2E7GA

Solution structure of putative ribosome-binding factor a (rbfa) from human mutochondrial precursor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Putative ribosome-binding factor A
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e7gA01
1UKKA 5IT9D 1WF3A 3T1YC 4X62C 4JYAC 1L2FA 1PA4A 1ML8A 4DR5C 2UU9C 2UUBC 4X66C 4X65C 1IBKC 1XMQC 4LF7C 1EGAA 4DR7C 4LFBC 4DV4C 4DR3C 4DUYC 3J80D 4DV0C 5FLXD 2D7VA 4B3TC 4AQYC 2UUAC 4DCUA 4LF6C 4DR1C 2CY1A 1USPB 3IEVA 4DV2C 1HH2P 1IBLC 1XMOC 2UXDC 2BJOA 3AF5A 5LMNC 4B3RC 3T1HC 4OX9C 4JI1C 1XNQC 1VLAA 4LFCC 4GKKC 4LF9C 1MKYA 1N32C 4X64C 1IBMC 3EERA 4K0KC 4BSZA 1I94C 2ASBA 1ZB8A 1K0RA 1FJGC 2XR1A 4DV1C 4JI8C 4JI7C 4LF5C 4XX2A 4JI2C 2ZM6C 1N2FA 1LQLA 3I07A 1J5EC 1JOSA 2HJGA 4YY3C 3R9XA 2PT7G 2ATWA 3R9WA 4DR6C 5IWAC 2HHHC 3AF6A 3CJEA 1WH9A 3GKUA 5LMUC 2E5LC 4JI5C 4DR2C 2OPLB 1N36C 3J81D 1USPA 4YHHC 1HNZC 4JI3C 2E8EA 4LF4C 4NXNC 3OTOC 2ONFA 4MH4A 3IEUA 1NYEA 4DCVA 1XNRC 4MTNA 4DV6C 2UUCC 4DR4C 1N34C 4DV3C 2EGTA 4DCSA 1KKGA 2E8FA 4KHPC 4DCTA 3JAMD 3LUSA 2KZFA 4DUZC 4B3SC 2QL8A 2E8CA 4NOZA 1HR0C 2CXCA 1HNWC 2YCBA 2JMPA 1QWIA 1HNXC 4JV5C 4JI0C 4DV7C 4GKJC 4LFAC 2VQEC 1ZB9A 2VQFC 5BR8C 4B3MC 4JI6C 2DYJA 2E7GA 5A2QD 4NXMC 1N33C 4LF8C 2F4VC 2UXCC 2OPLA 4JI4C 2PN2A 2UXBC 4DV5C
chains in the Genus database with same CATH superfamily
4IZ6A 1WF3A 3T1YC 4X62C 4JYAC 1L2FA 2UU9C 3TUFA 4L4QA 5A19A 4GXQA 5FLXD 4BBYA 2YWBA 2P2FA 4FUTA 4R1LA 2D27A 4D57A 1M6XC 3C5EA 3CQ2A 4RMNA 3IEVA 5AE2A 5A1IA 2PROA 1IBLC 4KTTA 2UXDC 1XRAA 2BJOA 3AF5A 1RG9A 5E7QA 2D28C 1XHJA 1MXCA 1O93A 3NI2A 1N32C 3A9VA 2V7BA 2VSQA 3EERA 3FCEA 4BSZA 5BUQA 1M6XA 3PBKA 1FLOA 4ISBA 4WV3A 4RLQA 5BSRA 3I07A 1LQLA 1P7LA 1P4EC 2M5OA 2HJGA 2DHMA 2Y4NA 3R9XA 3R9WA 4WS9A 3GKUA 2VZEA 2E5LC 4LE5A 4PZPA 1N36C 4JI3C 2E8EA 4RVNA 4GS5A 2UUCC 4PROC 4K0BA 2KDNA 1QM4A 3N2QA 1KKGA 2D1QA 2E8FA 3LGXA 3JAMD 4DCTA 4BC7A 1T5HX 3AY0A 3A9UA 4G37A 2YCBA 4GKJC 4LFAC 2VQEC 5KYTA 2VQFC 5BR8C 4DG8A 3UX2A 2E7GA 1VEHA 5A2QD 2ZZMA 3NPDA 3ETCA 2UXCC 2OPLA 4FUQA 4JI4C 2PN2A 4DV5C 4L2ZA 1PU1A 2JNVA 2YX1A 1UKKA 5IT9D 4DR5C 4DR7C 2P2MA 4DR3C 5GTDA 3NYQA 1BA3A 4PUHA 1V25A 5BSVA 4U5YD 1TH5A 3CQ3A 4AQYC 2UUAC 2D1SA 4DCUA 4TPSB 2QVYX 2MM9A 1HH2P 2CU6A 4ODJA 1XMOC 3IMLA 3UOWA 4RVOA 1MXAA 1VLAA 1O92A 4LFCC 4GKKC 2QVZX 4X64C 3N54B 4K0KC 1I94C 1FJGC 1K0RA 3CQ1A 2XR1A 1V26A 4JI2C 1T5DX 1V60A 2ZM6C 5CZXA 1AMUA 2M5HA 4YY3C 3E7WA 2PT7G 2ATWA 4DR6C 3K6RA 2HHHC 3AF6A 3CJEA 5LMUC 4JI5C 5BSMA 3GR1A 1USPA 4YHHC 4OXIA 2ONFA 4MH4A 5CZVA 1PG3A 3KXWA 4DV6C 4L7IA 3VNQA 4DR4C 3IPLA 5BSTA 5BSUA 5LCIA 4BCAA 2WP0C 4DUZC 4B3SC 1PG4A 2JMPA 3GR0A 2ZZNA 4JV5C 4PUIA 1ZB9A 2DYJA 1N33C 2P2JA 5A1GA 4I9GA 5KYVA 4D4GA 4KTVA 5IFIA 1WCJA 3TDEA 3TQIA 1PA4A 2NCLA 3G7SA 2UUBC 4LF7C 2QW0X 3H2TA 1XMQC 1IBKC 4RM2A 4DV4C 4PUGA 4DUYC 4OYCA 4DV0C 3A25A 5BSWA 2D7VA 5AE3A 2Y4OA 1ULTA 3S82A 3VNRA 4PHTA 2CY1A 3E7XA 2P20A 3UEBA 3CW8X 5DV9A 5LMNC 3T1HC 1UWDA 4JI1C 1XNQC 1MDBA 4LF9C 1MKYA 1IBMC 2ASBA 1ZB8A 1O9TA 4DV1C 4JI8C 3PROC 4XX2A 5K8FA 2MCQA 2AYAA 1J5EC 1JOSA 3ETOA 2D1TA 5T8SA 1WH9A 4D4IA 3J81D 4FTFA 1O90A 1HNZC 3OTOC 3O2EA 3CW9A 3IEUA 4DCVA 1YJ7A 1XNRC 4MTNA 2P2QA 3L8CA 4DCSA 1MDFA 3L95X 3FCCA 4R0MA 4IR7A 4KHPC 2KZFA 3EQ6A 1HR0C 4NOZA 2CXCA 3TR3A 2D1RA 1QWIA 1HNXC 4DV7C 4ZJZA 3PESA 1IB8A 5ADZA 2Z51A 4G36A 4NXMC 3NYRA 2QVXX 4GXRA 4LF8C 2OBVA 4D56A 2F4VC 1MXBA 3LAXA 4DG9A 3GPCA 5KEIA 1ML8A 5AE1A 4X66C 4X65C 4G1IA 4EATA 4I9FA 1EGAA 4LFBC 4R1MA 3J80D 3LNVA 2YWCA 2Y27A 4B3TC 1P4EA 4LF6C 1XRBA 4DR1C 1USPB 3A26A 4HPVA 2MMAB 4DV2C 5K85A 1RY2A 3RG2A 3B7WA 4JM1A 1MD9A 4B3RC 4OX9C 3A4IA 1LCIA 3DHVA 4JI7C 4LF5C 5H9UA 1N2FA 5BURA 2WD9A 3VNSA 5IWAC 4ZLPA 4DR2C 2DPLA 2OPLB 3I08A 4LF4C 4NXNC 2KZ0A 3UX3A 1NYEA 4NDNA 2BH1X 4RM3A 1N34C 4DV3C 2EGTA 3R44A 3UZ0A 1XS3A 4BC9A 2P02A 3LUSA 2OO4A 4RLFA 2QL8A 2E8CA 1HNWC 2E0GA 4JI0C 5BUSA 1NY8A 1XRCA 5T8TA 4B3MC 4JI6C 3DAYA 1GPMA 3LNOA 5JRHA 1FUGA 3SO4A 2P2BA 3DLPX 2UXBC 3RV2A
chains in the Genus database with same CATH topology
4IZ6A 1WF3A 3T1YC 4X62C 4JYAC 1L2FA 2UU9C 3TUFA 4L4QA 5A19A 4GXQA 5FLXD 4BBYA 2YWBA 2P2FA 4FUTA 4R1LA 2D27A 4D57A 3C5EA 4RMNA 3IEVA 5AE2A 5A1IA 2PROA 1IBLC 4KTTA 2UXDC 1XRAA 2BJOA 3AF5A 1RG9A 5E7QA 2D28C 1MXCA 1O93A 3NI2A 1N32C 3A9VA 2V7BA 2VSQA 3EERA 3FCEA 4BSZA 5BUQA 3PBKA 4ISBA 4WV3A 4RLQA 5BSRA 3I07A 1LQLA 1P7LA 2HJGA 2Y4NA 3R9XA 3R9WA 4WS9A 3GKUA 2VZEA 2E5LC 4LE5A 4PZPA 1N36C 4JI3C 2E8EA 4RVNA 4GS5A 2UUCC 4PROC 4K0BA 1QM4A 3N2QA 1KKGA 2D1QA 2E8FA 3LGXA 3JAMD 4DCTA 4BC7A 1T5HX 3A9UA 4G37A 2YCBA 4GKJC 4LFAC 2VQEC 5KYTA 2VQFC 5BR8C 4DG8A 5A2QD 2E7GA 3NPDA 3ETCA 2UXCC 2OPLA 4FUQA 4JI4C 2PN2A 4DV5C 4L2ZA 1UKKA 5IT9D 4DR5C 4DR7C 2P2MA 4DR3C 5GTDA 3NYQA 1BA3A 1V25A 5BSVA 4U5YD 4AQYC 2UUAC 2D1SA 4DCUA 4TPSB 2QVYX 1HH2P 4ODJA 1XMOC 3IMLA 3UOWA 4RVOA 1MXAA 1VLAA 1O92A 4LFCC 4GKKC 2QVZX 4X64C 3N54B 4K0KC 1I94C 1FJGC 1K0RA 2XR1A 1V26A 4JI2C 1T5DX 2ZM6C 5CZXA 1AMUA 4YY3C 3E7WA 2PT7G 2ATWA 4DR6C 2HHHC 3AF6A 3CJEA 5LMUC 4JI5C 5BSMA 3GR1A 1USPA 4YHHC 4OXIA 2ONFA 4MH4A 5CZVA 1PG3A 3KXWA 4DV6C 4L7IA 3VNQA 4DR4C 3IPLA 5BSTA 5BSUA 4BCAA 2WP0C 4DUZC 4B3SC 1PG4A 2JMPA 3GR0A 4JV5C 1ZB9A 2DYJA 1N33C 2P2JA 5A1GA 4I9GA 5KYVA 4D4GA 4KTVA 5IFIA 3TDEA 3TQIA 1PA4A 2UUBC 3G7SA 4LF7C 2QW0X 3H2TA 1XMQC 1IBKC 4RM2A 4DV4C 4DUYC 4OYCA 4DV0C 5BSWA 2D7VA 5AE3A 2Y4OA 1ULTA 3S82A 3VNRA 4PHTA 2CY1A 3E7XA 2P20A 3CW8X 5DV9A 5LMNC 3T1HC 4JI1C 1XNQC 1MDBA 4LF9C 1MKYA 1IBMC 2ASBA 1ZB8A 1O9TA 4DV1C 4JI8C 3PROC 4XX2A 5K8FA 2AYAA 1J5EC 1JOSA 3ETOA 2D1TA 5T8SA 1WH9A 4D4IA 3J81D 4FTFA 1O90A 1HNZC 3OTOC 3CW9A 3IEUA 4DCVA 1YJ7A 1XNRC 4MTNA 2P2QA 3L8CA 1MDFA 4DCSA 3L95X 3FCCA 4R0MA 4IR7A 4KHPC 2KZFA 3EQ6A 1HR0C 4NOZA 2CXCA 2D1RA 1QWIA 1HNXC 4DV7C 4ZJZA 3PESA 5ADZA 4G36A 4NXMC 3NYRA 2QVXX 4GXRA 4LF8C 2OBVA 4D56A 2F4VC 1MXBA 3LAXA 4DG9A 3GPCA 5KEIA 1ML8A 5AE1A 4X66C 4X65C 4G1IA 4EATA 4I9FA 1EGAA 4LFBC 4R1MA 3J80D 3LNVA 2YWCA 2Y27A 4B3TC 4LF6C 1XRBA 4DR1C 1USPB 4HPVA 5K85A 1RY2A 4DV2C 3RG2A 3B7WA 4JM1A 1MD9A 4B3RC 4OX9C 3A4IA 1LCIA 3DHVA 4JI7C 4LF5C 5H9UA 1N2FA 5BURA 2WD9A 3VNSA 5IWAC 4ZLPA 4DR2C 2DPLA 2OPLB 3I08A 4LF4C 4NXNC 1NYEA 4NDNA 2BH1X 4RM3A 1N34C 4DV3C 2EGTA 3R44A 3UZ0A 4BC9A 2P02A 3LUSA 2OO4A 4RLFA 2QL8A 2E8CA 1HNWC 2E0GA 4JI0C 5BUSA 1XRCA 5T8TA 4B3MC 4JI6C 3DAYA 1GPMA 5JRHA 1FUGA 3SO4A 2P2BA 3DLPX 2UXBC 3RV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKK A;  5IT9 D;  1WF3 A;  3T1Y C;  4X62 C;  4JYA C;  1L2F A;  1PA4 A;  1ML8 A;  4DR5 C;  2UU9 C;  2UUB C;  4X66 C;  4X65 C;  1IBK C;  1XMQ C;  4LF7 C;  1EGA A;  4DR7 C;  4LFB C;  4DV4 C;  4DR3 C;  4DUY C;  3J80 D;  4DV0 C;  5FLX D;  2D7V A;  4B3T C;  4AQY C;  2UUA C;  4DCU A;  4LF6 C;  4DR1 C;  2CY1 A;  1USP B;  3IEV A;  4DV2 C;  1HH2 P;  1IBL C;  1XMO C;  2UXD C;  2BJO A;  3AF5 A;  5LMN C;  4B3R C;  3T1H C;  4OX9 C;  4JI1 C;  1XNQ C;  1VLA A;  4LFC C;  4GKK C;  4LF9 C;  1MKY A;  1N32 C;  4X64 C;  1IBM C;  3EER A;  4K0K C;  4BSZ A;  1I94 C;  2ASB A;  1ZB8 A;  1K0R A;  1FJG C;  2XR1 A;  4DV1 C;  4JI8 C;  4JI7 C;  4LF5 C;  4XX2 A;  4JI2 C;  2ZM6 C;  1N2F A;  1LQL A;  3I07 A;  1J5E C;  1JOS A;  2HJG A;  4YY3 C;  3R9X A;  2PT7 G;  2ATW A;  3R9W A;  4DR6 C;  5IWA C;  2HHH C;  3AF6 A;  3CJE A;  1WH9 A;  3GKU A;  5LMU C;  2E5L C;  4JI5 C;  4DR2 C;  2OPL B;  1N36 C;  3J81 D;  1USP A;  4YHH C;  1HNZ C;  4JI3 C;  2E8E A;  4LF4 C;  4NXN C;  3OTO C;  2ONF A;  4MH4 A;  3IEU A;  1NYE A;  4DCV A;  1XNR C;  4MTN A;  4DV6 C;  2UUC C;  4DR4 C;  1N34 C;  4DV3 C;  2EGT A;  4DCS A;  1KKG A;  2E8F A;  4KHP C;  4DCT A;  3JAM D;  3LUS A;  2KZF A;  4DUZ C;  4B3S C;  2QL8 A;  2E8C A;  4NOZ A;  1HR0 C;  2CXC A;  1HNW C;  2YCB A;  2JMP A;  1QWI A;  1HNX C;  4JV5 C;  4JI0 C;  4DV7 C;  4GKJ C;  4LFA C;  2VQE C;  1ZB9 A;  2VQF C;  5BR8 C;  4B3M C;  4JI6 C;  2DYJ A;  2E7G A;  5A2Q D;  4NXM C;  1N33 C;  4LF8 C;  2F4V C;  2UXC C;  2OPL A;  4JI4 C;  2PN2 A;  2UXB C;  4DV5 C; 
#chains in the Genus database with same CATH topology
 4IZ6 A;  1WF3 A;  3T1Y C;  4X62 C;  4JYA C;  1L2F A;  2UU9 C;  3TUF A;  4L4Q A;  5A19 A;  4GXQ A;  5FLX D;  4BBY A;  2YWB A;  2P2F A;  4FUT A;  4R1L A;  2D27 A;  4D57 A;  1M6X C;  3C5E A;  3CQ2 A;  4RMN A;  3IEV A;  5AE2 A;  5A1I A;  2PRO A;  1IBL C;  4KTT A;  2UXD C;  1XRA A;  2BJO A;  3AF5 A;  1RG9 A;  5E7Q A;  2D28 C;  1XHJ A;  1MXC A;  1O93 A;  3NI2 A;  1N32 C;  3A9V A;  2V7B A;  2VSQ A;  3EER A;  3FCE A;  4BSZ A;  5BUQ A;  1M6X A;  3PBK A;  1FLO A;  4ISB A;  4WV3 A;  4RLQ A;  5BSR A;  3I07 A;  1LQL A;  1P7L A;  1P4E C;  2M5O A;  2HJG A;  2DHM A;  2Y4N A;  3R9X A;  3R9W A;  4WS9 A;  3GKU A;  2VZE A;  2E5L C;  4LE5 A;  4PZP A;  1N36 C;  4JI3 C;  2E8E A;  4RVN A;  4GS5 A;  2UUC C;  4PRO C;  4K0B A;  2KDN A;  1QM4 A;  3N2Q A;  1KKG A;  2D1Q A;  2E8F A;  3LGX A;  3JAM D;  4DCT A;  4BC7 A;  1T5H X;  3AY0 A;  3A9U A;  4G37 A;  2YCB A;  4GKJ C;  4LFA C;  2VQE C;  5KYT A;  2VQF C;  5BR8 C;  4DG8 A;  3UX2 A;  2E7G A;  1VEH A;  5A2Q D;  2ZZM A;  3NPD A;  3ETC A;  2UXC C;  2OPL A;  4FUQ A;  4JI4 C;  2PN2 A;  4DV5 C;  4L2Z A;  1PU1 A;  2JNV A;  2YX1 A;  1UKK A;  5IT9 D;  4DR5 C;  4DR7 C;  2P2M A;  4DR3 C;  5GTD A;  3NYQ A;  1BA3 A;  4PUH A;  1V25 A;  5BSV A;  4U5Y D;  1TH5 A;  3CQ3 A;  4AQY C;  2UUA C;  2D1S A;  4DCU A;  4TPS B;  2QVY X;  2MM9 A;  1HH2 P;  2CU6 A;  4ODJ A;  1XMO C;  3IML A;  3UOW A;  4RVO A;  1MXA A;  1VLA A;  1O92 A;  4LFC C;  4GKK C;  2QVZ X;  4X64 C;  3N54 B;  4K0K C;  1I94 C;  1FJG C;  1K0R A;  3CQ1 A;  2XR1 A;  1V26 A;  4JI2 C;  1T5D X;  1V60 A;  2ZM6 C;  5CZX A;  1AMU A;  2M5H A;  4YY3 C;  3E7W A;  2PT7 G;  2ATW A;  4DR6 C;  3K6R A;  2HHH C;  3AF6 A;  3CJE A;  5LMU C;  4JI5 C;  5BSM A;  3GR1 A;  1USP A;  4YHH C;  4OXI A;  2ONF A;  4MH4 A;  5CZV A;  1PG3 A;  3KXW A;  4DV6 C;  4L7I A;  3VNQ A;  4DR4 C;  3IPL A;  5BST A;  5BSU A;  5LCI A;  4BCA A;  2WP0 C;  4DUZ C;  4B3S C;  1PG4 A;  2JMP A;  3GR0 A;  2ZZN A;  4JV5 C;  4PUI A;  1ZB9 A;  2DYJ A;  1N33 C;  2P2J A;  5A1G A;  4I9G A;  5KYV A;  4D4G A;  4KTV A;  5IFI A;  1WCJ A;  3TDE A;  3TQI A;  1PA4 A;  2NCL A;  3G7S A;  2UUB C;  4LF7 C;  2QW0 X;  3H2T A;  1XMQ C;  1IBK C;  4RM2 A;  4DV4 C;  4PUG A;  4DUY C;  4OYC A;  4DV0 C;  3A25 A;  5BSW A;  2D7V A;  5AE3 A;  2Y4O A;  1ULT A;  3S82 A;  3VNR A;  4PHT A;  2CY1 A;  3E7X A;  2P20 A;  3UEB A;  3CW8 X;  5DV9 A;  5LMN C;  3T1H C;  1UWD A;  4JI1 C;  1XNQ C;  1MDB A;  4LF9 C;  1MKY A;  1IBM C;  2ASB A;  1ZB8 A;  1O9T A;  4DV1 C;  4JI8 C;  3PRO C;  4XX2 A;  5K8F A;  2MCQ A;  2AYA A;  1J5E C;  1JOS A;  3ETO A;  2D1T A;  5T8S A;  1WH9 A;  4D4I A;  3J81 D;  4FTF A;  1O90 A;  1HNZ C;  3OTO C;  3O2E A;  3CW9 A;  3IEU A;  4DCV A;  1YJ7 A;  1XNR C;  4MTN A;  2P2Q A;  3L8C A;  4DCS A;  1MDF A;  3L95 X;  3FCC A;  4R0M A;  4IR7 A;  4KHP C;  2KZF A;  3EQ6 A;  1HR0 C;  4NOZ A;  2CXC A;  3TR3 A;  2D1R A;  1QWI A;  1HNX C;  4DV7 C;  4ZJZ A;  3PES A;  1IB8 A;  5ADZ A;  2Z51 A;  4G36 A;  4NXM C;  3NYR A;  2QVX X;  4GXR A;  4LF8 C;  2OBV A;  4D56 A;  2F4V C;  1MXB A;  3LAX A;  4DG9 A;  3GPC A;  5KEI A;  1ML8 A;  5AE1 A;  4X66 C;  4X65 C;  4G1I A;  4EAT A;  4I9F A;  1EGA A;  4LFB C;  4R1M A;  3J80 D;  3LNV A;  2YWC A;  2Y27 A;  4B3T C;  1P4E A;  4LF6 C;  1XRB A;  4DR1 C;  1USP B;  3A26 A;  4HPV A;  2MMA B;  4DV2 C;  5K85 A;  1RY2 A;  3RG2 A;  3B7W A;  4JM1 A;  1MD9 A;  4B3R C;  4OX9 C;  3A4I A;  1LCI A;  3DHV A;  4JI7 C;  4LF5 C;  5H9U A;  1N2F A;  5BUR A;  2WD9 A;  3VNS A;  5IWA C;  4ZLP A;  4DR2 C;  2DPL A;  2OPL B;  3I08 A;  4LF4 C;  4NXN C;  2KZ0 A;  3UX3 A;  1NYE A;  4NDN A;  2BH1 X;  4RM3 A;  1N34 C;  4DV3 C;  2EGT A;  3R44 A;  3UZ0 A;  1XS3 A;  4BC9 A;  2P02 A;  3LUS A;  2OO4 A;  4RLF A;  2QL8 A;  2E8C A;  1HNW C;  2E0G A;  4JI0 C;  5BUS A;  1NY8 A;  1XRC A;  5T8T A;  4B3M C;  4JI6 C;  3DAY A;  1GPM A;  3LNO A;  5JRH A;  1FUG A;  3SO4 A;  2P2B A;  3DLP X;  2UXB C;  3RV2 A; 
#chains in the Genus database with same CATH homology
 4IZ6 A;  1WF3 A;  3T1Y C;  4X62 C;  4JYA C;  1L2F A;  2UU9 C;  3TUF A;  4L4Q A;  5A19 A;  4GXQ A;  5FLX D;  4BBY A;  2YWB A;  2P2F A;  4FUT A;  4R1L A;  2D27 A;  4D57 A;  3C5E A;  4RMN A;  3IEV A;  5AE2 A;  5A1I A;  2PRO A;  1IBL C;  4KTT A;  2UXD C;  1XRA A;  2BJO A;  3AF5 A;  1RG9 A;  5E7Q A;  2D28 C;  1MXC A;  1O93 A;  3NI2 A;  1N32 C;  3A9V A;  2V7B A;  2VSQ A;  3EER A;  3FCE A;  4BSZ A;  5BUQ A;  3PBK A;  4ISB A;  4WV3 A;  4RLQ A;  5BSR A;  3I07 A;  1LQL A;  1P7L A;  2HJG A;  2Y4N A;  3R9X A;  3R9W A;  4WS9 A;  3GKU A;  2VZE A;  2E5L C;  4LE5 A;  4PZP A;  1N36 C;  4JI3 C;  2E8E A;  4RVN A;  4GS5 A;  2UUC C;  4PRO C;  4K0B A;  1QM4 A;  3N2Q A;  1KKG A;  2D1Q A;  2E8F A;  3LGX A;  3JAM D;  4DCT A;  4BC7 A;  1T5H X;  3A9U A;  4G37 A;  2YCB A;  4GKJ C;  4LFA C;  2VQE C;  5KYT A;  2VQF C;  5BR8 C;  4DG8 A;  5A2Q D;  2E7G A;  3NPD A;  3ETC A;  2UXC C;  2OPL A;  4FUQ A;  4JI4 C;  2PN2 A;  4DV5 C;  4L2Z A;  1UKK A;  5IT9 D;  4DR5 C;  4DR7 C;  2P2M A;  4DR3 C;  5GTD A;  3NYQ A;  1BA3 A;  1V25 A;  5BSV A;  4U5Y D;  4AQY C;  2UUA C;  2D1S A;  4DCU A;  4TPS B;  2QVY X;  1HH2 P;  4ODJ A;  1XMO C;  3IML A;  3UOW A;  4RVO A;  1MXA A;  1VLA A;  1O92 A;  4LFC C;  4GKK C;  2QVZ X;  4X64 C;  3N54 B;  4K0K C;  1I94 C;  1FJG C;  1K0R A;  2XR1 A;  1V26 A;  4JI2 C;  1T5D X;  2ZM6 C;  5CZX A;  1AMU A;  4YY3 C;  3E7W A;  2PT7 G;  2ATW A;  4DR6 C;  2HHH C;  3AF6 A;  3CJE A;  5LMU C;  4JI5 C;  5BSM A;  3GR1 A;  1USP A;  4YHH C;  4OXI A;  2ONF A;  4MH4 A;  5CZV A;  1PG3 A;  3KXW A;  4DV6 C;  4L7I A;  3VNQ A;  4DR4 C;  3IPL A;  5BST A;  5BSU A;  4BCA A;  2WP0 C;  4DUZ C;  4B3S C;  1PG4 A;  2JMP A;  3GR0 A;  4JV5 C;  1ZB9 A;  2DYJ A;  1N33 C;  2P2J A;  5A1G A;  4I9G A;  5KYV A;  4D4G A;  4KTV A;  5IFI A;  3TDE A;  3TQI A;  1PA4 A;  2UUB C;  3G7S A;  4LF7 C;  2QW0 X;  3H2T A;  1XMQ C;  1IBK C;  4RM2 A;  4DV4 C;  4DUY C;  4OYC A;  4DV0 C;  5BSW A;  2D7V A;  5AE3 A;  2Y4O A;  1ULT A;  3S82 A;  3VNR A;  4PHT A;  2CY1 A;  3E7X A;  2P20 A;  3CW8 X;  5DV9 A;  5LMN C;  3T1H C;  4JI1 C;  1XNQ C;  1MDB A;  4LF9 C;  1MKY A;  1IBM C;  2ASB A;  1ZB8 A;  1O9T A;  4DV1 C;  4JI8 C;  3PRO C;  4XX2 A;  5K8F A;  2AYA A;  1J5E C;  1JOS A;  3ETO A;  2D1T A;  5T8S A;  1WH9 A;  4D4I A;  3J81 D;  4FTF A;  1O90 A;  1HNZ C;  3OTO C;  3CW9 A;  3IEU A;  4DCV A;  1YJ7 A;  1XNR C;  4MTN A;  2P2Q A;  3L8C A;  1MDF A;  4DCS A;  3L95 X;  3FCC A;  4R0M A;  4IR7 A;  4KHP C;  2KZF A;  3EQ6 A;  1HR0 C;  4NOZ A;  2CXC A;  2D1R A;  1QWI A;  1HNX C;  4DV7 C;  4ZJZ A;  3PES A;  5ADZ A;  4G36 A;  4NXM C;  3NYR A;  2QVX X;  4GXR A;  4LF8 C;  2OBV A;  4D56 A;  2F4V C;  1MXB A;  3LAX A;  4DG9 A;  3GPC A;  5KEI A;  1ML8 A;  5AE1 A;  4X66 C;  4X65 C;  4G1I A;  4EAT A;  4I9F A;  1EGA A;  4LFB C;  4R1M A;  3J80 D;  3LNV A;  2YWC A;  2Y27 A;  4B3T C;  4LF6 C;  1XRB A;  4DR1 C;  1USP B;  4HPV A;  5K85 A;  1RY2 A;  4DV2 C;  3RG2 A;  3B7W A;  4JM1 A;  1MD9 A;  4B3R C;  4OX9 C;  3A4I A;  1LCI A;  3DHV A;  4JI7 C;  4LF5 C;  5H9U A;  1N2F A;  5BUR A;  2WD9 A;  3VNS A;  5IWA C;  4ZLP A;  4DR2 C;  2DPL A;  2OPL B;  3I08 A;  4LF4 C;  4NXN C;  1NYE A;  4NDN A;  2BH1 X;  4RM3 A;  1N34 C;  4DV3 C;  2EGT A;  3R44 A;  3UZ0 A;  4BC9 A;  2P02 A;  3LUS A;  2OO4 A;  4RLF A;  2QL8 A;  2E8C A;  1HNW C;  2E0G A;  4JI0 C;  5BUS A;  1XRC A;  5T8T A;  4B3M C;  4JI6 C;  3DAY A;  1GPM A;  5JRH A;  1FUG A;  3SO4 A;  2P2B A;  3DLP X;  2UXB C;  3RV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...