2E7GA

Solution structure of putative ribosome-binding factor a (rbfa) from human mutochondrial precursor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ribosome-binding factor A
publication title Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e7gA01
2PT7G 1IBMC 1MKYA 2E8FA 4JI6C 2VQFC 4JI1C 4NOZA 4DV7C 4DV3C 2ZM6C 1N32C 4LFAC 4DCUA 3CJEA 1HNXC 1N36C 4MH4A 2UUCC 2F4VC 4DR4C 2UXCC 2UUBC 4JI2C 4JI3C 4YY3C 1HNZC 4BSZA 1XNRC 4DV2C 4DCTA 2UUAC 1NYEA 2ATWA 3IEUA 1UKKA 4LF8C 3JAMD 1USPB 1J5EC 2OPLB 4AQYC 4DR6C 4DCVA 1USPA 2CXCA 1N34C 2OPLA 2DYJA 1HH2P 2KZFA 4B3TC 5LMUC 2HHHC 2E7GA 2E8EA 4JI0C 4DCSA 2E5LC 2UXBC 2PN2A 4MTNA 4JYAC 2VQEC 2ASBA 1XMQC 3I07A 4XX2A 4JI4C 4X66C 1VLAA 4OX9C 1K0RA 1KKGA 5A2QD 4B3RC 3J80D 2UU9C 4JI7C 1XNQC 4DR7C 1WH9A 1FJGC 3IEVA 3J81D 2D7VA 4NXNC 2EGTA 5FLXD 1ML8A 4LF5C 4X64C 4DV5C 3R9XA 1LQLA 1IBLC 4DR2C 4JV5C 2QL8A 4X65C 5BR8C 2ONFA 4DUYC 4DR3C 2JMPA 2CY1A 3AF5A 1XMOC 4YHHC 2BJOA 4GKJC 3OTOC 1JOSA 4DV0C 5IT9D 4DV4C 1HR0C 5LMNC 4DUZC 4B3SC 3LUSA 3T1YC 1L2FA 4LFCC 1EGAA 3GKUA 5IWAC 4B3MC 2E8CA 3R9WA 4DR1C 4DV6C 1IBKC 4LF6C 2UXDC 4K0KC 4LF7C 3EERA 2HJGA 4JI5C 2YCBA 4LFBC 4X62C 4DV1C 1I94C 1QWIA 3T1HC 4LF9C 4GKKC 1ZB8A 1N2FA 1HNWC 4JI8C 4KHPC 1ZB9A 4NXMC 1WF3A 2XR1A 3AF6A 4DR5C 1PA4A 1N33C 4LF4C
chains in the Genus database with same CATH superfamily
3CJEA 5T8SA 1O92A 1MD9A 1P4EC 4YY3C 4BSZA 4PZPA 4D57A 1XNRC 2UUAC 4ODJA 1YJ7A 4DR6C 4EATA 2CXCA 4DG9A 2DYJA 5LMUC 2WP0C 3A9VA 1V60A 2E5LC 3VNSA 2UXBC 3RV2A 4JYAC 4PUHA 3I07A 4XX2A 5BSRA 5IFIA 4OX9C 1K0RA 1XS3A 4K0BA 3IMLA 3KXWA 3R9XA 1PG3A 2QVZX 5BR8C 4GS5A 1XRCA 1M6XC 4DR3C 2JMPA 3AF5A 2V7BA 4YHHC 2DHMA 3OTOC 5IT9D 5ADZA 1HR0C 4DUZC 4NDNA 5KEIA 3FCCA 5LCIA 3LUSA 3VNRA 3T1YC 1MDFA 5BURA 3GKUA 5AE3A 3UX2A 3R9WA 3PESA 4DR1C 3CW8X 4DV6C 4D56A 3LGXA 3E7WA 3EQ6A 2QW0X 3GR0A 4LF7C 4K0KC 4R1MA 3EERA 1O90A 2HJGA 4JI5C 3N54B 2YCBA 4LFBC 4RLFA 1I94C 2D1RA 1QWIA 3T1HC 4GKKC 1ZB8A 4L7IA 5BUQA 1ZB9A 2D1SA 5E7QA 2YX1A 3UX3A 2MMAB 3DLPX 3AF6A 2ZZNA 1MKYA 4PUGA 2D28C 1FLOA 2ZM6C 4LFAC 4DCUA 1HNXC 1N36C 4DR4C 1MXCA 2F4VC 2CU6A 5CZVA 4JI2C 3R44A 4JI3C 2M5HA 4GXRA 4DV2C 4DCTA 1ULTA 1NYEA 3LAXA 2ATWA 3IEUA 3JAMD 1RY2A 1J5EC 4L2ZA 2M5OA 4RM2A 4DCVA 3L95X 1N34C 4JI0C 4R0MA 2YWCA 3A4IA 4BC9A 4FUTA 3A26A 2VQEC 1UWDA 4RM3A 4X66C 3VNQA 1KKGA 5A1GA 3J80D 2UU9C 2D27A 4ZJZA 3LNOA 1WH9A 2DPLA 3ETOA 3NPDA 4RVOA 3IEVA 3J81D 1QM4A 5FLXD 1ML8A 4LF5C 4DV5C 1LQLA 2P02A 5K85A 2MCQA 4D4GA 4JV5C 4X65C 2ONFA 2VZEA 4IR7A 5CZXA 4DUYC 2NCLA 3DAYA 4BCAA 4G36A 2BJOA 4G1IA 4DV0C 2P2JA 3SO4A 1FUGA 4B3SC 1O93A 4LFCC 5IWAC 1WCJA 2WD9A 5T8TA 1IBKC 1P4EA 2OBVA 4ISBA 3H2TA 4L4QA 5BSMA 3TR3A 4TPSB 4DV1C 4LF9C 5BSTA 3CQ2A 2QVXX 1V25A 4D4IA 1N33C 4PHTA 2E8FA 2VQFC 4JI1C 2KZ0A 4DV7C 5K8FA 4I9FA 1N32C 3IPLA 5BSWA 4MH4A 2UUCC 2E0GA 2UXCC 2UUBC 1O9TA 3UZ0A 2VSQA 4OYCA 5A1IA 4IZ6A 4KTVA 3A25A 2MM9A 5AE2A 4LF8C 1USPB 5A19A 2OPLB 5BSUA 4AQYC 1T5HX 2KZFA 2E7GA 5KYVA 2OO4A 1M6XA 4DCSA 3AY0A 2PN2A 1XRBA 1XMQC 1PG4A 2PROA 4JI4C 1VLAA 5A2QD 3ETCA 4DR7C 2BH1X 1FJGC 4RLQA 2Y27A 3N2QA 2D1QA 4NXNC 3A9UA 2EGTA 3C5EA 4DR2C 4ZLPA 3I08A 5H9UA 3UEBA 2CY1A 3TQIA 1XMOC 1T5DX 4LE5A 3K6RA 4GXQA 5LMNC 4FTFA 1MXAA 1XRAA 4JM1A 3CQ3A 3G7SA 4PUIA 1AMUA 4RMNA 3DHVA 1RG9A 4RVNA 1BA3A 1P7LA 1NY8A 3PROC 1HNWC 3S82A 2JNVA 4OXIA 3CW9A 4NXMC 4WS9A 4BBYA 3LNVA 4LF4C 2PT7G 4U5YD 1IBMC 4BC7A 4JI6C 2Y4NA 4NOZA 4DV3C 1MDBA 3B7WA 4G37A 1HNZC 5BSVA 1UKKA 1TH5A 2ZZMA 2P2BA 1USPA 2P2QA 2OPLA 1HH2P 4B3TC 1VEHA 2HHHC 3TDEA 2E8EA 3GPCA 4HPVA 2AYAA 1IB8A 4MTNA 2ASBA 3PBKA 5DV9A 3L8CA 2QVYX 3UOWA 4B3RC 2YWBA 4JI7C 1XNQC 1GPMA 5JRHA 2P2MA 2D7VA 4X64C 1IBLC 2QL8A 1LCIA 2P20A 3O2EA 1PU1A 4GKJC 1JOSA 5BUSA 4DV4C 2Z51A 3FCEA 3NI2A 2P2FA 5GTDA 1XHJA 3NYQA 1L2FA 2D1TA 4KTTA 1EGAA 5KYTA 4B3MC 2E8CA 4I9GA 4WV3A 4LF6C 3NYRA 2UXDC 3E7XA 3GR1A 3RG2A 1V26A 2Y4OA 4DG8A 3TUFA 4FUQA 4X62C 4R1LA 1MXBA 1N2FA 4JI8C 2KDNA 4KHPC 3CQ1A 5AE1A 1WF3A 2XR1A 4DR5C 4PROC 1PA4A
chains in the Genus database with same CATH topology
3CJEA 5T8SA 1O92A 1MD9A 4YY3C 4BSZA 4PZPA 4D57A 1XNRC 2UUAC 4ODJA 1YJ7A 4DR6C 4EATA 2CXCA 4DG9A 2DYJA 5LMUC 2WP0C 3A9VA 2E5LC 3VNSA 2UXBC 3RV2A 4JYAC 3I07A 4XX2A 5BSRA 5IFIA 4OX9C 1K0RA 4K0BA 3IMLA 3KXWA 3R9XA 1PG3A 2QVZX 5BR8C 4GS5A 1XRCA 4DR3C 2JMPA 3AF5A 2V7BA 4YHHC 3OTOC 5IT9D 5ADZA 1HR0C 4DUZC 4NDNA 5KEIA 3FCCA 3LUSA 3VNRA 3T1YC 1MDFA 5BURA 3GKUA 5AE3A 3R9WA 4DR1C 3PESA 3CW8X 4DV6C 4D56A 3LGXA 3E7WA 3EQ6A 2QW0X 3GR0A 4LF7C 4K0KC 4R1MA 3EERA 1O90A 2HJGA 4JI5C 3N54B 2YCBA 4LFBC 4RLFA 1I94C 2D1RA 1QWIA 3T1HC 4GKKC 1ZB8A 4L7IA 5BUQA 1ZB9A 2D1SA 5E7QA 3DLPX 3AF6A 1MKYA 2D28C 2ZM6C 4LFAC 4DCUA 1HNXC 1N36C 4DR4C 1MXCA 2F4VC 5CZVA 4JI2C 3R44A 4JI3C 4GXRA 4DV2C 4DCTA 1ULTA 1NYEA 3LAXA 2ATWA 3IEUA 3JAMD 1RY2A 1J5EC 4L2ZA 4RM2A 4DCVA 3L95X 1N34C 4JI0C 4R0MA 2YWCA 3A4IA 4BC9A 4FUTA 2VQEC 4RM3A 4X66C 3VNQA 1KKGA 5A1GA 3J80D 2UU9C 2D27A 4ZJZA 1WH9A 2DPLA 3ETOA 3NPDA 4RVOA 3IEVA 3J81D 1QM4A 5FLXD 1ML8A 4LF5C 4DV5C 1LQLA 2P02A 5K85A 4D4GA 4JV5C 4X65C 2ONFA 2VZEA 4IR7A 5CZXA 4DUYC 3DAYA 4BCAA 4G36A 2BJOA 4G1IA 4DV0C 2P2JA 3SO4A 1FUGA 4B3SC 1O93A 4LFCC 5IWAC 2WD9A 5T8TA 1IBKC 2OBVA 4ISBA 3H2TA 4L4QA 5BSMA 4TPSB 4DV1C 4LF9C 5BSTA 2QVXX 1V25A 4D4IA 1N33C 4PHTA 2E8FA 2VQFC 4JI1C 4DV7C 5K8FA 4I9FA 1N32C 3IPLA 5BSWA 4MH4A 2UUCC 2E0GA 2UXCC 2UUBC 1O9TA 3UZ0A 2VSQA 4OYCA 5A1IA 4IZ6A 4KTVA 5AE2A 4LF8C 1USPB 5A19A 2OPLB 5BSUA 4AQYC 1T5HX 2KZFA 2E7GA 5KYVA 2OO4A 4DCSA 2PN2A 1XRBA 1XMQC 1PG4A 2PROA 4JI4C 1VLAA 5A2QD 3ETCA 4DR7C 2BH1X 1FJGC 4RLQA 2Y27A 3N2QA 2D1QA 4NXNC 3A9UA 2EGTA 3C5EA 4DR2C 4ZLPA 3I08A 5H9UA 2CY1A 3TQIA 1XMOC 1T5DX 4LE5A 4GXQA 5LMNC 4FTFA 1MXAA 1XRAA 4JM1A 3G7SA 1AMUA 4RMNA 3DHVA 1RG9A 4RVNA 1BA3A 1P7LA 3PROC 1HNWC 3S82A 4OXIA 3CW9A 4NXMC 4WS9A 4BBYA 3LNVA 4LF4C 2PT7G 4U5YD 1IBMC 4BC7A 4JI6C 2Y4NA 4NOZA 4DV3C 1MDBA 3B7WA 4G37A 1HNZC 5BSVA 1UKKA 2P2BA 1USPA 2P2QA 2OPLA 1HH2P 4B3TC 2HHHC 3TDEA 2E8EA 3GPCA 4HPVA 2AYAA 4MTNA 2ASBA 3PBKA 5DV9A 3L8CA 2QVYX 3UOWA 4B3RC 2YWBA 4JI7C 1XNQC 1GPMA 5JRHA 2P2MA 2D7VA 4X64C 1IBLC 2QL8A 1LCIA 2P20A 4GKJC 1JOSA 5BUSA 4DV4C 3FCEA 3NI2A 2P2FA 5GTDA 3NYQA 1L2FA 2D1TA 4KTTA 1EGAA 5KYTA 4B3MC 2E8CA 4I9GA 4WV3A 4LF6C 3NYRA 2UXDC 3E7XA 3GR1A 3RG2A 1V26A 2Y4OA 4DG8A 3TUFA 4FUQA 4X62C 4R1LA 1MXBA 1N2FA 4JI8C 4KHPC 5AE1A 1WF3A 2XR1A 4DR5C 4PROC 1PA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PT7 G;  1IBM C;  1MKY A;  2E8F A;  4JI6 C;  2VQF C;  4JI1 C;  4NOZ A;  4DV7 C;  4DV3 C;  2ZM6 C;  1N32 C;  4LFA C;  4DCU A;  3CJE A;  1HNX C;  1N36 C;  4MH4 A;  2UUC C;  2F4V C;  4DR4 C;  2UXC C;  2UUB C;  4JI2 C;  4JI3 C;  4YY3 C;  1HNZ C;  4BSZ A;  1XNR C;  4DV2 C;  4DCT A;  2UUA C;  1NYE A;  2ATW A;  3IEU A;  1UKK A;  4LF8 C;  3JAM D;  1USP B;  1J5E C;  2OPL B;  4AQY C;  4DR6 C;  4DCV A;  1USP A;  2CXC A;  1N34 C;  2OPL A;  2DYJ A;  1HH2 P;  2KZF A;  4B3T C;  5LMU C;  2HHH C;  2E7G A;  2E8E A;  4JI0 C;  4DCS A;  2E5L C;  2UXB C;  2PN2 A;  4MTN A;  4JYA C;  2VQE C;  2ASB A;  1XMQ C;  3I07 A;  4XX2 A;  4JI4 C;  4X66 C;  1VLA A;  4OX9 C;  1K0R A;  1KKG A;  5A2Q D;  4B3R C;  3J80 D;  2UU9 C;  4JI7 C;  1XNQ C;  4DR7 C;  1WH9 A;  1FJG C;  3IEV A;  3J81 D;  2D7V A;  4NXN C;  2EGT A;  5FLX D;  1ML8 A;  4LF5 C;  4X64 C;  4DV5 C;  3R9X A;  1LQL A;  1IBL C;  4DR2 C;  4JV5 C;  2QL8 A;  4X65 C;  5BR8 C;  2ONF A;  4DUY C;  4DR3 C;  2JMP A;  2CY1 A;  3AF5 A;  1XMO C;  4YHH C;  2BJO A;  4GKJ C;  3OTO C;  1JOS A;  4DV0 C;  5IT9 D;  4DV4 C;  1HR0 C;  5LMN C;  4DUZ C;  4B3S C;  3LUS A;  3T1Y C;  1L2F A;  4LFC C;  1EGA A;  3GKU A;  5IWA C;  4B3M C;  2E8C A;  3R9W A;  4DR1 C;  4DV6 C;  1IBK C;  4LF6 C;  2UXD C;  4K0K C;  4LF7 C;  3EER A;  2HJG A;  4JI5 C;  2YCB A;  4LFB C;  4X62 C;  4DV1 C;  1I94 C;  1QWI A;  3T1H C;  4LF9 C;  4GKK C;  1ZB8 A;  1N2F A;  1HNW C;  4JI8 C;  4KHP C;  1ZB9 A;  4NXM C;  1WF3 A;  2XR1 A;  3AF6 A;  4DR5 C;  1PA4 A;  1N33 C;  4LF4 C; 
#chains in the Genus database with same CATH topology
 3CJE A;  5T8S A;  1O92 A;  1MD9 A;  1P4E C;  4YY3 C;  4BSZ A;  4PZP A;  4D57 A;  1XNR C;  2UUA C;  4ODJ A;  1YJ7 A;  4DR6 C;  4EAT A;  2CXC A;  4DG9 A;  2DYJ A;  5LMU C;  2WP0 C;  3A9V A;  1V60 A;  2E5L C;  3VNS A;  2UXB C;  3RV2 A;  4JYA C;  4PUH A;  3I07 A;  4XX2 A;  5BSR A;  5IFI A;  4OX9 C;  1K0R A;  1XS3 A;  4K0B A;  3IML A;  3KXW A;  3R9X A;  1PG3 A;  2QVZ X;  5BR8 C;  4GS5 A;  1XRC A;  1M6X C;  4DR3 C;  2JMP A;  3AF5 A;  2V7B A;  4YHH C;  2DHM A;  3OTO C;  5IT9 D;  5ADZ A;  1HR0 C;  4DUZ C;  4NDN A;  5KEI A;  3FCC A;  5LCI A;  3LUS A;  3VNR A;  3T1Y C;  1MDF A;  5BUR A;  3GKU A;  5AE3 A;  3UX2 A;  3R9W A;  3PES A;  4DR1 C;  3CW8 X;  4DV6 C;  4D56 A;  3LGX A;  3E7W A;  3EQ6 A;  2QW0 X;  3GR0 A;  4LF7 C;  4K0K C;  4R1M A;  3EER A;  1O90 A;  2HJG A;  4JI5 C;  3N54 B;  2YCB A;  4LFB C;  4RLF A;  1I94 C;  2D1R A;  1QWI A;  3T1H C;  4GKK C;  1ZB8 A;  4L7I A;  5BUQ A;  1ZB9 A;  2D1S A;  5E7Q A;  2YX1 A;  3UX3 A;  2MMA B;  3DLP X;  3AF6 A;  2ZZN A;  1MKY A;  4PUG A;  2D28 C;  1FLO A;  2ZM6 C;  4LFA C;  4DCU A;  1HNX C;  1N36 C;  4DR4 C;  1MXC A;  2F4V C;  2CU6 A;  5CZV A;  4JI2 C;  3R44 A;  4JI3 C;  2M5H A;  4GXR A;  4DV2 C;  4DCT A;  1ULT A;  1NYE A;  3LAX A;  2ATW A;  3IEU A;  3JAM D;  1RY2 A;  1J5E C;  4L2Z A;  2M5O A;  4RM2 A;  4DCV A;  3L95 X;  1N34 C;  4JI0 C;  4R0M A;  2YWC A;  3A4I A;  4BC9 A;  4FUT A;  3A26 A;  2VQE C;  1UWD A;  4RM3 A;  4X66 C;  3VNQ A;  1KKG A;  5A1G A;  3J80 D;  2UU9 C;  2D27 A;  4ZJZ A;  3LNO A;  1WH9 A;  2DPL A;  3ETO A;  3NPD A;  4RVO A;  3IEV A;  3J81 D;  1QM4 A;  5FLX D;  1ML8 A;  4LF5 C;  4DV5 C;  1LQL A;  2P02 A;  5K85 A;  2MCQ A;  4D4G A;  4JV5 C;  4X65 C;  2ONF A;  2VZE A;  4IR7 A;  5CZX A;  4DUY C;  2NCL A;  3DAY A;  4BCA A;  4G36 A;  2BJO A;  4G1I A;  4DV0 C;  2P2J A;  3SO4 A;  1FUG A;  4B3S C;  1O93 A;  4LFC C;  5IWA C;  1WCJ A;  2WD9 A;  5T8T A;  1IBK C;  1P4E A;  2OBV A;  4ISB A;  3H2T A;  4L4Q A;  5BSM A;  3TR3 A;  4TPS B;  4DV1 C;  4LF9 C;  5BST A;  3CQ2 A;  2QVX X;  1V25 A;  4D4I A;  1N33 C;  4PHT A;  2E8F A;  2VQF C;  4JI1 C;  2KZ0 A;  4DV7 C;  5K8F A;  4I9F A;  1N32 C;  3IPL A;  5BSW A;  4MH4 A;  2UUC C;  2E0G A;  2UXC C;  2UUB C;  1O9T A;  3UZ0 A;  2VSQ A;  4OYC A;  5A1I A;  4IZ6 A;  4KTV A;  3A25 A;  2MM9 A;  5AE2 A;  4LF8 C;  1USP B;  5A19 A;  2OPL B;  5BSU A;  4AQY C;  1T5H X;  2KZF A;  2E7G A;  5KYV A;  2OO4 A;  1M6X A;  4DCS A;  3AY0 A;  2PN2 A;  1XRB A;  1XMQ C;  1PG4 A;  2PRO A;  4JI4 C;  1VLA A;  5A2Q D;  3ETC A;  4DR7 C;  2BH1 X;  1FJG C;  4RLQ A;  2Y27 A;  3N2Q A;  2D1Q A;  4NXN C;  3A9U A;  2EGT A;  3C5E A;  4DR2 C;  4ZLP A;  3I08 A;  5H9U A;  3UEB A;  2CY1 A;  3TQI A;  1XMO C;  1T5D X;  4LE5 A;  3K6R A;  4GXQ A;  5LMN C;  4FTF A;  1MXA A;  1XRA A;  4JM1 A;  3CQ3 A;  3G7S A;  4PUI A;  1AMU A;  4RMN A;  3DHV A;  1RG9 A;  4RVN A;  1BA3 A;  1P7L A;  1NY8 A;  3PRO C;  1HNW C;  3S82 A;  2JNV A;  4OXI A;  3CW9 A;  4NXM C;  4WS9 A;  4BBY A;  3LNV A;  4LF4 C;  2PT7 G;  4U5Y D;  1IBM C;  4BC7 A;  4JI6 C;  2Y4N A;  4NOZ A;  4DV3 C;  1MDB A;  3B7W A;  4G37 A;  1HNZ C;  5BSV A;  1UKK A;  1TH5 A;  2ZZM A;  2P2B A;  1USP A;  2P2Q A;  2OPL A;  1HH2 P;  4B3T C;  1VEH A;  2HHH C;  3TDE A;  2E8E A;  3GPC A;  4HPV A;  2AYA A;  1IB8 A;  4MTN A;  2ASB A;  3PBK A;  5DV9 A;  3L8C A;  2QVY X;  3UOW A;  4B3R C;  2YWB A;  4JI7 C;  1XNQ C;  1GPM A;  5JRH A;  2P2M A;  2D7V A;  4X64 C;  1IBL C;  2QL8 A;  1LCI A;  2P20 A;  3O2E A;  1PU1 A;  4GKJ C;  1JOS A;  5BUS A;  4DV4 C;  2Z51 A;  3FCE A;  3NI2 A;  2P2F A;  5GTD A;  1XHJ A;  3NYQ A;  1L2F A;  2D1T A;  4KTT A;  1EGA A;  5KYT A;  4B3M C;  2E8C A;  4I9G A;  4WV3 A;  4LF6 C;  3NYR A;  2UXD C;  3E7X A;  3GR1 A;  3RG2 A;  1V26 A;  2Y4O A;  4DG8 A;  3TUF A;  4FUQ A;  4X62 C;  4R1L A;  1MXB A;  1N2F A;  4JI8 C;  2KDN A;  4KHP C;  3CQ1 A;  5AE1 A;  1WF3 A;  2XR1 A;  4DR5 C;  4PRO C;  1PA4 A; 
#chains in the Genus database with same CATH homology
 3CJE A;  5T8S A;  1O92 A;  1MD9 A;  4YY3 C;  4BSZ A;  4PZP A;  4D57 A;  1XNR C;  2UUA C;  4ODJ A;  1YJ7 A;  4DR6 C;  4EAT A;  2CXC A;  4DG9 A;  2DYJ A;  5LMU C;  2WP0 C;  3A9V A;  2E5L C;  3VNS A;  2UXB C;  3RV2 A;  4JYA C;  3I07 A;  4XX2 A;  5BSR A;  5IFI A;  4OX9 C;  1K0R A;  4K0B A;  3IML A;  3KXW A;  3R9X A;  1PG3 A;  2QVZ X;  5BR8 C;  4GS5 A;  1XRC A;  4DR3 C;  2JMP A;  3AF5 A;  2V7B A;  4YHH C;  3OTO C;  5IT9 D;  5ADZ A;  1HR0 C;  4DUZ C;  4NDN A;  5KEI A;  3FCC A;  3LUS A;  3VNR A;  3T1Y C;  1MDF A;  5BUR A;  3GKU A;  5AE3 A;  3R9W A;  4DR1 C;  3PES A;  3CW8 X;  4DV6 C;  4D56 A;  3LGX A;  3E7W A;  3EQ6 A;  2QW0 X;  3GR0 A;  4LF7 C;  4K0K C;  4R1M A;  3EER A;  1O90 A;  2HJG A;  4JI5 C;  3N54 B;  2YCB A;  4LFB C;  4RLF A;  1I94 C;  2D1R A;  1QWI A;  3T1H C;  4GKK C;  1ZB8 A;  4L7I A;  5BUQ A;  1ZB9 A;  2D1S A;  5E7Q A;  3DLP X;  3AF6 A;  1MKY A;  2D28 C;  2ZM6 C;  4LFA C;  4DCU A;  1HNX C;  1N36 C;  4DR4 C;  1MXC A;  2F4V C;  5CZV A;  4JI2 C;  3R44 A;  4JI3 C;  4GXR A;  4DV2 C;  4DCT A;  1ULT A;  1NYE A;  3LAX A;  2ATW A;  3IEU A;  3JAM D;  1RY2 A;  1J5E C;  4L2Z A;  4RM2 A;  4DCV A;  3L95 X;  1N34 C;  4JI0 C;  4R0M A;  2YWC A;  3A4I A;  4BC9 A;  4FUT A;  2VQE C;  4RM3 A;  4X66 C;  3VNQ A;  1KKG A;  5A1G A;  3J80 D;  2UU9 C;  2D27 A;  4ZJZ A;  1WH9 A;  2DPL A;  3ETO A;  3NPD A;  4RVO A;  3IEV A;  3J81 D;  1QM4 A;  5FLX D;  1ML8 A;  4LF5 C;  4DV5 C;  1LQL A;  2P02 A;  5K85 A;  4D4G A;  4JV5 C;  4X65 C;  2ONF A;  2VZE A;  4IR7 A;  5CZX A;  4DUY C;  3DAY A;  4BCA A;  4G36 A;  2BJO A;  4G1I A;  4DV0 C;  2P2J A;  3SO4 A;  1FUG A;  4B3S C;  1O93 A;  4LFC C;  5IWA C;  2WD9 A;  5T8T A;  1IBK C;  2OBV A;  4ISB A;  3H2T A;  4L4Q A;  5BSM A;  4TPS B;  4DV1 C;  4LF9 C;  5BST A;  2QVX X;  1V25 A;  4D4I A;  1N33 C;  4PHT A;  2E8F A;  2VQF C;  4JI1 C;  4DV7 C;  5K8F A;  4I9F A;  1N32 C;  3IPL A;  5BSW A;  4MH4 A;  2UUC C;  2E0G A;  2UXC C;  2UUB C;  1O9T A;  3UZ0 A;  2VSQ A;  4OYC A;  5A1I A;  4IZ6 A;  4KTV A;  5AE2 A;  4LF8 C;  1USP B;  5A19 A;  2OPL B;  5BSU A;  4AQY C;  1T5H X;  2KZF A;  2E7G A;  5KYV A;  2OO4 A;  4DCS A;  2PN2 A;  1XRB A;  1XMQ C;  1PG4 A;  2PRO A;  4JI4 C;  1VLA A;  5A2Q D;  3ETC A;  4DR7 C;  2BH1 X;  1FJG C;  4RLQ A;  2Y27 A;  3N2Q A;  2D1Q A;  4NXN C;  3A9U A;  2EGT A;  3C5E A;  4DR2 C;  4ZLP A;  3I08 A;  5H9U A;  2CY1 A;  3TQI A;  1XMO C;  1T5D X;  4LE5 A;  4GXQ A;  5LMN C;  4FTF A;  1MXA A;  1XRA A;  4JM1 A;  3G7S A;  1AMU A;  4RMN A;  3DHV A;  1RG9 A;  4RVN A;  1BA3 A;  1P7L A;  3PRO C;  1HNW C;  3S82 A;  4OXI A;  3CW9 A;  4NXM C;  4WS9 A;  4BBY A;  3LNV A;  4LF4 C;  2PT7 G;  4U5Y D;  1IBM C;  4BC7 A;  4JI6 C;  2Y4N A;  4NOZ A;  4DV3 C;  1MDB A;  3B7W A;  4G37 A;  1HNZ C;  5BSV A;  1UKK A;  2P2B A;  1USP A;  2P2Q A;  2OPL A;  1HH2 P;  4B3T C;  2HHH C;  3TDE A;  2E8E A;  3GPC A;  4HPV A;  2AYA A;  4MTN A;  2ASB A;  3PBK A;  5DV9 A;  3L8C A;  2QVY X;  3UOW A;  4B3R C;  2YWB A;  4JI7 C;  1XNQ C;  1GPM A;  5JRH A;  2P2M A;  2D7V A;  4X64 C;  1IBL C;  2QL8 A;  1LCI A;  2P20 A;  4GKJ C;  1JOS A;  5BUS A;  4DV4 C;  3FCE A;  3NI2 A;  2P2F A;  5GTD A;  3NYQ A;  1L2F A;  2D1T A;  4KTT A;  1EGA A;  5KYT A;  4B3M C;  2E8C A;  4I9G A;  4WV3 A;  4LF6 C;  3NYR A;  2UXD C;  3E7X A;  3GR1 A;  3RG2 A;  1V26 A;  2Y4O A;  4DG8 A;  3TUF A;  4FUQ A;  4X62 C;  4R1L A;  1MXB A;  1N2F A;  4JI8 C;  4KHP C;  5AE1 A;  1WF3 A;  2XR1 A;  4DR5 C;  4PRO C;  1PA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...