1QWIA

Crystal structure of e. coli osmc
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
TIHKKGQAHWESDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydroperoxide reductase
molecule keywords osmotically inducible protein
publication title Structural and functional features of the Escherichia coli hydroperoxide resistance protein OsmC
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1qwiA00
4JV5C 5LMNC 2CY1A 1XMQC 4DCSA 2BJOA 2YCBA 3T1YC 1EGAA 4GKKC 4B3MC 1JOSA 4NXNC 5FLXD 3J80D 4DR4C 1ML8A 4DR5C 4DR3C 1IBMC 2UUBC 4B3SC 2CXCA 3IEVA 1N34C 4DV7C 3R9XA 1XMOC 4MTNA 1I94C 4B3TC 1J5EC 2ONFA 2OPLB 3GKUA 3IEUA 1HNZC 1MKYA 4DUZC 2DYJA 4JI7C 4AQYC 4JI2C 2XR1A 2KZFA 1USPA 3I07A 4DV0C 2UXDC 4JI4C 1PA4A 1XNRC 2UUCC 3LUSA 1K0RA 4X66C 4DV2C 5LMUC 2EGTA 4JI8C 4OX9C 1USPB 4DCTA 2ASBA 4X65C 2E7GA 2ZM6C 1L2FA 4DV3C 4KHPC 1VLAA 5IWAC 3T1HC 4LF7C 2UXBC 1IBLC 4LF8C 2HJGA 4LFBC 3JAMD 2ATWA 4NOZA 4LFAC 2PN2A 4DR7C 4DV1C 3J81D 4LFCC 4DCUA 5A2QD 2F4VC 4JYAC 4DR6C 4K0KC 4JI3C 4LF4C 4DR2C 1ZB8A 4BSZA 4YHHC 1FJGC 2UXCC 1HR0C 1HH2P 4XX2A 4DV5C 1LQLA 4LF5C 3R9WA 4LF6C 4DV4C 3EERA 4NXMC 4DR1C 4JI6C 2JMPA 4B3RC 2PT7G 1N33C 4X64C 1N32C 1KKGA 1WH9A 1N2FA 4DV6C 2HHHC 1ZB9A 1N36C 2VQEC 2UUAC 2E8FA 4X62C 3CJEA 5BR8C 1XNQC 1NYEA 1WF3A 2E8EA 3AF5A 1IBKC 4DCVA 2D7VA 2UU9C 1HNWC 2E8CA 2VQFC 1QWIA 3OTOC 2QL8A 3AF6A 1HNXC 5IT9D 2OPLA 4LF9C 4JI1C 4YY3C 4JI0C 2E5LC 4GKJC 4JI5C 4DUYC 4MH4A 1UKKA
chains in the Genus database with same CATH superfamily
5LMNC 2CY1A 4KTVA 5T8SA 4DCSA 4BCAA 3I08A 3T1YC 2NCLA 4DG9A 2P02A 1IB8A 4GKKC 4GS5A 2YWBA 3J80D 4WS9A 5AE2A 4G1IA 2D27A 4B3SC 1N34C 3NYQA 3R9XA 4OYCA 3RV2A 4MTNA 2D1RA 3K6RA 1T5DX 5E7QA 4B3TC 1J5EC 2ONFA 4RMNA 1HNZC 2WP0C 4DUZC 1USPA 4JI4C 1XNRC 2KDNA 1O92A 3LUSA 1K0RA 4X66C 4I9GA 4ZLPA 3E7WA 1M6XC 2E7GA 1L2FA 4BC9A 1AMUA 4LF7C 1LCIA 3RG2A 1O90A 3DHVA 1PG4A 2OBVA 1XS3A 2PN2A 2E0GA 5IFIA 3LNOA 5BSVA 2AYAA 5BSMA 4PZPA 2QVYX 4LF4C 2UXCC 1FJGC 3IPLA 5KEIA 3C5EA 2Y4NA 1P7LA 1UWDA 4DV5C 1V25A 4JI6C 1XRBA 4TPSB 5H9UA 1WH9A 1V26A 2MCQA 2UUAC 4FUTA 4KTTA 2MMAB 2E8FA 4DG8A 4X62C 5BR8C 2ZZMA 1NYEA 5A1GA 5K85A 2E8CA 2VQFC 1QWIA 3OTOC 2QW0X 3AF6A 4L2ZA 4JI1C 4JI0C 4JI5C 4DUYC 3NI2A 5DV9A 2CU6A 1XHJA 3CQ1A 3L95X 3B7WA 2BJOA 2YCBA 1O93A 1NY8A 4B3MC 4EATA 1JOSA 5FLXD 3E7XA 5A19A 1O9TA 4DR3C 3PESA 2UUBC 5AE1A 1XMOC 1I94C 3N54B 4RVOA 5CZVA 4JI2C 4HPVA 3I07A 4L7IA 3N2QA 1MDFA 3H2TA 3DAYA 3ETCA 2UUCC 4DV2C 4WV3A 2ASBA 2VZEA 2V7BA 4DV3C 4KHPC 4PHTA 5BUQA 4D4GA 2KZ0A 3ETOA 1GPMA 1IBLC 1ULTA 2DHMA 4LF8C 2HJGA 2BH1X 1P4EC 5BSUA 3DLPX 4DV1C 1V60A 2Z51A 4D4IA 4JYAC 4NDNA 3PBKA 2YWCA 1ZB8A 4R1LA 1MXCA 1LQLA 3UX2A 1N33C 1N32C 1KKGA 5BUSA 5BURA 4PUIA 4FTFA 1N36C 3SO4A 3CJEA 1QM4A 5AE3A 1HNWC 3CW8X 4OXIA 1MXAA 2QL8A 4RM2A 2OPLA 2P2JA 4YY3C 3AY0A 2VSQA 4R0MA 1T5HX 4RLFA 3VNRA 5KYVA 4JM1A 1RG9A 3O2EA 3VNSA 4DR4C 4U5YD 1ML8A 4DR5C 4PROC 1MDBA 2CXCA 4BBYA 1PU1A 2YX1A 2OPLB 4RVNA 5KYTA 4JI7C 1PG3A 1XRCA 3G7SA 5LCIA 4D57A 3KXWA 4D56A 4OX9C 4JI8C 4DCTA 3CQ2A 3TUFA 4I9FA 1VLAA 3LGXA 1XRAA 5IWAC 4R1MA 3T1HC 2UXBC 4PUGA 4LFBC 2PROA 4GXQA 4NOZA 3CQ3A 2P2BA 4G36A 3TQIA 2OO4A 3LNVA 4RM3A 4IR7A 2F4VC 3FCEA 4JI3C 3A9VA 4DR2C 1HR0C 1HH2P 4XX2A 4LF5C 4LF6C 4DV4C 3EERA 4NXMC 4DR1C 2JMPA 2PT7G 3A25A 1N2FA 3PROC 2HHHC 5BSWA 1ZB9A 2P2FA 2VQEC 2Y4OA 1FUGA 1XNQC 2M5OA 4FUQA 4IZ6A 1WF3A 2E8EA 3AF5A 1IBKC 2WD9A 1HNXC 4L4QA 5IT9D 2MM9A 5K8FA 2E5LC 4BC7A 4MH4A 1UKKA 4JV5C 5GTDA 1XMQC 3S82A 2Y27A 3LAXA 2DPLA 3UOWA 1EGAA 1WCJA 2M5HA 5ADZA 4NXNC 2D1SA 2D1QA 3EQ6A 3CW9A 1IBMC 2P20A 3IMLA 3IEVA 5CZXA 4DV7C 4ISBA 1MD9A 2JNVA 3GKUA 3IEUA 4ZJZA 1MKYA 2DYJA 4AQYC 1FLOA 2XR1A 2KZFA 1YJ7A 3A9UA 5BSTA 4DV0C 2UXDC 3GR0A 1PA4A 2D1TA 4LE5A 2D28C 5JRHA 5LMUC 2EGTA 1USPB 3TDEA 3NYRA 4X65C 3A4IA 2ZM6C 1P4EA 2QVZX 2QVXX 3FCCA 3JAMD 2ATWA 4PUHA 1VEHA 4LFAC 4DR7C 3TR3A 5BSRA 3J81D 4LFCC 3UEBA 4DCUA 1BA3A 5A2QD 3GPCA 1M6XA 4DR6C 4K0KC 3L8CA 4G37A 4BSZA 4YHHC 2P2MA 4GXRA 1TH5A 3R9WA 2P2QA 4B3RC 4X64C 4K0BA 3GR1A 3A26A 4DV6C 3VNQA 3UX3A 3UZ0A 5A1IA 5T8TA 1RY2A 4DCVA 2D7VA 1MXBA 2UU9C 3NPDA 2ZZNA 3R44A 4LF9C 4RLQA 4GKJC 4ODJA
chains in the Genus database with same CATH topology
5LMNC 2CY1A 4KTVA 5T8SA 4DCSA 4BCAA 3I08A 3T1YC 4DG9A 2P02A 4GKKC 4GS5A 2YWBA 3J80D 4WS9A 5AE2A 4G1IA 2D27A 4B3SC 1N34C 3NYQA 3R9XA 4OYCA 3RV2A 4MTNA 2D1RA 5E7QA 1T5DX 4B3TC 1J5EC 2ONFA 4RMNA 1HNZC 2WP0C 4DUZC 1USPA 4JI4C 1XNRC 1O92A 3LUSA 1K0RA 4X66C 4I9GA 4ZLPA 3E7WA 2E7GA 1L2FA 4BC9A 1AMUA 4LF7C 1LCIA 3RG2A 1O90A 3DHVA 1PG4A 2OBVA 2PN2A 2E0GA 5IFIA 5BSVA 2AYAA 5BSMA 4PZPA 2QVYX 4LF4C 2UXCC 1FJGC 3IPLA 5KEIA 3C5EA 2Y4NA 1P7LA 4DV5C 1V25A 4JI6C 1XRBA 4TPSB 5H9UA 1WH9A 1V26A 2UUAC 4FUTA 4KTTA 4DG8A 2E8FA 4X62C 5BR8C 1NYEA 5A1GA 5K85A 2E8CA 2VQFC 3AF6A 1QWIA 2QW0X 3OTOC 4L2ZA 4JI1C 4JI0C 4JI5C 4DUYC 3NI2A 5DV9A 3L95X 3B7WA 2BJOA 2YCBA 1O93A 4B3MC 4EATA 1JOSA 5FLXD 3E7XA 5A19A 1O9TA 4DR3C 3PESA 2UUBC 5AE1A 1XMOC 1I94C 3N54B 4RVOA 5CZVA 4JI2C 4HPVA 3I07A 4L7IA 3N2QA 1MDFA 3H2TA 3DAYA 3ETCA 2UUCC 4DV2C 4WV3A 2ASBA 2VZEA 2V7BA 4DV3C 4KHPC 4PHTA 5BUQA 4D4GA 3ETOA 1GPMA 1IBLC 1ULTA 4LF8C 2HJGA 2BH1X 5BSUA 3DLPX 4DV1C 4D4IA 4JYAC 4NDNA 3PBKA 2YWCA 1ZB8A 4R1LA 1MXCA 1LQLA 1N33C 1N32C 1KKGA 5BUSA 5BURA 4FTFA 1N36C 3SO4A 3CJEA 1QM4A 5AE3A 1HNWC 3CW8X 4OXIA 1MXAA 2QL8A 4RM2A 2OPLA 2P2JA 4YY3C 2VSQA 4R0MA 1T5HX 4RLFA 3VNRA 5KYVA 4JM1A 1RG9A 3VNSA 4DR4C 4U5YD 1ML8A 4DR5C 4PROC 1MDBA 2CXCA 4BBYA 2OPLB 4RVNA 5KYTA 4JI7C 1PG3A 1XRCA 3G7SA 4D57A 3KXWA 4D56A 4OX9C 4JI8C 4DCTA 3TUFA 4I9FA 1VLAA 3LGXA 1XRAA 5IWAC 4R1MA 3T1HC 2UXBC 4LFBC 2PROA 4GXQA 4NOZA 2P2BA 4G36A 3TQIA 2OO4A 3LNVA 4RM3A 4IR7A 2F4VC 3FCEA 4JI3C 3A9VA 4DR2C 1HR0C 1HH2P 4XX2A 4LF5C 4LF6C 4DV4C 3EERA 4NXMC 4DR1C 2JMPA 2PT7G 1N2FA 3PROC 2HHHC 5BSWA 1ZB9A 2P2FA 2VQEC 2Y4OA 1FUGA 1XNQC 4FUQA 4IZ6A 1WF3A 2E8EA 3AF5A 1IBKC 2WD9A 1HNXC 4L4QA 5IT9D 5K8FA 2E5LC 4BC7A 4MH4A 1UKKA 4JV5C 5GTDA 1XMQC 3S82A 2Y27A 3LAXA 2DPLA 3UOWA 1EGAA 5ADZA 4NXNC 2D1SA 2D1QA 3EQ6A 3CW9A 1IBMC 2P20A 3IMLA 3IEVA 5CZXA 4DV7C 4ISBA 1MD9A 3GKUA 3IEUA 4ZJZA 1MKYA 2DYJA 4AQYC 2XR1A 2KZFA 1YJ7A 3A9UA 5BSTA 4DV0C 2UXDC 3GR0A 1PA4A 2D1TA 4LE5A 2D28C 5JRHA 5LMUC 2EGTA 1USPB 3TDEA 3NYRA 4X65C 3A4IA 2ZM6C 2QVZX 2QVXX 3FCCA 3JAMD 2ATWA 4LFAC 4DR7C 5BSRA 3J81D 4LFCC 4DCUA 1BA3A 5A2QD 3GPCA 4DR6C 4K0KC 3L8CA 4G37A 4BSZA 4YHHC 2P2MA 4GXRA 3R9WA 2P2QA 4B3RC 4X64C 4K0BA 3GR1A 4DV6C 3VNQA 5A1IA 3UZ0A 5T8TA 1RY2A 4DCVA 2D7VA 1MXBA 2UU9C 3NPDA 3R44A 4LF9C 4RLQA 4GKJC 4ODJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JV5 C;  5LMN C;  2CY1 A;  1XMQ C;  4DCS A;  2BJO A;  2YCB A;  3T1Y C;  1EGA A;  4GKK C;  4B3M C;  1JOS A;  4NXN C;  5FLX D;  3J80 D;  4DR4 C;  1ML8 A;  4DR5 C;  4DR3 C;  1IBM C;  2UUB C;  4B3S C;  2CXC A;  3IEV A;  1N34 C;  4DV7 C;  3R9X A;  1XMO C;  4MTN A;  1I94 C;  4B3T C;  1J5E C;  2ONF A;  2OPL B;  3GKU A;  3IEU A;  1HNZ C;  1MKY A;  4DUZ C;  2DYJ A;  4JI7 C;  4AQY C;  4JI2 C;  2XR1 A;  2KZF A;  1USP A;  3I07 A;  4DV0 C;  2UXD C;  4JI4 C;  1PA4 A;  1XNR C;  2UUC C;  3LUS A;  1K0R A;  4X66 C;  4DV2 C;  5LMU C;  2EGT A;  4JI8 C;  4OX9 C;  1USP B;  4DCT A;  2ASB A;  4X65 C;  2E7G A;  2ZM6 C;  1L2F A;  4DV3 C;  4KHP C;  1VLA A;  5IWA C;  3T1H C;  4LF7 C;  2UXB C;  1IBL C;  4LF8 C;  2HJG A;  4LFB C;  3JAM D;  2ATW A;  4NOZ A;  4LFA C;  2PN2 A;  4DR7 C;  4DV1 C;  3J81 D;  4LFC C;  4DCU A;  5A2Q D;  2F4V C;  4JYA C;  4DR6 C;  4K0K C;  4JI3 C;  4LF4 C;  4DR2 C;  1ZB8 A;  4BSZ A;  4YHH C;  1FJG C;  2UXC C;  1HR0 C;  1HH2 P;  4XX2 A;  4DV5 C;  1LQL A;  4LF5 C;  3R9W A;  4LF6 C;  4DV4 C;  3EER A;  4NXM C;  4DR1 C;  4JI6 C;  2JMP A;  4B3R C;  2PT7 G;  1N33 C;  4X64 C;  1N32 C;  1KKG A;  1WH9 A;  1N2F A;  4DV6 C;  2HHH C;  1ZB9 A;  1N36 C;  2VQE C;  2UUA C;  2E8F A;  4X62 C;  3CJE A;  5BR8 C;  1XNQ C;  1NYE A;  1WF3 A;  2E8E A;  3AF5 A;  1IBK C;  4DCV A;  2D7V A;  2UU9 C;  1HNW C;  2E8C A;  2VQF C;  1QWI A;  3OTO C;  2QL8 A;  3AF6 A;  1HNX C;  5IT9 D;  2OPL A;  4LF9 C;  4JI1 C;  4YY3 C;  4JI0 C;  2E5L C;  4GKJ C;  4JI5 C;  4DUY C;  4MH4 A;  1UKK A; 
#chains in the Genus database with same CATH topology
 5LMN C;  2CY1 A;  4KTV A;  5T8S A;  4DCS A;  4BCA A;  3I08 A;  3T1Y C;  2NCL A;  4DG9 A;  2P02 A;  1IB8 A;  4GKK C;  4GS5 A;  2YWB A;  3J80 D;  4WS9 A;  5AE2 A;  4G1I A;  2D27 A;  4B3S C;  1N34 C;  3NYQ A;  3R9X A;  4OYC A;  3RV2 A;  4MTN A;  2D1R A;  3K6R A;  1T5D X;  5E7Q A;  4B3T C;  1J5E C;  2ONF A;  4RMN A;  1HNZ C;  2WP0 C;  4DUZ C;  1USP A;  4JI4 C;  1XNR C;  2KDN A;  1O92 A;  3LUS A;  1K0R A;  4X66 C;  4I9G A;  4ZLP A;  3E7W A;  1M6X C;  2E7G A;  1L2F A;  4BC9 A;  1AMU A;  4LF7 C;  1LCI A;  3RG2 A;  1O90 A;  3DHV A;  1PG4 A;  2OBV A;  1XS3 A;  2PN2 A;  2E0G A;  5IFI A;  3LNO A;  5BSV A;  2AYA A;  5BSM A;  4PZP A;  2QVY X;  4LF4 C;  2UXC C;  1FJG C;  3IPL A;  5KEI A;  3C5E A;  2Y4N A;  1P7L A;  1UWD A;  4DV5 C;  1V25 A;  4JI6 C;  1XRB A;  4TPS B;  5H9U A;  1WH9 A;  1V26 A;  2MCQ A;  2UUA C;  4FUT A;  4KTT A;  2MMA B;  2E8F A;  4DG8 A;  4X62 C;  5BR8 C;  2ZZM A;  1NYE A;  5A1G A;  5K85 A;  2E8C A;  2VQF C;  1QWI A;  3OTO C;  2QW0 X;  3AF6 A;  4L2Z A;  4JI1 C;  4JI0 C;  4JI5 C;  4DUY C;  3NI2 A;  5DV9 A;  2CU6 A;  1XHJ A;  3CQ1 A;  3L95 X;  3B7W A;  2BJO A;  2YCB A;  1O93 A;  1NY8 A;  4B3M C;  4EAT A;  1JOS A;  5FLX D;  3E7X A;  5A19 A;  1O9T A;  4DR3 C;  3PES A;  2UUB C;  5AE1 A;  1XMO C;  1I94 C;  3N54 B;  4RVO A;  5CZV A;  4JI2 C;  4HPV A;  3I07 A;  4L7I A;  3N2Q A;  1MDF A;  3H2T A;  3DAY A;  3ETC A;  2UUC C;  4DV2 C;  4WV3 A;  2ASB A;  2VZE A;  2V7B A;  4DV3 C;  4KHP C;  4PHT A;  5BUQ A;  4D4G A;  2KZ0 A;  3ETO A;  1GPM A;  1IBL C;  1ULT A;  2DHM A;  4LF8 C;  2HJG A;  2BH1 X;  1P4E C;  5BSU A;  3DLP X;  4DV1 C;  1V60 A;  2Z51 A;  4D4I A;  4JYA C;  4NDN A;  3PBK A;  2YWC A;  1ZB8 A;  4R1L A;  1MXC A;  1LQL A;  3UX2 A;  1N33 C;  1N32 C;  1KKG A;  5BUS A;  5BUR A;  4PUI A;  4FTF A;  1N36 C;  3SO4 A;  3CJE A;  1QM4 A;  5AE3 A;  1HNW C;  3CW8 X;  4OXI A;  1MXA A;  2QL8 A;  4RM2 A;  2OPL A;  2P2J A;  4YY3 C;  3AY0 A;  2VSQ A;  4R0M A;  1T5H X;  4RLF A;  3VNR A;  5KYV A;  4JM1 A;  1RG9 A;  3O2E A;  3VNS A;  4DR4 C;  4U5Y D;  1ML8 A;  4DR5 C;  4PRO C;  1MDB A;  2CXC A;  4BBY A;  1PU1 A;  2YX1 A;  2OPL B;  4RVN A;  5KYT A;  4JI7 C;  1PG3 A;  1XRC A;  3G7S A;  5LCI A;  4D57 A;  3KXW A;  4D56 A;  4OX9 C;  4JI8 C;  4DCT A;  3CQ2 A;  3TUF A;  4I9F A;  1VLA A;  3LGX A;  1XRA A;  5IWA C;  4R1M A;  3T1H C;  2UXB C;  4PUG A;  4LFB C;  2PRO A;  4GXQ A;  4NOZ A;  3CQ3 A;  2P2B A;  4G36 A;  3TQI A;  2OO4 A;  3LNV A;  4RM3 A;  4IR7 A;  2F4V C;  3FCE A;  4JI3 C;  3A9V A;  4DR2 C;  1HR0 C;  1HH2 P;  4XX2 A;  4LF5 C;  4LF6 C;  4DV4 C;  3EER A;  4NXM C;  4DR1 C;  2JMP A;  2PT7 G;  3A25 A;  1N2F A;  3PRO C;  2HHH C;  5BSW A;  1ZB9 A;  2P2F A;  2VQE C;  2Y4O A;  1FUG A;  1XNQ C;  2M5O A;  4FUQ A;  4IZ6 A;  1WF3 A;  2E8E A;  3AF5 A;  1IBK C;  2WD9 A;  1HNX C;  4L4Q A;  5IT9 D;  2MM9 A;  5K8F A;  2E5L C;  4BC7 A;  4MH4 A;  1UKK A;  4JV5 C;  5GTD A;  1XMQ C;  3S82 A;  2Y27 A;  3LAX A;  2DPL A;  3UOW A;  1EGA A;  1WCJ A;  2M5H A;  5ADZ A;  4NXN C;  2D1S A;  2D1Q A;  3EQ6 A;  3CW9 A;  1IBM C;  2P20 A;  3IML A;  3IEV A;  5CZX A;  4DV7 C;  4ISB A;  1MD9 A;  2JNV A;  3GKU A;  3IEU A;  4ZJZ A;  1MKY A;  2DYJ A;  4AQY C;  1FLO A;  2XR1 A;  2KZF A;  1YJ7 A;  3A9U A;  5BST A;  4DV0 C;  2UXD C;  3GR0 A;  1PA4 A;  2D1T A;  4LE5 A;  2D28 C;  5JRH A;  5LMU C;  2EGT A;  1USP B;  3TDE A;  3NYR A;  4X65 C;  3A4I A;  2ZM6 C;  1P4E A;  2QVZ X;  2QVX X;  3FCC A;  3JAM D;  2ATW A;  4PUH A;  1VEH A;  4LFA C;  4DR7 C;  3TR3 A;  5BSR A;  3J81 D;  4LFC C;  3UEB A;  4DCU A;  1BA3 A;  5A2Q D;  3GPC A;  1M6X A;  4DR6 C;  4K0K C;  3L8C A;  4G37 A;  4BSZ A;  4YHH C;  2P2M A;  4GXR A;  1TH5 A;  3R9W A;  2P2Q A;  4B3R C;  4X64 C;  4K0B A;  3GR1 A;  3A26 A;  4DV6 C;  3VNQ A;  3UX3 A;  3UZ0 A;  5A1I A;  5T8T A;  1RY2 A;  4DCV A;  2D7V A;  1MXB A;  2UU9 C;  3NPD A;  2ZZN A;  3R44 A;  4LF9 C;  4RLQ A;  4GKJ C;  4ODJ A; 
#chains in the Genus database with same CATH homology
 5LMN C;  2CY1 A;  4KTV A;  5T8S A;  4DCS A;  4BCA A;  3I08 A;  3T1Y C;  4DG9 A;  2P02 A;  4GKK C;  4GS5 A;  2YWB A;  3J80 D;  4WS9 A;  5AE2 A;  4G1I A;  2D27 A;  4B3S C;  1N34 C;  3NYQ A;  3R9X A;  4OYC A;  3RV2 A;  4MTN A;  2D1R A;  5E7Q A;  1T5D X;  4B3T C;  1J5E C;  2ONF A;  4RMN A;  1HNZ C;  2WP0 C;  4DUZ C;  1USP A;  4JI4 C;  1XNR C;  1O92 A;  3LUS A;  1K0R A;  4X66 C;  4I9G A;  4ZLP A;  3E7W A;  2E7G A;  1L2F A;  4BC9 A;  1AMU A;  4LF7 C;  1LCI A;  3RG2 A;  1O90 A;  3DHV A;  1PG4 A;  2OBV A;  2PN2 A;  2E0G A;  5IFI A;  5BSV A;  2AYA A;  5BSM A;  4PZP A;  2QVY X;  4LF4 C;  2UXC C;  1FJG C;  3IPL A;  5KEI A;  3C5E A;  2Y4N A;  1P7L A;  4DV5 C;  1V25 A;  4JI6 C;  1XRB A;  4TPS B;  5H9U A;  1WH9 A;  1V26 A;  2UUA C;  4FUT A;  4KTT A;  4DG8 A;  2E8F A;  4X62 C;  5BR8 C;  1NYE A;  5A1G A;  5K85 A;  2E8C A;  2VQF C;  3AF6 A;  1QWI A;  2QW0 X;  3OTO C;  4L2Z A;  4JI1 C;  4JI0 C;  4JI5 C;  4DUY C;  3NI2 A;  5DV9 A;  3L95 X;  3B7W A;  2BJO A;  2YCB A;  1O93 A;  4B3M C;  4EAT A;  1JOS A;  5FLX D;  3E7X A;  5A19 A;  1O9T A;  4DR3 C;  3PES A;  2UUB C;  5AE1 A;  1XMO C;  1I94 C;  3N54 B;  4RVO A;  5CZV A;  4JI2 C;  4HPV A;  3I07 A;  4L7I A;  3N2Q A;  1MDF A;  3H2T A;  3DAY A;  3ETC A;  2UUC C;  4DV2 C;  4WV3 A;  2ASB A;  2VZE A;  2V7B A;  4DV3 C;  4KHP C;  4PHT A;  5BUQ A;  4D4G A;  3ETO A;  1GPM A;  1IBL C;  1ULT A;  4LF8 C;  2HJG A;  2BH1 X;  5BSU A;  3DLP X;  4DV1 C;  4D4I A;  4JYA C;  4NDN A;  3PBK A;  2YWC A;  1ZB8 A;  4R1L A;  1MXC A;  1LQL A;  1N33 C;  1N32 C;  1KKG A;  5BUS A;  5BUR A;  4FTF A;  1N36 C;  3SO4 A;  3CJE A;  1QM4 A;  5AE3 A;  1HNW C;  3CW8 X;  4OXI A;  1MXA A;  2QL8 A;  4RM2 A;  2OPL A;  2P2J A;  4YY3 C;  2VSQ A;  4R0M A;  1T5H X;  4RLF A;  3VNR A;  5KYV A;  4JM1 A;  1RG9 A;  3VNS A;  4DR4 C;  4U5Y D;  1ML8 A;  4DR5 C;  4PRO C;  1MDB A;  2CXC A;  4BBY A;  2OPL B;  4RVN A;  5KYT A;  4JI7 C;  1PG3 A;  1XRC A;  3G7S A;  4D57 A;  3KXW A;  4D56 A;  4OX9 C;  4JI8 C;  4DCT A;  3TUF A;  4I9F A;  1VLA A;  3LGX A;  1XRA A;  5IWA C;  4R1M A;  3T1H C;  2UXB C;  4LFB C;  2PRO A;  4GXQ A;  4NOZ A;  2P2B A;  4G36 A;  3TQI A;  2OO4 A;  3LNV A;  4RM3 A;  4IR7 A;  2F4V C;  3FCE A;  4JI3 C;  3A9V A;  4DR2 C;  1HR0 C;  1HH2 P;  4XX2 A;  4LF5 C;  4LF6 C;  4DV4 C;  3EER A;  4NXM C;  4DR1 C;  2JMP A;  2PT7 G;  1N2F A;  3PRO C;  2HHH C;  5BSW A;  1ZB9 A;  2P2F A;  2VQE C;  2Y4O A;  1FUG A;  1XNQ C;  4FUQ A;  4IZ6 A;  1WF3 A;  2E8E A;  3AF5 A;  1IBK C;  2WD9 A;  1HNX C;  4L4Q A;  5IT9 D;  5K8F A;  2E5L C;  4BC7 A;  4MH4 A;  1UKK A;  4JV5 C;  5GTD A;  1XMQ C;  3S82 A;  2Y27 A;  3LAX A;  2DPL A;  3UOW A;  1EGA A;  5ADZ A;  4NXN C;  2D1S A;  2D1Q A;  3EQ6 A;  3CW9 A;  1IBM C;  2P20 A;  3IML A;  3IEV A;  5CZX A;  4DV7 C;  4ISB A;  1MD9 A;  3GKU A;  3IEU A;  4ZJZ A;  1MKY A;  2DYJ A;  4AQY C;  2XR1 A;  2KZF A;  1YJ7 A;  3A9U A;  5BST A;  4DV0 C;  2UXD C;  3GR0 A;  1PA4 A;  2D1T A;  4LE5 A;  2D28 C;  5JRH A;  5LMU C;  2EGT A;  1USP B;  3TDE A;  3NYR A;  4X65 C;  3A4I A;  2ZM6 C;  2QVZ X;  2QVX X;  3FCC A;  3JAM D;  2ATW A;  4LFA C;  4DR7 C;  5BSR A;  3J81 D;  4LFC C;  4DCU A;  1BA3 A;  5A2Q D;  3GPC A;  4DR6 C;  4K0K C;  3L8C A;  4G37 A;  4BSZ A;  4YHH C;  2P2M A;  4GXR A;  3R9W A;  2P2Q A;  4B3R C;  4X64 C;  4K0B A;  3GR1 A;  4DV6 C;  3VNQ A;  5A1I A;  3UZ0 A;  5T8T A;  1RY2 A;  4DCV A;  2D7V A;  1MXB A;  2UU9 C;  3NPD A;  3R44 A;  4LF9 C;  4RLQ A;  4GKJ C;  4ODJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...