2E7GA

Solution structure of putative ribosome-binding factor a (rbfa) from human mutochondrial precursor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative ribosome-binding factor A
publication title Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor
rcsb
source organism Homo sapiens
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e7gA01
2UU9C 1WF3A 4YY3C 4DV0C 2BJOA 5A2QD 1XMOC 4DR6C 2ONFA 3EERA 1MKYA 4LF7C 2HJGA 2KZFA 1LQLA 3IEUA 3R9XA 1L2FA 2PT7G 1XNQC 5FLXD 3CJEA 1USPB 1EGAA 4DUZC 4JYAC 2CXCA 4MTNA 4B3MC 4JI4C 1N33C 4B3RC 1HNXC 4JI2C 4KHPC 1KKGA 2E7GA 4LFAC 2OPLB 4DR2C 1I94C 2VQFC 2ATWA 4B3SC 2UXBC 4DCSA 1PA4A 4JI1C 2YCBA 1N32C 1ZB8A 1WH9A 2F4VC 1IBKC 3I07A 1N34C 1FJGC 4JI8C 5BR8C 3J80D 4LFCC 4DUYC 2UUAC 2E5LC 5IT9D 4DR5C 1UKKA 1NYEA 2DYJA 3AF6A 2E8EA 4JI5C 3OTOC 4X64C 1HNWC 2UXCC 4LFBC 4DV3C 4AQYC 4LF8C 3IEVA 3JAMD 1VLAA 4JI3C 2PN2A 4X66C 2ZM6C 2UUBC 2UUCC 1XNRC 5IWAC 1HH2P 2E8FA 4DCVA 2XR1A 3GKUA 4YHHC 4DR3C 2HHHC 4X62C 4X65C 3AF5A 3LUSA 4JI0C 2QL8A 1IBLC 2E8CA 1ML8A 1JOSA 4GKJC 4GKKC 2UXDC 4DCTA 4NXMC 1K0RA 2ASBA 3J81D 4DV5C 1HR0C 4JI7C 4DV2C 3T1HC 4B3TC 3R9WA 1ZB9A 4JI6C 4NOZA 2VQEC 5LMUC 4DR4C 4DV7C 4DCUA 5LMNC 1J5EC 2EGTA 4DR7C 2D7VA 4DV1C 1N36C 1XMQC 4DV4C 1IBMC 4LF9C 4BSZA 4XX2A 1N2FA 4DR1C 4K0KC 4LF4C 1USPA 2JMPA 1QWIA 4MH4A 3T1YC 4LF6C 4NXNC 4JV5C 2CY1A 4DV6C 4LF5C 1HNZC 2OPLA 4OX9C
chains in the Genus database with same CATH superfamily
1ULTA 3LGXA 1AMUA 5KYVA 1LCIA 3RG2A 2BJOA 1FUGA 5CZXA 3EERA 4NDNA 1MKYA 3IEUA 3R9XA 2YX1A 1XNQC 2MCQA 4PROC 4JYAC 2CXCA 4B3MC 4JI4C 4FUQA 3S82A 4RVNA 2ATWA 2OPLB 1M6XC 1I94C 2UXBC 4DCSA 4JI1C 1ZB8A 4RLQA 3UZ0A 1FJGC 1MD9A 2D1TA 4L4QA 3TR3A 5BURA 1UKKA 1NYEA 4D56A 3GPCA 4DG8A 3UX3A 3NYQA 1V25A 1HNWC 2OBVA 4LFBC 4DV3C 5BUQA 1IB8A 3H2TA 3I08A 2M5OA 1V60A 1UWDA 4DCVA 5IWAC 2XR1A 2QVYX 4YHHC 4X62C 1YJ7A 3LUSA 4U5YD 4OYCA 5E7QA 1ML8A 1TH5A 4GKKC 2UXDC 4DCTA 1NY8A 2QW0X 3VNQA 5GTDA 4JI7C 2D28C 3E7XA 2E0GA 1RG9A 1ZB9A 4IZ6A 2P2BA 1BA3A 5BSVA 1T5DX 1J5EC 3R44A 2D7VA 4DV4C 1IBMC 4BSZA 2YWBA 4OXIA 4DR1C 4K0KC 4R1LA 2DHMA 2QVZX 1QWIA 5K85A 3T1YC 4I9FA 1FLOA 4LF6C 2CY1A 4DV6C 4KTVA 1WCJA 3DAYA 3E7WA 4DV0C 1V26A 4BCAA 1XRBA 4GXRA 2KZFA 1LQLA 3CJEA 2P2FA 1USPB 1EGAA 3AY0A 2VZEA 4MTNA 4B3RC 1HNXC 4JI2C 4JM1A 1XRAA 1MDBA 2Y27A 4B3SC 3CW9A 1PA4A 1N32C 2MM9A 1WH9A 2F4VC 3B7WA 4DG9A 1N34C 3KXWA 3UX2A 2M5HA 1PU1A 5BSTA 4JI5C 2QVXX 3OTOC 5A19A 4ZLPA 4AQYC 3IEVA 5BSRA 3G7SA 5ADZA 4ODJA 4PZPA 1O9TA 2PN2A 4X66C 2DPLA 4D4GA 4DR3C 3GKUA 1MXAA 4X65C 3GR1A 2QL8A 4L7IA 1JOSA 4GKJC 4RLFA 3PBKA 4WS9A 2P2QA 3J81D 3NI2A 2WD9A 4B3TC 3N2QA 2VQEC 5LMUC 4DR4C 5AE1A 4DV7C 4FTFA 1RY2A 2EGTA 2KDNA 4DV1C 3PROC 1N36C 4LF9C 4XX2A 1N2FA 4LF4C 3UEBA 4PUIA 2MMAB 5IFIA 3A4IA 1VEHA 1HNZC 2OPLA 2D1SA 5K8FA 1P4EA 2UU9C 3PESA 4WV3A 4YY3C 1PG4A 2D1QA 3L95X 5A2QD 1O93A 1XMOC 3VNSA 4RMNA 2HJGA 1GPMA 5AE2A 4D57A 1L2FA 5FLXD 5LCIA 2KZ0A 3A25A 3A9VA 4LFAC 2P2MA 4DR2C 4TPSB 2VQFC 2PROA 1XS3A 2NCLA 2Y4OA 1P4EC 4BC9A 4JI8C 3O2EA 4PUGA 3NYRA 4DUYC 2UUAC 2E5LC 5CZVA 4ZJZA 2CU6A 4GS5A 3FCEA 4IR7A 1VLAA 2ZM6C 2UUBC 1XNRC 4RM2A 2P20A 1HH2P 3CW8X 3DLPX 4RM3A 3N54B 2WP0C 3NPDA 2E8CA 4I9GA 1PG3A 4NXMC 1K0RA 2ASBA 2Z51A 1HR0C 3FCCA 5AE3A 2OO4A 4KTTA 4DV2C 3T1HC 3R9WA 2AYAA 5BSMA 3LAXA 4EATA 4L2ZA 4DCUA 4HPVA 1XMQC 1USPA 2JMPA 4K0BA 1T5HX 3CQ2A 4NXNC 5H9UA 2BH1X 5KEIA 4LF5C 3A26A 4OX9C 2VSQA 5T8TA 1WF3A 5BSUA 1MXBA 4D4IA 5BUSA 3TUFA 5DV9A 3DHVA 3UOWA 3SO4A 4DR6C 2ONFA 4LF7C 4R1MA 2PT7G 2D1RA 4DUZC 1N33C 1QM4A 4LE5A 4KHPC 1KKGA 2E7GA 4BBYA 2YCBA 5A1IA 1MDFA 1IBKC 3I07A 1XRCA 4RVOA 2Y4NA 5BR8C 1O92A 3J80D 4LFCC 1P7LA 3IMLA 5IT9D 4G36A 4DR5C 3RV2A 2ZZNA 2D27A 2DYJA 3AF6A 2E8EA 1O90A 4X64C 2UXCC 3CQ1A 4LF8C 4G1IA 3JAMD 5T8SA 5KYTA 4JI3C 3L8CA 3A9UA 2JNVA 2UUCC 2E8FA 2HHHC 3IPLA 3LNOA 1XHJA 2P2JA 3AF5A 4PUHA 4JI0C 4GXQA 5JRHA 1IBLC 3TDEA 3LNVA 3VNRA 4DV5C 3C5EA 4R0MA 3GR0A 2P02A 4BC7A 4JI6C 4NOZA 5LMNC 4DR7C 3ETCA 3TQIA 3ETOA 5BSWA 2ZZMA 3EQ6A 4FUTA 4G37A 4ISBA 2YWCA 4MH4A 4JV5C 2V7BA 5A1GA 1M6XA 3CQ3A 4PHTA 3K6RA 1MXCA
chains in the Genus database with same CATH topology
1ULTA 3LGXA 1AMUA 5KYVA 1LCIA 3RG2A 2BJOA 1FUGA 5CZXA 3EERA 4NDNA 1MKYA 3IEUA 3R9XA 1XNQC 4PROC 4JYAC 2CXCA 4B3MC 4JI4C 4FUQA 3S82A 4RVNA 2ATWA 2OPLB 2UXBC 1I94C 4DCSA 4JI1C 1ZB8A 4RLQA 3UZ0A 1FJGC 1MD9A 2D1TA 4L4QA 5BURA 1UKKA 1NYEA 4D56A 3GPCA 4DG8A 3NYQA 1V25A 1HNWC 2OBVA 4LFBC 4DV3C 5BUQA 3H2TA 3I08A 4DCVA 5IWAC 2XR1A 2QVYX 4YHHC 4X62C 1YJ7A 3LUSA 4U5YD 4OYCA 5E7QA 1ML8A 4GKKC 2UXDC 4DCTA 3VNQA 2QW0X 5GTDA 4JI7C 2D28C 3E7XA 2E0GA 1RG9A 1ZB9A 4IZ6A 2P2BA 1BA3A 5BSVA 1T5DX 1J5EC 3R44A 2D7VA 4DV4C 1IBMC 4BSZA 2YWBA 4OXIA 4DR1C 4K0KC 4R1LA 2QVZX 5K85A 1QWIA 3T1YC 4LF6C 4I9FA 2CY1A 4DV6C 4KTVA 3DAYA 3E7WA 4DV0C 1V26A 4BCAA 1XRBA 4GXRA 2KZFA 1LQLA 3CJEA 2P2FA 1USPB 1EGAA 2VZEA 4MTNA 4B3RC 1HNXC 4JI2C 4JM1A 1XRAA 1MDBA 2Y27A 4B3SC 3CW9A 1PA4A 1N32C 1WH9A 2F4VC 3B7WA 4DG9A 1N34C 3KXWA 5BSTA 4JI5C 2QVXX 3OTOC 5A19A 4ZLPA 4AQYC 3IEVA 5BSRA 3G7SA 5ADZA 4ODJA 4PZPA 1O9TA 2PN2A 4X66C 2DPLA 4D4GA 4DR3C 3GKUA 1MXAA 4X65C 3GR1A 2QL8A 4L7IA 1JOSA 4GKJC 4RLFA 3PBKA 4WS9A 2P2QA 3J81D 3NI2A 2WD9A 4B3TC 3N2QA 2VQEC 5LMUC 4DR4C 5AE1A 4DV7C 4FTFA 1RY2A 2EGTA 4DV1C 3PROC 1N36C 4LF9C 4XX2A 1N2FA 4LF4C 5IFIA 1HNZC 2OPLA 2D1SA 5K8FA 2UU9C 3PESA 4WV3A 4YY3C 1PG4A 2D1QA 3L95X 5A2QD 1O93A 1XMOC 3VNSA 4RMNA 2HJGA 1GPMA 5AE2A 4D57A 1L2FA 5FLXD 3A9VA 4LFAC 2P2MA 4DR2C 4TPSB 2VQFC 2PROA 2Y4OA 4BC9A 4JI8C 3NYRA 4DUYC 2UUAC 2E5LC 5CZVA 4ZJZA 4GS5A 3FCEA 4IR7A 1VLAA 2ZM6C 2UUBC 1XNRC 4RM2A 2P20A 1HH2P 3CW8X 3DLPX 4RM3A 3N54B 2WP0C 3NPDA 2E8CA 4I9GA 1PG3A 4NXMC 1K0RA 2ASBA 1HR0C 3FCCA 5AE3A 2OO4A 4KTTA 4DV2C 3T1HC 3R9WA 2AYAA 5BSMA 3LAXA 4EATA 4L2ZA 4DCUA 4HPVA 1XMQC 1USPA 2JMPA 4K0BA 1T5HX 4NXNC 5H9UA 2BH1X 5KEIA 4LF5C 4OX9C 2VSQA 5T8TA 1WF3A 5BSUA 1MXBA 4D4IA 5BUSA 3TUFA 5DV9A 3DHVA 3UOWA 3SO4A 4DR6C 2ONFA 4LF7C 4R1MA 2PT7G 2D1RA 4DUZC 1N33C 1QM4A 4LE5A 4KHPC 1KKGA 2E7GA 4BBYA 2YCBA 5A1IA 1MDFA 1IBKC 3I07A 1XRCA 4RVOA 2Y4NA 5BR8C 1O92A 3J80D 4LFCC 1P7LA 3IMLA 5IT9D 4G36A 4DR5C 3RV2A 2D27A 2DYJA 3AF6A 2E8EA 1O90A 4X64C 2UXCC 4LF8C 4G1IA 3JAMD 5T8SA 5KYTA 4JI3C 3L8CA 3A9UA 2UUCC 2E8FA 2HHHC 3IPLA 2P2JA 3AF5A 4JI0C 4GXQA 5JRHA 1IBLC 3TDEA 3LNVA 3VNRA 4DV5C 3C5EA 4R0MA 3GR0A 2P02A 4BC7A 4JI6C 4NOZA 5LMNC 4DR7C 3ETCA 3TQIA 3ETOA 5BSWA 3EQ6A 4FUTA 4G37A 4ISBA 2YWCA 4MH4A 4JV5C 2V7BA 5A1GA 4PHTA 3A4IA 1MXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 C;  1WF3 A;  4YY3 C;  4DV0 C;  2BJO A;  5A2Q D;  1XMO C;  4DR6 C;  2ONF A;  3EER A;  1MKY A;  4LF7 C;  2HJG A;  2KZF A;  1LQL A;  3IEU A;  3R9X A;  1L2F A;  2PT7 G;  1XNQ C;  5FLX D;  3CJE A;  1USP B;  1EGA A;  4DUZ C;  4JYA C;  2CXC A;  4MTN A;  4B3M C;  4JI4 C;  1N33 C;  4B3R C;  1HNX C;  4JI2 C;  4KHP C;  1KKG A;  2E7G A;  4LFA C;  2OPL B;  4DR2 C;  1I94 C;  2VQF C;  2ATW A;  4B3S C;  2UXB C;  4DCS A;  1PA4 A;  4JI1 C;  2YCB A;  1N32 C;  1ZB8 A;  1WH9 A;  2F4V C;  1IBK C;  3I07 A;  1N34 C;  1FJG C;  4JI8 C;  5BR8 C;  3J80 D;  4LFC C;  4DUY C;  2UUA C;  2E5L C;  5IT9 D;  4DR5 C;  1UKK A;  1NYE A;  2DYJ A;  3AF6 A;  2E8E A;  4JI5 C;  3OTO C;  4X64 C;  1HNW C;  2UXC C;  4LFB C;  4DV3 C;  4AQY C;  4LF8 C;  3IEV A;  3JAM D;  1VLA A;  4JI3 C;  2PN2 A;  4X66 C;  2ZM6 C;  2UUB C;  2UUC C;  1XNR C;  5IWA C;  1HH2 P;  2E8F A;  4DCV A;  2XR1 A;  3GKU A;  4YHH C;  4DR3 C;  2HHH C;  4X62 C;  4X65 C;  3AF5 A;  3LUS A;  4JI0 C;  2QL8 A;  1IBL C;  2E8C A;  1ML8 A;  1JOS A;  4GKJ C;  4GKK C;  2UXD C;  4DCT A;  4NXM C;  1K0R A;  2ASB A;  3J81 D;  4DV5 C;  1HR0 C;  4JI7 C;  4DV2 C;  3T1H C;  4B3T C;  3R9W A;  1ZB9 A;  4JI6 C;  4NOZ A;  2VQE C;  5LMU C;  4DR4 C;  4DV7 C;  4DCU A;  5LMN C;  1J5E C;  2EGT A;  4DR7 C;  2D7V A;  4DV1 C;  1N36 C;  1XMQ C;  4DV4 C;  1IBM C;  4LF9 C;  4BSZ A;  4XX2 A;  1N2F A;  4DR1 C;  4K0K C;  4LF4 C;  1USP A;  2JMP A;  1QWI A;  4MH4 A;  3T1Y C;  4LF6 C;  4NXN C;  4JV5 C;  2CY1 A;  4DV6 C;  4LF5 C;  1HNZ C;  2OPL A;  4OX9 C; 
#chains in the Genus database with same CATH topology
 1ULT A;  3LGX A;  1AMU A;  5KYV A;  1LCI A;  3RG2 A;  2BJO A;  1FUG A;  5CZX A;  3EER A;  4NDN A;  1MKY A;  3IEU A;  3R9X A;  2YX1 A;  1XNQ C;  2MCQ A;  4PRO C;  4JYA C;  2CXC A;  4B3M C;  4JI4 C;  4FUQ A;  3S82 A;  4RVN A;  2ATW A;  2OPL B;  1M6X C;  1I94 C;  2UXB C;  4DCS A;  4JI1 C;  1ZB8 A;  4RLQ A;  3UZ0 A;  1FJG C;  1MD9 A;  2D1T A;  4L4Q A;  3TR3 A;  5BUR A;  1UKK A;  1NYE A;  4D56 A;  3GPC A;  4DG8 A;  3UX3 A;  3NYQ A;  1V25 A;  1HNW C;  2OBV A;  4LFB C;  4DV3 C;  5BUQ A;  1IB8 A;  3H2T A;  3I08 A;  2M5O A;  1V60 A;  1UWD A;  4DCV A;  5IWA C;  2XR1 A;  2QVY X;  4YHH C;  4X62 C;  1YJ7 A;  3LUS A;  4U5Y D;  4OYC A;  5E7Q A;  1ML8 A;  1TH5 A;  4GKK C;  2UXD C;  4DCT A;  1NY8 A;  2QW0 X;  3VNQ A;  5GTD A;  4JI7 C;  2D28 C;  3E7X A;  2E0G A;  1RG9 A;  1ZB9 A;  4IZ6 A;  2P2B A;  1BA3 A;  5BSV A;  1T5D X;  1J5E C;  3R44 A;  2D7V A;  4DV4 C;  1IBM C;  4BSZ A;  2YWB A;  4OXI A;  4DR1 C;  4K0K C;  4R1L A;  2DHM A;  2QVZ X;  1QWI A;  5K85 A;  3T1Y C;  4I9F A;  1FLO A;  4LF6 C;  2CY1 A;  4DV6 C;  4KTV A;  1WCJ A;  3DAY A;  3E7W A;  4DV0 C;  1V26 A;  4BCA A;  1XRB A;  4GXR A;  2KZF A;  1LQL A;  3CJE A;  2P2F A;  1USP B;  1EGA A;  3AY0 A;  2VZE A;  4MTN A;  4B3R C;  1HNX C;  4JI2 C;  4JM1 A;  1XRA A;  1MDB A;  2Y27 A;  4B3S C;  3CW9 A;  1PA4 A;  1N32 C;  2MM9 A;  1WH9 A;  2F4V C;  3B7W A;  4DG9 A;  1N34 C;  3KXW A;  3UX2 A;  2M5H A;  1PU1 A;  5BST A;  4JI5 C;  2QVX X;  3OTO C;  5A19 A;  4ZLP A;  4AQY C;  3IEV A;  5BSR A;  3G7S A;  5ADZ A;  4ODJ A;  4PZP A;  1O9T A;  2PN2 A;  4X66 C;  2DPL A;  4D4G A;  4DR3 C;  3GKU A;  1MXA A;  4X65 C;  3GR1 A;  2QL8 A;  4L7I A;  1JOS A;  4GKJ C;  4RLF A;  3PBK A;  4WS9 A;  2P2Q A;  3J81 D;  3NI2 A;  2WD9 A;  4B3T C;  3N2Q A;  2VQE C;  5LMU C;  4DR4 C;  5AE1 A;  4DV7 C;  4FTF A;  1RY2 A;  2EGT A;  2KDN A;  4DV1 C;  3PRO C;  1N36 C;  4LF9 C;  4XX2 A;  1N2F A;  4LF4 C;  3UEB A;  4PUI A;  2MMA B;  5IFI A;  3A4I A;  1VEH A;  1HNZ C;  2OPL A;  2D1S A;  5K8F A;  1P4E A;  2UU9 C;  3PES A;  4WV3 A;  4YY3 C;  1PG4 A;  2D1Q A;  3L95 X;  5A2Q D;  1O93 A;  1XMO C;  3VNS A;  4RMN A;  2HJG A;  1GPM A;  5AE2 A;  4D57 A;  1L2F A;  5FLX D;  5LCI A;  2KZ0 A;  3A25 A;  3A9V A;  4LFA C;  2P2M A;  4DR2 C;  4TPS B;  2VQF C;  2PRO A;  1XS3 A;  2NCL A;  2Y4O A;  1P4E C;  4BC9 A;  4JI8 C;  3O2E A;  4PUG A;  3NYR A;  4DUY C;  2UUA C;  2E5L C;  5CZV A;  4ZJZ A;  2CU6 A;  4GS5 A;  3FCE A;  4IR7 A;  1VLA A;  2ZM6 C;  2UUB C;  1XNR C;  4RM2 A;  2P20 A;  1HH2 P;  3CW8 X;  3DLP X;  4RM3 A;  3N54 B;  2WP0 C;  3NPD A;  2E8C A;  4I9G A;  1PG3 A;  4NXM C;  1K0R A;  2ASB A;  2Z51 A;  1HR0 C;  3FCC A;  5AE3 A;  2OO4 A;  4KTT A;  4DV2 C;  3T1H C;  3R9W A;  2AYA A;  5BSM A;  3LAX A;  4EAT A;  4L2Z A;  4DCU A;  4HPV A;  1XMQ C;  1USP A;  2JMP A;  4K0B A;  1T5H X;  3CQ2 A;  4NXN C;  5H9U A;  2BH1 X;  5KEI A;  4LF5 C;  3A26 A;  4OX9 C;  2VSQ A;  5T8T A;  1WF3 A;  5BSU A;  1MXB A;  4D4I A;  5BUS A;  3TUF A;  5DV9 A;  3DHV A;  3UOW A;  3SO4 A;  4DR6 C;  2ONF A;  4LF7 C;  4R1M A;  2PT7 G;  2D1R A;  4DUZ C;  1N33 C;  1QM4 A;  4LE5 A;  4KHP C;  1KKG A;  2E7G A;  4BBY A;  2YCB A;  5A1I A;  1MDF A;  1IBK C;  3I07 A;  1XRC A;  4RVO A;  2Y4N A;  5BR8 C;  1O92 A;  3J80 D;  4LFC C;  1P7L A;  3IML A;  5IT9 D;  4G36 A;  4DR5 C;  3RV2 A;  2ZZN A;  2D27 A;  2DYJ A;  3AF6 A;  2E8E A;  1O90 A;  4X64 C;  2UXC C;  3CQ1 A;  4LF8 C;  4G1I A;  3JAM D;  5T8S A;  5KYT A;  4JI3 C;  3L8C A;  3A9U A;  2JNV A;  2UUC C;  2E8F A;  2HHH C;  3IPL A;  3LNO A;  1XHJ A;  2P2J A;  3AF5 A;  4PUH A;  4JI0 C;  4GXQ A;  5JRH A;  1IBL C;  3TDE A;  3LNV A;  3VNR A;  4DV5 C;  3C5E A;  4R0M A;  3GR0 A;  2P02 A;  4BC7 A;  4JI6 C;  4NOZ A;  5LMN C;  4DR7 C;  3ETC A;  3TQI A;  3ETO A;  5BSW A;  2ZZM A;  3EQ6 A;  4FUT A;  4G37 A;  4ISB A;  2YWC A;  4MH4 A;  4JV5 C;  2V7B A;  5A1G A;  1M6X A;  3CQ3 A;  4PHT A;  3K6R A;  1MXC A; 
#chains in the Genus database with same CATH homology
 1ULT A;  3LGX A;  1AMU A;  5KYV A;  1LCI A;  3RG2 A;  2BJO A;  1FUG A;  5CZX A;  3EER A;  4NDN A;  1MKY A;  3IEU A;  3R9X A;  1XNQ C;  4PRO C;  4JYA C;  2CXC A;  4B3M C;  4JI4 C;  4FUQ A;  3S82 A;  4RVN A;  2ATW A;  2OPL B;  2UXB C;  1I94 C;  4DCS A;  4JI1 C;  1ZB8 A;  4RLQ A;  3UZ0 A;  1FJG C;  1MD9 A;  2D1T A;  4L4Q A;  5BUR A;  1UKK A;  1NYE A;  4D56 A;  3GPC A;  4DG8 A;  3NYQ A;  1V25 A;  1HNW C;  2OBV A;  4LFB C;  4DV3 C;  5BUQ A;  3H2T A;  3I08 A;  4DCV A;  5IWA C;  2XR1 A;  2QVY X;  4YHH C;  4X62 C;  1YJ7 A;  3LUS A;  4U5Y D;  4OYC A;  5E7Q A;  1ML8 A;  4GKK C;  2UXD C;  4DCT A;  3VNQ A;  2QW0 X;  5GTD A;  4JI7 C;  2D28 C;  3E7X A;  2E0G A;  1RG9 A;  1ZB9 A;  4IZ6 A;  2P2B A;  1BA3 A;  5BSV A;  1T5D X;  1J5E C;  3R44 A;  2D7V A;  4DV4 C;  1IBM C;  4BSZ A;  2YWB A;  4OXI A;  4DR1 C;  4K0K C;  4R1L A;  2QVZ X;  5K85 A;  1QWI A;  3T1Y C;  4LF6 C;  4I9F A;  2CY1 A;  4DV6 C;  4KTV A;  3DAY A;  3E7W A;  4DV0 C;  1V26 A;  4BCA A;  1XRB A;  4GXR A;  2KZF A;  1LQL A;  3CJE A;  2P2F A;  1USP B;  1EGA A;  2VZE A;  4MTN A;  4B3R C;  1HNX C;  4JI2 C;  4JM1 A;  1XRA A;  1MDB A;  2Y27 A;  4B3S C;  3CW9 A;  1PA4 A;  1N32 C;  1WH9 A;  2F4V C;  3B7W A;  4DG9 A;  1N34 C;  3KXW A;  5BST A;  4JI5 C;  2QVX X;  3OTO C;  5A19 A;  4ZLP A;  4AQY C;  3IEV A;  5BSR A;  3G7S A;  5ADZ A;  4ODJ A;  4PZP A;  1O9T A;  2PN2 A;  4X66 C;  2DPL A;  4D4G A;  4DR3 C;  3GKU A;  1MXA A;  4X65 C;  3GR1 A;  2QL8 A;  4L7I A;  1JOS A;  4GKJ C;  4RLF A;  3PBK A;  4WS9 A;  2P2Q A;  3J81 D;  3NI2 A;  2WD9 A;  4B3T C;  3N2Q A;  2VQE C;  5LMU C;  4DR4 C;  5AE1 A;  4DV7 C;  4FTF A;  1RY2 A;  2EGT A;  4DV1 C;  3PRO C;  1N36 C;  4LF9 C;  4XX2 A;  1N2F A;  4LF4 C;  5IFI A;  1HNZ C;  2OPL A;  2D1S A;  5K8F A;  2UU9 C;  3PES A;  4WV3 A;  4YY3 C;  1PG4 A;  2D1Q A;  3L95 X;  5A2Q D;  1O93 A;  1XMO C;  3VNS A;  4RMN A;  2HJG A;  1GPM A;  5AE2 A;  4D57 A;  1L2F A;  5FLX D;  3A9V A;  4LFA C;  2P2M A;  4DR2 C;  4TPS B;  2VQF C;  2PRO A;  2Y4O A;  4BC9 A;  4JI8 C;  3NYR A;  4DUY C;  2UUA C;  2E5L C;  5CZV A;  4ZJZ A;  4GS5 A;  3FCE A;  4IR7 A;  1VLA A;  2ZM6 C;  2UUB C;  1XNR C;  4RM2 A;  2P20 A;  1HH2 P;  3CW8 X;  3DLP X;  4RM3 A;  3N54 B;  2WP0 C;  3NPD A;  2E8C A;  4I9G A;  1PG3 A;  4NXM C;  1K0R A;  2ASB A;  1HR0 C;  3FCC A;  5AE3 A;  2OO4 A;  4KTT A;  4DV2 C;  3T1H C;  3R9W A;  2AYA A;  5BSM A;  3LAX A;  4EAT A;  4L2Z A;  4DCU A;  4HPV A;  1XMQ C;  1USP A;  2JMP A;  4K0B A;  1T5H X;  4NXN C;  5H9U A;  2BH1 X;  5KEI A;  4LF5 C;  4OX9 C;  2VSQ A;  5T8T A;  1WF3 A;  5BSU A;  1MXB A;  4D4I A;  5BUS A;  3TUF A;  5DV9 A;  3DHV A;  3UOW A;  3SO4 A;  4DR6 C;  2ONF A;  4LF7 C;  4R1M A;  2PT7 G;  2D1R A;  4DUZ C;  1N33 C;  1QM4 A;  4LE5 A;  4KHP C;  1KKG A;  2E7G A;  4BBY A;  2YCB A;  5A1I A;  1MDF A;  1IBK C;  3I07 A;  1XRC A;  4RVO A;  2Y4N A;  5BR8 C;  1O92 A;  3J80 D;  4LFC C;  1P7L A;  3IML A;  5IT9 D;  4G36 A;  4DR5 C;  3RV2 A;  2D27 A;  2DYJ A;  3AF6 A;  2E8E A;  1O90 A;  4X64 C;  2UXC C;  4LF8 C;  4G1I A;  3JAM D;  5T8S A;  5KYT A;  4JI3 C;  3L8C A;  3A9U A;  2UUC C;  2E8F A;  2HHH C;  3IPL A;  2P2J A;  3AF5 A;  4JI0 C;  4GXQ A;  5JRH A;  1IBL C;  3TDE A;  3LNV A;  3VNR A;  4DV5 C;  3C5E A;  4R0M A;  3GR0 A;  2P02 A;  4BC7 A;  4JI6 C;  4NOZ A;  5LMN C;  4DR7 C;  3ETC A;  3TQI A;  3ETO A;  5BSW A;  3EQ6 A;  4FUT A;  4G37 A;  4ISB A;  2YWC A;  4MH4 A;  4JV5 C;  2V7B A;  5A1G A;  4PHT A;  3A4I A;  1MXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...