2E7GA

Solution structure of putative ribosome-binding factor a (rbfa) from human mutochondrial precursor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Putative ribosome-binding factor A
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e7gA01
2F4VC 3OTOC 4KHPC 5BR8C 3EERA 2VQFC 1WH9A 1HNXC 4LF8C 2OPLA 4JI1C 2UXCC 4DUZC 4K0KC 4JI0C 2PT7G 2E8CA 2UUAC 1XMOC 1K0RA 2YCBA 3J81D 4LFBC 2ZM6C 1ZB9A 2XR1A 1N34C 5A2QD 4DR5C 2D7VA 4DV3C 4JV5C 3I07A 3J80D 2E8FA 2KZFA 4B3RC 1UKKA 4DUYC 2ONFA 5IT9D 1N2FA 3T1HC 3AF6A 2UUCC 5IWAC 4LF7C 1XMQC 2PN2A 1L2FA 2CXCA 3IEVA 4DV5C 4DR2C 2DYJA 4NXMC 4DR3C 4X65C 4YHHC 1IBLC 4JYAC 3AF5A 1HNZC 2ASBA 1N32C 3R9XA 4XX2A 4JI6C 5FLXD 5LMNC 4DCSA 4YY3C 4X62C 1KKGA 5LMUC 1IBMC 1J5EC 1JOSA 1LQLA 4DV2C 4JI4C 4GKKC 1N36C 4AQYC 2HJGA 4DCUA 1USPA 2UUBC 1MKYA 2ATWA 2E8EA 2E5LC 4JI5C 4JI8C 2HHHC 1NYEA 2JMPA 1IBKC 4LF9C 4LFAC 4DV1C 4JI2C 4GKJC 4JI7C 1I94C 1PA4A 4DR6C 4DV7C 4DV0C 4JI3C 4MH4A 1N33C 4MTNA 3IEUA 1HH2P 3T1YC 4LF4C 2QL8A 1XNRC 2UU9C 4LF5C 4X66C 1ML8A 2VQEC 3JAMD 3GKUA 4B3TC 3LUSA 4DR7C 4DV4C 2UXBC 1EGAA 1HNWC 1QWIA 4NOZA 4DR1C 1USPB 4B3SC 2BJOA 4DV6C 2CY1A 3R9WA 2UXDC 4NXNC 1FJGC 4LFCC 2OPLB 4B3MC 4DR4C 2EGTA 1HR0C 4LF6C 1ZB8A 1VLAA 4X64C 1WF3A 1XNQC 4DCTA 4BSZA 4DCVA 4OX9C 2E7GA 3CJEA
chains in the Genus database with same CATH superfamily
5BSWA 3OTOC 1QM4A 4HPVA 3TQIA 2VQFC 2UXCC 4DUZC 1TH5A 2WP0C 1XRCA 2DHMA 5E7QA 1BA3A 5AE2A 2XR1A 4U5YD 3S82A 4IR7A 1V60A 2D7VA 3J80D 2E8FA 3NYRA 4WV3A 2QW0X 3UZ0A 5IT9D 2AYAA 5GTDA 3AF6A 1P4EC 4RMNA 1PG3A 3CQ1A 4I9GA 4ODJA 1XRAA 2DYJA 3TDEA 1MXBA 4X65C 4JYAC 1HNZC 1FUGA 5FLXD 4DCSA 4YY3C 4X62C 5LMUC 4BCAA 1LQLA 4GKKC 1O9TA 1N36C 2HJGA 1USPA 2UUBC 5AE3A 5BSTA 3LAXA 5BSVA 4LFAC 3FCEA 4JI7C 2BH1X 1PA4A 4DV7C 1MDFA 4MTNA 4D4GA 3IEUA 4OXIA 4LF4C 2D27A 2YWBA 4D4IA 5KEIA 4X66C 1V25A 3JAMD 3LUSA 2VSQA 4DR7C 2UXBC 2ZZNA 1QWIA 4DR1C 1O93A 3CQ3A 2CY1A 1IB8A 4B3MC 2P02A 2EGTA 5DV9A 1UWDA 4D56A 4LF6C 1T5HX 2MMAB 4X64C 1WF3A 4DCTA 4L7IA 1M6XA 3RV2A 4L2ZA 4BC7A 2VZEA 5CZVA 3EERA 4R0MA 1WH9A 2OPLA 4LE5A 4K0KC 4JI0C 4K0BA 2QVXX 4G37A 1K0RA 5K85A 5ADZA 3J81D 4L4QA 4KTVA 2ZM6C 1PG4A 1N34C 1XS3A 3A9UA 4JV5C 1FLOA 4B3RC 2YX1A 2P2BA 4RVNA 1V26A 3VNRA 4R1MA 3T1HC 5A1IA 1PU1A 3GR1A 4EATA 3G7SA 1LCIA 3UX3A 1XMQC 5JRHA 2QVZX 5A1GA 4DR3C 5BSUA 2MM9A 1N32C 4TPSB 5H9UA 4JI6C 5LMNC 5AE1A 4GXRA 2M5OA 2KZ0A 1KKGA 1O92A 1IBMC 1J5EC 1JOSA 4WS9A 4AQYC 2P2FA 4DCUA 1ULTA 1MKYA 4GS5A 2E5LC 4JI5C 4G1IA 1NYEA 2JMPA 1IBKC 4LF9C 2D1RA 1GPMA 5BSMA 4GKJC 4RM2A 3CW9A 3E7WA 4BBYA 5A19A 4DR6C 1N33C 3UX2A 4OYCA 4RVOA 4FUTA 3UOWA 4LF5C 3LNOA 3VNQA 2Y4NA 3NI2A 1EGAA 4DG8A 4FUQA 3DHVA 4B3SC 2BJOA 4DV6C 2Z51A 1HR0C 1VLAA 1XNQC 4DCVA 2E7GA 5KYVA 3CJEA 2E0GA 1MDBA 4KHPC 4GXQA 5BR8C 3LGXA 1MXAA 4JI1C 3TR3A 2D1SA 2E8CA 1NY8A 4PROC 2YCBA 4I9FA 2D1QA 4LFBC 3E7XA 1XHJA 4DV3C 3AY0A 4PUHA 3GPCA 1UKKA 2ONFA 4DUYC 4NDNA 3PESA 1N2FA 2WD9A 3DAYA 2UUCC 5IWAC 2PN2A 5KYTA 3R44A 3IEVA 2DPLA 5LCIA 3EQ6A 4DV5C 5T8TA 3N54B 4YHHC 1IBLC 2ASBA 1P7LA 4XX2A 2KDNA 3K6RA 1M6XC 4BC9A 4DV2C 3I08A 2YWCA 3CW8X 3A25A 3KXWA 2ATWA 3A9VA 2HHHC 2P2MA 2PROA 1T5DX 3FCCA 5BURA 4JI2C 3L8CA 3A4IA 4JI3C 4MH4A 3H2TA 3SO4A 5T8SA 1HH2P 1XNRC 3GR0A 2VQEC 1HNWC 3ETOA 1WCJA 4NOZA 2D28C 2QVYX 3A26A 4ZJZA 1FJGC 3DLPX 3CQ2A 4DR4C 1ZB8A 3C5EA 3VNSA 5BUQA 4BSZA 2F4VC 3O2EA 1HNXC 4LF8C 1XRBA 1O90A 2P20A 2PT7G 2M5HA 2UUAC 1XMOC 4G36A 4FTFA 2D1TA 1ZB9A 3IPLA 5IFIA 3PBKA 5A2QD 3N2QA 4DR5C 4ZLPA 4PUGA 4ISBA 2P2JA 3I07A 3NYQA 2KZFA 2P2QA 3L95X 4R1LA 4LF7C 3PROC 1P4EA 1L2FA 2ZZMA 2CXCA 2V7BA 4DR2C 2OBVA 4NXMC 4DG9A 4RLFA 3AF5A 4IZ6A 3R9XA 4PZPA 1RY2A 3ETCA 4RLQA 3IMLA 4RM3A 4JI4C 5CZXA 2E8EA 4JI8C 4JM1A 3TUFA 1MD9A 4DV1C 5BUSA 1MXCA 4D57A 1I94C 1VEHA 3RG2A 4DV0C 4PUIA 5K8FA 3B7WA 3T1YC 2CU6A 2QL8A 2UU9C 2Y4OA 1ML8A 3GKUA 4B3TC 3UEBA 1RG9A 1AMUA 4DV4C 2OO4A 2JNVA 3LNVA 4PHTA 1USPB 1YJ7A 3R9WA 2UXDC 4NXNC 5BSRA 3NPDA 2MCQA 2NCLA 2Y27A 4LFCC 2OPLB 4OX9C 4KTTA
chains in the Genus database with same CATH topology
5BSWA 3OTOC 1QM4A 4HPVA 3TQIA 2VQFC 2UXCC 4DUZC 2WP0C 1XRCA 5E7QA 1BA3A 5AE2A 2XR1A 4U5YD 3S82A 4IR7A 2D7VA 3J80D 2E8FA 3NYRA 4WV3A 2QW0X 3UZ0A 5IT9D 2AYAA 5GTDA 3AF6A 4RMNA 1PG3A 4I9GA 4ODJA 1XRAA 2DYJA 3TDEA 1MXBA 4X65C 4JYAC 1HNZC 1FUGA 5FLXD 4DCSA 4YY3C 4X62C 5LMUC 4BCAA 1LQLA 4GKKC 1O9TA 1N36C 2HJGA 1USPA 2UUBC 5AE3A 5BSTA 3LAXA 5BSVA 4LFAC 3FCEA 4JI7C 2BH1X 1PA4A 4DV7C 1MDFA 4MTNA 4D4GA 3IEUA 4OXIA 4LF4C 2D27A 2YWBA 4D4IA 5KEIA 4X66C 1V25A 3JAMD 3LUSA 2VSQA 4DR7C 2UXBC 1QWIA 4DR1C 1O93A 2CY1A 4B3MC 2P02A 2EGTA 5DV9A 4D56A 4LF6C 1T5HX 4X64C 1WF3A 4DCTA 4L7IA 3RV2A 4L2ZA 4BC7A 2VZEA 5CZVA 3EERA 4R0MA 1WH9A 2OPLA 4LE5A 4K0KC 4JI0C 4K0BA 2QVXX 4G37A 1K0RA 5K85A 5ADZA 3J81D 4L4QA 4KTVA 2ZM6C 1PG4A 1N34C 3A9UA 4JV5C 4B3RC 2P2BA 4RVNA 1V26A 3VNRA 4R1MA 3T1HC 5A1IA 3GR1A 4EATA 3G7SA 1LCIA 1XMQC 5JRHA 2QVZX 5A1GA 4DR3C 5BSUA 1N32C 4TPSB 5H9UA 4JI6C 5LMNC 5AE1A 4GXRA 1KKGA 1O92A 1IBMC 1J5EC 1JOSA 4WS9A 4AQYC 2P2FA 4DCUA 1ULTA 1MKYA 4GS5A 2E5LC 4JI5C 4G1IA 1NYEA 2JMPA 1IBKC 4LF9C 2D1RA 1GPMA 5BSMA 4GKJC 4RM2A 3CW9A 3E7WA 4BBYA 5A19A 4DR6C 1N33C 4OYCA 4RVOA 4FUTA 3UOWA 4LF5C 3VNQA 2Y4NA 3NI2A 1EGAA 4DG8A 4FUQA 3DHVA 4B3SC 2BJOA 4DV6C 1HR0C 1VLAA 1XNQC 4DCVA 2E7GA 5KYVA 3CJEA 2E0GA 1MDBA 4KHPC 4GXQA 5BR8C 3LGXA 1MXAA 4JI1C 2D1SA 2E8CA 4PROC 2YCBA 4I9FA 2D1QA 4LFBC 3E7XA 4DV3C 3GPCA 1UKKA 2ONFA 4DUYC 4NDNA 3PESA 1N2FA 2WD9A 3DAYA 2UUCC 5IWAC 2PN2A 5KYTA 3R44A 3IEVA 2DPLA 3EQ6A 4DV5C 5T8TA 3N54B 4YHHC 1IBLC 2ASBA 1P7LA 4XX2A 4BC9A 4DV2C 3I08A 2YWCA 3CW8X 3KXWA 2ATWA 3A9VA 2HHHC 2P2MA 2PROA 1T5DX 3FCCA 5BURA 4JI2C 3L8CA 3A4IA 4JI3C 4MH4A 3H2TA 3SO4A 5T8SA 1HH2P 1XNRC 3GR0A 2VQEC 1HNWC 3ETOA 4NOZA 2D28C 2QVYX 4ZJZA 1FJGC 3DLPX 4DR4C 1ZB8A 3C5EA 3VNSA 5BUQA 4BSZA 2F4VC 1HNXC 4LF8C 1XRBA 1O90A 2P20A 2PT7G 2UUAC 1XMOC 4G36A 4FTFA 2D1TA 1ZB9A 3IPLA 5IFIA 3PBKA 5A2QD 3N2QA 4DR5C 4ZLPA 4ISBA 2P2JA 3I07A 3NYQA 2KZFA 2P2QA 3L95X 4R1LA 4LF7C 3PROC 1L2FA 2CXCA 2V7BA 4DR2C 2OBVA 4NXMC 4DG9A 4RLFA 3AF5A 4IZ6A 3R9XA 4PZPA 1RY2A 3ETCA 4RLQA 3IMLA 4RM3A 4JI4C 5CZXA 2E8EA 4JI8C 4JM1A 3TUFA 1MD9A 4DV1C 5BUSA 1MXCA 4D57A 1I94C 3RG2A 4DV0C 5K8FA 3B7WA 3T1YC 2QL8A 2UU9C 2Y4OA 1ML8A 3GKUA 4B3TC 1RG9A 1AMUA 4DV4C 2OO4A 3LNVA 4PHTA 1USPB 1YJ7A 3R9WA 2UXDC 4NXNC 5BSRA 3NPDA 2Y27A 4LFCC 2OPLB 4OX9C 4KTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V C;  3OTO C;  4KHP C;  5BR8 C;  3EER A;  2VQF C;  1WH9 A;  1HNX C;  4LF8 C;  2OPL A;  4JI1 C;  2UXC C;  4DUZ C;  4K0K C;  4JI0 C;  2PT7 G;  2E8C A;  2UUA C;  1XMO C;  1K0R A;  2YCB A;  3J81 D;  4LFB C;  2ZM6 C;  1ZB9 A;  2XR1 A;  1N34 C;  5A2Q D;  4DR5 C;  2D7V A;  4DV3 C;  4JV5 C;  3I07 A;  3J80 D;  2E8F A;  2KZF A;  4B3R C;  1UKK A;  4DUY C;  2ONF A;  5IT9 D;  1N2F A;  3T1H C;  3AF6 A;  2UUC C;  5IWA C;  4LF7 C;  1XMQ C;  2PN2 A;  1L2F A;  2CXC A;  3IEV A;  4DV5 C;  4DR2 C;  2DYJ A;  4NXM C;  4DR3 C;  4X65 C;  4YHH C;  1IBL C;  4JYA C;  3AF5 A;  1HNZ C;  2ASB A;  1N32 C;  3R9X A;  4XX2 A;  4JI6 C;  5FLX D;  5LMN C;  4DCS A;  4YY3 C;  4X62 C;  1KKG A;  5LMU C;  1IBM C;  1J5E C;  1JOS A;  1LQL A;  4DV2 C;  4JI4 C;  4GKK C;  1N36 C;  4AQY C;  2HJG A;  4DCU A;  1USP A;  2UUB C;  1MKY A;  2ATW A;  2E8E A;  2E5L C;  4JI5 C;  4JI8 C;  2HHH C;  1NYE A;  2JMP A;  1IBK C;  4LF9 C;  4LFA C;  4DV1 C;  4JI2 C;  4GKJ C;  4JI7 C;  1I94 C;  1PA4 A;  4DR6 C;  4DV7 C;  4DV0 C;  4JI3 C;  4MH4 A;  1N33 C;  4MTN A;  3IEU A;  1HH2 P;  3T1Y C;  4LF4 C;  2QL8 A;  1XNR C;  2UU9 C;  4LF5 C;  4X66 C;  1ML8 A;  2VQE C;  3JAM D;  3GKU A;  4B3T C;  3LUS A;  4DR7 C;  4DV4 C;  2UXB C;  1EGA A;  1HNW C;  1QWI A;  4NOZ A;  4DR1 C;  1USP B;  4B3S C;  2BJO A;  4DV6 C;  2CY1 A;  3R9W A;  2UXD C;  4NXN C;  1FJG C;  4LFC C;  2OPL B;  4B3M C;  4DR4 C;  2EGT A;  1HR0 C;  4LF6 C;  1ZB8 A;  1VLA A;  4X64 C;  1WF3 A;  1XNQ C;  4DCT A;  4BSZ A;  4DCV A;  4OX9 C;  2E7G A;  3CJE A; 
#chains in the Genus database with same CATH topology
 5BSW A;  3OTO C;  1QM4 A;  4HPV A;  3TQI A;  2VQF C;  2UXC C;  4DUZ C;  1TH5 A;  2WP0 C;  1XRC A;  2DHM A;  5E7Q A;  1BA3 A;  5AE2 A;  2XR1 A;  4U5Y D;  3S82 A;  4IR7 A;  1V60 A;  2D7V A;  3J80 D;  2E8F A;  3NYR A;  4WV3 A;  2QW0 X;  3UZ0 A;  5IT9 D;  2AYA A;  5GTD A;  3AF6 A;  1P4E C;  4RMN A;  1PG3 A;  3CQ1 A;  4I9G A;  4ODJ A;  1XRA A;  2DYJ A;  3TDE A;  1MXB A;  4X65 C;  4JYA C;  1HNZ C;  1FUG A;  5FLX D;  4DCS A;  4YY3 C;  4X62 C;  5LMU C;  4BCA A;  1LQL A;  4GKK C;  1O9T A;  1N36 C;  2HJG A;  1USP A;  2UUB C;  5AE3 A;  5BST A;  3LAX A;  5BSV A;  4LFA C;  3FCE A;  4JI7 C;  2BH1 X;  1PA4 A;  4DV7 C;  1MDF A;  4MTN A;  4D4G A;  3IEU A;  4OXI A;  4LF4 C;  2D27 A;  2YWB A;  4D4I A;  5KEI A;  4X66 C;  1V25 A;  3JAM D;  3LUS A;  2VSQ A;  4DR7 C;  2UXB C;  2ZZN A;  1QWI A;  4DR1 C;  1O93 A;  3CQ3 A;  2CY1 A;  1IB8 A;  4B3M C;  2P02 A;  2EGT A;  5DV9 A;  1UWD A;  4D56 A;  4LF6 C;  1T5H X;  2MMA B;  4X64 C;  1WF3 A;  4DCT A;  4L7I A;  1M6X A;  3RV2 A;  4L2Z A;  4BC7 A;  2VZE A;  5CZV A;  3EER A;  4R0M A;  1WH9 A;  2OPL A;  4LE5 A;  4K0K C;  4JI0 C;  4K0B A;  2QVX X;  4G37 A;  1K0R A;  5K85 A;  5ADZ A;  3J81 D;  4L4Q A;  4KTV A;  2ZM6 C;  1PG4 A;  1N34 C;  1XS3 A;  3A9U A;  4JV5 C;  1FLO A;  4B3R C;  2YX1 A;  2P2B A;  4RVN A;  1V26 A;  3VNR A;  4R1M A;  3T1H C;  5A1I A;  1PU1 A;  3GR1 A;  4EAT A;  3G7S A;  1LCI A;  3UX3 A;  1XMQ C;  5JRH A;  2QVZ X;  5A1G A;  4DR3 C;  5BSU A;  2MM9 A;  1N32 C;  4TPS B;  5H9U A;  4JI6 C;  5LMN C;  5AE1 A;  4GXR A;  2M5O A;  2KZ0 A;  1KKG A;  1O92 A;  1IBM C;  1J5E C;  1JOS A;  4WS9 A;  4AQY C;  2P2F A;  4DCU A;  1ULT A;  1MKY A;  4GS5 A;  2E5L C;  4JI5 C;  4G1I A;  1NYE A;  2JMP A;  1IBK C;  4LF9 C;  2D1R A;  1GPM A;  5BSM A;  4GKJ C;  4RM2 A;  3CW9 A;  3E7W A;  4BBY A;  5A19 A;  4DR6 C;  1N33 C;  3UX2 A;  4OYC A;  4RVO A;  4FUT A;  3UOW A;  4LF5 C;  3LNO A;  3VNQ A;  2Y4N A;  3NI2 A;  1EGA A;  4DG8 A;  4FUQ A;  3DHV A;  4B3S C;  2BJO A;  4DV6 C;  2Z51 A;  1HR0 C;  1VLA A;  1XNQ C;  4DCV A;  2E7G A;  5KYV A;  3CJE A;  2E0G A;  1MDB A;  4KHP C;  4GXQ A;  5BR8 C;  3LGX A;  1MXA A;  4JI1 C;  3TR3 A;  2D1S A;  2E8C A;  1NY8 A;  4PRO C;  2YCB A;  4I9F A;  2D1Q A;  4LFB C;  3E7X A;  1XHJ A;  4DV3 C;  3AY0 A;  4PUH A;  3GPC A;  1UKK A;  2ONF A;  4DUY C;  4NDN A;  3PES A;  1N2F A;  2WD9 A;  3DAY A;  2UUC C;  5IWA C;  2PN2 A;  5KYT A;  3R44 A;  3IEV A;  2DPL A;  5LCI A;  3EQ6 A;  4DV5 C;  5T8T A;  3N54 B;  4YHH C;  1IBL C;  2ASB A;  1P7L A;  4XX2 A;  2KDN A;  3K6R A;  1M6X C;  4BC9 A;  4DV2 C;  3I08 A;  2YWC A;  3CW8 X;  3A25 A;  3KXW A;  2ATW A;  3A9V A;  2HHH C;  2P2M A;  2PRO A;  1T5D X;  3FCC A;  5BUR A;  4JI2 C;  3L8C A;  3A4I A;  4JI3 C;  4MH4 A;  3H2T A;  3SO4 A;  5T8S A;  1HH2 P;  1XNR C;  3GR0 A;  2VQE C;  1HNW C;  3ETO A;  1WCJ A;  4NOZ A;  2D28 C;  2QVY X;  3A26 A;  4ZJZ A;  1FJG C;  3DLP X;  3CQ2 A;  4DR4 C;  1ZB8 A;  3C5E A;  3VNS A;  5BUQ A;  4BSZ A;  2F4V C;  3O2E A;  1HNX C;  4LF8 C;  1XRB A;  1O90 A;  2P20 A;  2PT7 G;  2M5H A;  2UUA C;  1XMO C;  4G36 A;  4FTF A;  2D1T A;  1ZB9 A;  3IPL A;  5IFI A;  3PBK A;  5A2Q D;  3N2Q A;  4DR5 C;  4ZLP A;  4PUG A;  4ISB A;  2P2J A;  3I07 A;  3NYQ A;  2KZF A;  2P2Q A;  3L95 X;  4R1L A;  4LF7 C;  3PRO C;  1P4E A;  1L2F A;  2ZZM A;  2CXC A;  2V7B A;  4DR2 C;  2OBV A;  4NXM C;  4DG9 A;  4RLF A;  3AF5 A;  4IZ6 A;  3R9X A;  4PZP A;  1RY2 A;  3ETC A;  4RLQ A;  3IML A;  4RM3 A;  4JI4 C;  5CZX A;  2E8E A;  4JI8 C;  4JM1 A;  3TUF A;  1MD9 A;  4DV1 C;  5BUS A;  1MXC A;  4D57 A;  1I94 C;  1VEH A;  3RG2 A;  4DV0 C;  4PUI A;  5K8F A;  3B7W A;  3T1Y C;  2CU6 A;  2QL8 A;  2UU9 C;  2Y4O A;  1ML8 A;  3GKU A;  4B3T C;  3UEB A;  1RG9 A;  1AMU A;  4DV4 C;  2OO4 A;  2JNV A;  3LNV A;  4PHT A;  1USP B;  1YJ7 A;  3R9W A;  2UXD C;  4NXN C;  5BSR A;  3NPD A;  2MCQ A;  2NCL A;  2Y27 A;  4LFC C;  2OPL B;  4OX9 C;  4KTT A; 
#chains in the Genus database with same CATH homology
 5BSW A;  3OTO C;  1QM4 A;  4HPV A;  3TQI A;  2VQF C;  2UXC C;  4DUZ C;  2WP0 C;  1XRC A;  5E7Q A;  1BA3 A;  5AE2 A;  2XR1 A;  4U5Y D;  3S82 A;  4IR7 A;  2D7V A;  3J80 D;  2E8F A;  3NYR A;  4WV3 A;  2QW0 X;  3UZ0 A;  5IT9 D;  2AYA A;  5GTD A;  3AF6 A;  4RMN A;  1PG3 A;  4I9G A;  4ODJ A;  1XRA A;  2DYJ A;  3TDE A;  1MXB A;  4X65 C;  4JYA C;  1HNZ C;  1FUG A;  5FLX D;  4DCS A;  4YY3 C;  4X62 C;  5LMU C;  4BCA A;  1LQL A;  4GKK C;  1O9T A;  1N36 C;  2HJG A;  1USP A;  2UUB C;  5AE3 A;  5BST A;  3LAX A;  5BSV A;  4LFA C;  3FCE A;  4JI7 C;  2BH1 X;  1PA4 A;  4DV7 C;  1MDF A;  4MTN A;  4D4G A;  3IEU A;  4OXI A;  4LF4 C;  2D27 A;  2YWB A;  4D4I A;  5KEI A;  4X66 C;  1V25 A;  3JAM D;  3LUS A;  2VSQ A;  4DR7 C;  2UXB C;  1QWI A;  4DR1 C;  1O93 A;  2CY1 A;  4B3M C;  2P02 A;  2EGT A;  5DV9 A;  4D56 A;  4LF6 C;  1T5H X;  4X64 C;  1WF3 A;  4DCT A;  4L7I A;  3RV2 A;  4L2Z A;  4BC7 A;  2VZE A;  5CZV A;  3EER A;  4R0M A;  1WH9 A;  2OPL A;  4LE5 A;  4K0K C;  4JI0 C;  4K0B A;  2QVX X;  4G37 A;  1K0R A;  5K85 A;  5ADZ A;  3J81 D;  4L4Q A;  4KTV A;  2ZM6 C;  1PG4 A;  1N34 C;  3A9U A;  4JV5 C;  4B3R C;  2P2B A;  4RVN A;  1V26 A;  3VNR A;  4R1M A;  3T1H C;  5A1I A;  3GR1 A;  4EAT A;  3G7S A;  1LCI A;  1XMQ C;  5JRH A;  2QVZ X;  5A1G A;  4DR3 C;  5BSU A;  1N32 C;  4TPS B;  5H9U A;  4JI6 C;  5LMN C;  5AE1 A;  4GXR A;  1KKG A;  1O92 A;  1IBM C;  1J5E C;  1JOS A;  4WS9 A;  4AQY C;  2P2F A;  4DCU A;  1ULT A;  1MKY A;  4GS5 A;  2E5L C;  4JI5 C;  4G1I A;  1NYE A;  2JMP A;  1IBK C;  4LF9 C;  2D1R A;  1GPM A;  5BSM A;  4GKJ C;  4RM2 A;  3CW9 A;  3E7W A;  4BBY A;  5A19 A;  4DR6 C;  1N33 C;  4OYC A;  4RVO A;  4FUT A;  3UOW A;  4LF5 C;  3VNQ A;  2Y4N A;  3NI2 A;  1EGA A;  4DG8 A;  4FUQ A;  3DHV A;  4B3S C;  2BJO A;  4DV6 C;  1HR0 C;  1VLA A;  1XNQ C;  4DCV A;  2E7G A;  5KYV A;  3CJE A;  2E0G A;  1MDB A;  4KHP C;  4GXQ A;  5BR8 C;  3LGX A;  1MXA A;  4JI1 C;  2D1S A;  2E8C A;  4PRO C;  2YCB A;  4I9F A;  2D1Q A;  4LFB C;  3E7X A;  4DV3 C;  3GPC A;  1UKK A;  2ONF A;  4DUY C;  4NDN A;  3PES A;  1N2F A;  2WD9 A;  3DAY A;  2UUC C;  5IWA C;  2PN2 A;  5KYT A;  3R44 A;  3IEV A;  2DPL A;  3EQ6 A;  4DV5 C;  5T8T A;  3N54 B;  4YHH C;  1IBL C;  2ASB A;  1P7L A;  4XX2 A;  4BC9 A;  4DV2 C;  3I08 A;  2YWC A;  3CW8 X;  3KXW A;  2ATW A;  3A9V A;  2HHH C;  2P2M A;  2PRO A;  1T5D X;  3FCC A;  5BUR A;  4JI2 C;  3L8C A;  3A4I A;  4JI3 C;  4MH4 A;  3H2T A;  3SO4 A;  5T8S A;  1HH2 P;  1XNR C;  3GR0 A;  2VQE C;  1HNW C;  3ETO A;  4NOZ A;  2D28 C;  2QVY X;  4ZJZ A;  1FJG C;  3DLP X;  4DR4 C;  1ZB8 A;  3C5E A;  3VNS A;  5BUQ A;  4BSZ A;  2F4V C;  1HNX C;  4LF8 C;  1XRB A;  1O90 A;  2P20 A;  2PT7 G;  2UUA C;  1XMO C;  4G36 A;  4FTF A;  2D1T A;  1ZB9 A;  3IPL A;  5IFI A;  3PBK A;  5A2Q D;  3N2Q A;  4DR5 C;  4ZLP A;  4ISB A;  2P2J A;  3I07 A;  3NYQ A;  2KZF A;  2P2Q A;  3L95 X;  4R1L A;  4LF7 C;  3PRO C;  1L2F A;  2CXC A;  2V7B A;  4DR2 C;  2OBV A;  4NXM C;  4DG9 A;  4RLF A;  3AF5 A;  4IZ6 A;  3R9X A;  4PZP A;  1RY2 A;  3ETC A;  4RLQ A;  3IML A;  4RM3 A;  4JI4 C;  5CZX A;  2E8E A;  4JI8 C;  4JM1 A;  3TUF A;  1MD9 A;  4DV1 C;  5BUS A;  1MXC A;  4D57 A;  1I94 C;  3RG2 A;  4DV0 C;  5K8F A;  3B7W A;  3T1Y C;  2QL8 A;  2UU9 C;  2Y4O A;  1ML8 A;  3GKU A;  4B3T C;  1RG9 A;  1AMU A;  4DV4 C;  2OO4 A;  3LNV A;  4PHT A;  1USP B;  1YJ7 A;  3R9W A;  2UXD C;  4NXN C;  5BSR A;  3NPD A;  2Y27 A;  4LFC C;  2OPL B;  4OX9 C;  4KTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...