A;  3TQI A;  4B3T C;  4PRO C;  2D1R A;  2KZF A;  4FTF A;  4DR4 C;  1N2F A;  3ETC A;  1HR0 C;  4RVN A;  4D4I A;  3GKU A;  4K0B A;  4LFA C;  2DYJ A;  4GKJ C;  2YWC A;  2Y4N A;  3NYQ A;  2E5L C;  1FJG C;  2UUB C;  3G7S A;  3RV2 A;  5K85 A;  5LMN C;  4OXI A;  5BSM A;  5BSR A;  3NPD A;  4XX2 A;  3C5E A;  3EER A;  1N34 C;  3DLP X;  1USP B;  1WF3 A;  4JI4 C;  4LF5 C;  3A9U A;  4JI2 C;  1QM4 A;  2UUA C;  2QVZ X;  4OYC A;  2QL8 A;  4DG8 A;  1HNW C;  2UU9 C;  3DHV A;  2OBV A;  1O90 A;  4EAT A;  3PBK A;  1ULT A;  5KEI A;  4WV3 A;  3NI2 A;  2OPL A;  1XRB A;  2P2B A;  4R0M A;  2P2M A;  4L2Z A;  4D56 A;  4KTT A;  4ZLP A;  3PRO C;  4RLQ A;  4RVO A;  4GXQ A;  4DR6 C;  1XMO C;  4DCV A;  4JM1 A;  5DV9 A;  4MTN A;  4OX9 C;  4BCA A;  2UUC C;  1WH9 A;  3EQ6 A;  4G36 A;  4LE5 A;  4DR1 C;  1USP A;  5GTD A;  1MDB A;  4GKK C;  2E8E A;  2CY1 A;  1O92 A;  3GR0 A;  4K0K C;  4B3M C;  4NXM C;  2ASB A;  4DG9 A;  3UZ0 A;  5AE2 A;  3H2T A;  5A2Q D;  2E0G A;  3IEU A;  3UOW A;  4LFC C;  5T8S A;  2YCB A;  4L4Q A;  3GPC A;  4DR7 C;  5JRH A;  4NOZ A;  2PT7 G;  3R9X A;  2HHH C;  4X64 C;  4BC7 A;  4X62 C;  2OPL B;  1N36 C;  2HJG A;  4U5Y D;  2VQF C;  4AQY C;  1HNZ C;  2P20 A;  1UKK A;  3A4I A;  3ETO A;  1T5H X;  3LUS A;  1T5D X;  4BSZ A;  1ZB9 A;  3E7W A;  4DV7 C;  5CZV A;  5IWA C;  1N32 C;  4IR7 A;  2EGT A;  3FCC A;  3TDE A;  2D1Q A;  1MD9 A;  3IPL A;  4LF9 C;  4DV1 C;  2VSQ A;  3I07 A;  4JV5 C;  4DV5 C;  3KXW A;  5BSU A;  1VLA A;  4JI6 C;  4YY3 C;  4DR3 C;  2PN2 A;  4DCT A;  1MXC A;  4RM3 A;  2CXC A;  1V26 A;  2E8C A;  2DPL A;  3AF6 A;  2UXC C;  4DV4 C;  4FUQ A;  5AE3 A;  4D4G A;  3N2Q A;  3GR1 A;  1K0R A;  4MH4 A;  5K8F A;  1GPM A;  4NDN A;  4KHP C;  4RLF A;  4DV0 C;  2BH1 X;  1MXB A;  1AMU A;  4JI8 C;  5BSW A;  3SO4 A;  2OO4 A;  3L95 X;  1FUG A;  4L7I A;  2D1T A;  5ADZ A;  3LNV A;  2VZE A;  2E8F A;  2QVY X;  3AF5 A;  5AE1 A;  1PA4 A;  2PRO A;  1IBM C;  1KKG A;  1ZB8 A;  5CZX A;  4PHT A;  3N54 B;  1RY2 A;  1LCI A;  3DAY A;  4DV2 C;  1RG9 A;  3CW9 A;  4TPS B;  3TUF A;  2V7B A;  1YJ7 A;  2BJO A;  4I9F A;  4ISB A;  2ZM6 C;  1MKY A;  5LMU C;  1LQL A;  4LF8 C;  4LF4 C;  2D27 A;  2ONF A;  4DUZ C;  1IBL C;  4X65 C;  3CJE A;  3OTO C;  5BSV A;  4DUY C;  2VQE C;  1IBK C;  1HH2 P;  2JMP A;  3A9V A;  4PZP A;  5A1I A;  4RMN A;  5T8T A;  5FLX D;  4JI7 C;  2QVX X;  1PG3 A;  3VNQ A;  3I08 A;  1PG4 A;  4GXR A;  4KTV A;  2F4V C;  2WD9 A;  4DV6 C;  4NXN C;  4LF6 C;  3R44 A;  4FUT A;  3IEV A;  2UXB C;  4DR2 C;  2ATW A;  2XR1 A;  1BA3 A;  4D57 A;  1I94 C;  1V25 A;  2Y27 A;  4LF7 C;  5BST A;  4I9G A;  4JI3 C;  1O9T A;  3PES A;  3FCE A;  4DCU A;  3L8C A;  3T1Y C;  4BBY A;  1MXA A;  4JI1 C;  1QWI A;  1O93 A;  2D28 C;  4ODJ A;  5KYV A;  1EGA A;  1P7L A;  5A1G A;  4B3R C;  2Y4O A;  1HNX C;  2UXD C;  3R9W A;  2P2F A;  4HPV A;  3RG2 A;  1XRA A;  3JAM D;  3T1H C;  5A19 A;  5KYT A;  3IML A;  4JYA C;  3VNR A;  4WS9 A;  1N33 C;  4DR5 C;  1MDF A;  1ML8 A;  3NYR A;  5IFI A;  3LAX A;  3VNS A;  3J80 D;  5BUR A;  2D7V A;  2AYA A;  2QW0 X;  5IT9 D;  2WP0 C;  5H9U A;  1L2F A;  1XMQ C;  4X66 C;  4R1M A;  3LGX A;  2E7G A;  3CW8 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...