2E7GA

Solution structure of putative ribosome-binding factor a (rbfa) from human mutochondrial precursor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
129
structure length
129
Chain Sequence
GSSGSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of putative ribosome-binding factor A (RbfA) from human mutochondrial precursor
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Putative ribosome-binding factor A
total genus 22
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02033 RBFA Ribosome-binding factor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e7gA01
4DR2C 5LMUC 1XMOC 4JI6C 4X66C 4JI4C 1IBMC 2CXCA 1J5EC 2QL8A 4JI8C 4DR4C 2ASBA 1JOSA 1ZB8A 2E7GA 1N32C 4DCSA 4LFCC 4LF6C 2F4VC 4K0KC 4DV7C 4LFAC 2ATWA 4X62C 3LUSA 2UU9C 1K0RA 4JI7C 4JI2C 4YY3C 3T1YC 1ZB9A 4DUZC 3I07A 2ONFA 4NOZA 5A2QD 4X65C 1IBLC 4LF9C 4AQYC 4GKKC 1USPB 4DV1C 2PN2A 1EGAA 3IEVA 4B3SC 3R9XA 4BSZA 4B3RC 2PT7G 1NYEA 4DV6C 4DV4C 4LFBC 3T1HC 4DCUA 1HH2P 4DR1C 4DR5C 4DR6C 5FLXD 2UUCC 1N33C 2OPLB 1WF3A 1N2FA 3J81D 4DV5C 2E8EA 1HR0C 4B3TC 4DR3C 2OPLA 5IWAC 3J80D 2VQEC 2D7VA 4X64C 1N34C 2XR1A 2YCBA 1QWIA 1FJGC 1LQLA 4DV0C 4DCTA 2UXDC 4NXNC 4OX9C 2UXBC 4JI5C 1HNWC 1KKGA 4B3MC 4MH4A 1HNZC 4DV3C 2KZFA 5BR8C 2UUAC 4DR7C 4JV5C 1UKKA 4DCVA 5LMNC 3EERA 2BJOA 4NXMC 1WH9A 4KHPC 2HJGA 2ZM6C 2UUBC 1XMQC 4XX2A 3R9WA 2JMPA 3IEUA 2HHHC 1L2FA 2E8FA 3CJEA 3JAMD 4DV2C 1XNRC 4YHHC 4JI1C 4GKJC 1IBKC 1XNQC 2CY1A 1USPA 2UXCC 2E8CA 2EGTA 3GKUA 1N36C 3AF5A 3OTOC 4LF4C 4JYAC 1I94C 1HNXC 3AF6A 1VLAA 2VQFC 2DYJA 4JI0C 5IT9D 1PA4A 1ML8A 4DUYC 4LF5C 4LF7C 1MKYA 4MTNA 4LF8C 4JI3C 2E5LC
chains in the Genus database with same CATH superfamily
3VNRA 4D57A 3DHVA 4JI4C 4IZ6A 1J5EC 2QL8A 3N2QA 3C5EA 2ASBA 4DCSA 4FTFA 2VSQA 4LFAC 2ATWA 4GS5A 3VNQA 3A26A 4JI7C 3IMLA 2DPLA 3T1YC 1O90A 4DUZC 2CU6A 4TPSB 4X65C 4LF9C 1O9TA 4AQYC 2Y27A 5A1GA 3UOWA 2D1SA 3RG2A 3T1HC 5JRHA 1HH2P 4DR1C 5ADZA 1V26A 4DR6C 5K8FA 1N33C 3A9UA 2BH1X 4L2ZA 3J81D 4DV5C 4D4GA 2E8EA 1HR0C 1NY8A 5H9UA 5DV9A 1MXCA 2YCBA 4G36A 5KEIA 3PBKA 4ISBA 3NPDA 1V25A 2M5OA 4BBYA 4U5YD 1HNWC 2DHMA 5AE1A 5BSWA 3B7WA 4DCVA 5LMNC 3UEBA 2HJGA 2MCQA 4OXIA 5T8SA 3IEUA 1FLOA 3A25A 1XNRC 3O2EA 2KDNA 4YHHC 3KXWA 1XNQC 2CY1A 5BSMA 2JNVA 4JYAC 2WP0C 2VQFC 1VLAA 4PROC 4BCAA 3EQ6A 1PA4A 3VNSA 3TR3A 1P4EC 3CW8X 3UX2A 2P2BA 4JI3C 5LMUC 4JI6C 3I08A 2KZ0A 2QVZX 2CXCA 4DR4C 1ZB8A 3FCEA 2OO4A 5BURA 4LFCC 3E7WA 2F4VC 2Y4OA 2YX1A 1YJ7A 3L8CA 4RM2A 3FCCA 1M6XC 4YY3C 2QW0X 3DLPX 1ZB9A 3G7SA 1MD9A 3H2TA 4D4IA 4FUQA 5AE3A 1USPB 4RMNA 1MXBA 4PHTA 4K0BA 4I9GA 3IEVA 3IPLA 2PT7G 4DV4C 4DCUA 4IR7A 2D1RA 1IB8A 5FLXD 1O93A 1WF3A 2MMAB 3CW9A 3LGXA 4GXRA 4DG9A 1XRAA 4B3TC 5IWAC 3J80D 1N34C 2QVXX 4DCTA 2UXDC 4NDNA 4OX9C 4KTTA 5A1IA 4JI5C 3K6RA 4R1LA 4MH4A 4DV3C 1VEHA 5BR8C 3GR1A 3UX3A 4NXMC 4KHPC 2ZM6C 3R9WA 3LNOA 2HHHC 3CJEA 2E0GA 1WCJA 3GR0A 2Z51A 3R44A 2ZZMA 2UXCC 3PROC 2E8CA 5IFIA 3CQ2A 2NCLA 4G1IA 5T8TA 1HNXC 3AF6A 5IT9D 1ULTA 1RY2A 1QM4A 3S82A 4LF5C 4LF7C 1MKYA 2D1TA 4LE5A 4MTNA 2E5LC 4DR2C 3NYRA 1GPMA 1IBMC 4BC7A 1M6XA 1LCIA 1JOSA 2P2JA 4K0KC 3CQ3A 4G37A 5AE2A 3A4IA 4X62C 3LUSA 2UU9C 4JI2C 3SO4A 5KYTA 2ONFA 5A2QD 4GKKC 2ZZNA 4RVOA 5CZXA 2YWBA 4L7IA 3A9VA 1EGAA 1AMUA 4B3SC 4BSZA 4B3RC 2VZEA 5BSTA 3TQIA 1XRBA 4DV6C 4LFBC 4PZPA 1O92A 2MM9A 2OPLB 4WS9A 5KYVA 4I9FA 5K85A 4DR3C 2OPLA 5CZVA 1XS3A 4X64C 2XR1A 1LQLA 4DV0C 1UWDA 4NXNC 1PG3A 1MDFA 4B3MC 4PUHA 4ZJZA 4HPVA 2UUAC 4DR7C 2BJOA 2P20A 5E7QA 3L95X 1XMQC 3E7XA 4XX2A 3TDEA 1V60A 2JMPA 2E8FA 4PUIA 3JAMD 4DV2C 4RLQA 4DG8A 4R0MA 4JI1C 1IBKC 2EGTA 1N36C 4LF4C 3OTOC 3LAXA 1RG9A 3ETCA 2DYJA 4JI0C 1ML8A 5LCIA 4RLFA 4RM3A 4BC9A 4R1MA 4LF8C 5BSUA 3CQ1A 1XMOC 4X66C 4PUGA 4JI8C 3RV2A 2Y4NA 2E7GA 5BUQA 1N32C 4GXQA 4LF6C 2D27A 4DV7C 3AY0A 5A19A 2QVYX 3UZ0A 4ZLPA 1MXAA 2D1QA 1K0RA 1PG4A 3I07A 4NOZA 2D28C 1IBLC 4DV1C 2V7BA 2PN2A 2M5HA 4ODJA 3R9XA 3PESA 5BUSA 3N54B 1NYEA 4JM1A 1BA3A 1FUGA 4OYCA 1XRCA 2YWCA 4DR5C 4EATA 2UUCC 3NI2A 2OBVA 1N2FA 4RVNA 5BSVA 2VQEC 2D7VA 3DAYA 2AYAA 1QWIA 1FJGC 1T5HX 3TUFA 2UXBC 4KTVA 1KKGA 4WV3A 1HNZC 2KZFA 4D56A 2P02A 2P2FA 4JV5C 1UKKA 2P2QA 3EERA 1WH9A 3NYQA 2UUBC 3ETOA 1L2FA 2PROA 1XHJA 1P4EA 5BSRA 4GKJC 1USPA 1TH5A 3GKUA 3AF5A 1I94C 2P2MA 4FUTA 1P7LA 4DUYC 1MDBA 2WD9A 5GTDA 1PU1A 4L4QA 3LNVA 3GPCA 1T5DX
chains in the Genus database with same CATH topology
3VNRA 4D57A 3DHVA 4JI4C 4IZ6A 1J5EC 2QL8A 3N2QA 3C5EA 2ASBA 4DCSA 4FTFA 2VSQA 4LFAC 2ATWA 4GS5A 3VNQA 4JI7C 3IMLA 2DPLA 3T1YC 1O90A 4DUZC 4TPSB 4X65C 4LF9C 1O9TA 4AQYC 2Y27A 5A1GA 3UOWA 2D1SA 3RG2A 3T1HC 5JRHA 1HH2P 4DR1C 5ADZA 1V26A 4DR6C 5K8FA 1N33C 3A9UA 2BH1X 4L2ZA 3J81D 4DV5C 4D4GA 2E8EA 1HR0C 5H9UA 5DV9A 1MXCA 2YCBA 4G36A 5KEIA 3PBKA 4ISBA 3NPDA 1V25A 4BBYA 4U5YD 1HNWC 5AE1A 5BSWA 3B7WA 4DCVA 5LMNC 2HJGA 4OXIA 5T8SA 3IEUA 1XNRC 4YHHC 3KXWA 1XNQC 2CY1A 5BSMA 4JYAC 2WP0C 2VQFC 1VLAA 4PROC 4BCAA 3EQ6A 1PA4A 3VNSA 3CW8X 2P2BA 4JI3C 5LMUC 4JI6C 3I08A 2QVZX 2CXCA 4DR4C 1ZB8A 3FCEA 2OO4A 5BURA 4LFCC 3E7WA 2F4VC 2Y4OA 1YJ7A 3L8CA 4RM2A 3FCCA 4YY3C 2QW0X 3DLPX 1ZB9A 3G7SA 1MD9A 3H2TA 4D4IA 4FUQA 5AE3A 1USPB 4RMNA 1MXBA 4PHTA 4K0BA 4I9GA 3IEVA 3IPLA 2PT7G 4DV4C 4DCUA 4IR7A 2D1RA 5FLXD 1O93A 1WF3A 3CW9A 3LGXA 4GXRA 4DG9A 1XRAA 4B3TC 5IWAC 3J80D 1N34C 2QVXX 4DCTA 2UXDC 4NDNA 4OX9C 4KTTA 5A1IA 4JI5C 4R1LA 4MH4A 4DV3C 5BR8C 3GR1A 4NXMC 4KHPC 2ZM6C 3R9WA 2HHHC 3CJEA 2E0GA 3GR0A 3R44A 2UXCC 3PROC 2E8CA 5IFIA 4G1IA 5T8TA 1HNXC 3AF6A 5IT9D 1ULTA 1RY2A 1QM4A 3S82A 4LF5C 4LF7C 1MKYA 2D1TA 4LE5A 4MTNA 2E5LC 4DR2C 3NYRA 1GPMA 1IBMC 4BC7A 1LCIA 1JOSA 2P2JA 4K0KC 4G37A 5AE2A 3A4IA 4X62C 3LUSA 2UU9C 4JI2C 3SO4A 5KYTA 2ONFA 5A2QD 4GKKC 4RVOA 5CZXA 2YWBA 4L7IA 3A9VA 1EGAA 1AMUA 4B3SC 4BSZA 4B3RC 2VZEA 5BSTA 3TQIA 1XRBA 4DV6C 4LFBC 4PZPA 1O92A 2OPLB 4WS9A 5KYVA 4I9FA 5K85A 4DR3C 2OPLA 5CZVA 4X64C 2XR1A 1LQLA 4DV0C 4NXNC 1PG3A 1MDFA 4B3MC 4ZJZA 4HPVA 2UUAC 4DR7C 2BJOA 2P20A 5E7QA 3L95X 1XMQC 3E7XA 4XX2A 3TDEA 2JMPA 2E8FA 3JAMD 4DV2C 4RLQA 4DG8A 4R0MA 4JI1C 1IBKC 2EGTA 1N36C 4LF4C 3OTOC 3LAXA 1RG9A 3ETCA 2DYJA 4JI0C 1ML8A 4RLFA 4RM3A 4BC9A 4LF8C 4R1MA 5BSUA 1XMOC 4X66C 4JI8C 3RV2A 2Y4NA 2E7GA 5BUQA 1N32C 4GXQA 4LF6C 2D27A 4DV7C 5A19A 2QVYX 3UZ0A 4ZLPA 1MXAA 2D1QA 1K0RA 1PG4A 3I07A 4NOZA 2D28C 1IBLC 4DV1C 2V7BA 2PN2A 4ODJA 3R9XA 3PESA 5BUSA 3N54B 1NYEA 4JM1A 1BA3A 1FUGA 4OYCA 1XRCA 2YWCA 4DR5C 4EATA 2UUCC 3NI2A 2OBVA 1N2FA 4RVNA 5BSVA 2VQEC 2D7VA 3DAYA 2AYAA 1QWIA 1FJGC 1T5HX 3TUFA 2UXBC 4KTVA 1KKGA 4WV3A 1HNZC 2KZFA 4D56A 2P02A 2P2FA 4JV5C 1UKKA 2P2QA 3EERA 1WH9A 3NYQA 2UUBC 3ETOA 1L2FA 2PROA 5BSRA 4GKJC 1USPA 3GKUA 3AF5A 1I94C 2P2MA 4FUTA 1P7LA 4DUYC 1MDBA 2WD9A 5GTDA 4L4QA 3LNVA 3GPCA 1T5DX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 C;  5LMU C;  1XMO C;  4JI6 C;  4X66 C;  4JI4 C;  1IBM C;  2CXC A;  1J5E C;  2QL8 A;  4JI8 C;  4DR4 C;  2ASB A;  1JOS A;  1ZB8 A;  2E7G A;  1N32 C;  4DCS A;  4LFC C;  4LF6 C;  2F4V C;  4K0K C;  4DV7 C;  4LFA C;  2ATW A;  4X62 C;  3LUS A;  2UU9 C;  1K0R A;  4JI7 C;  4JI2 C;  4YY3 C;  3T1Y C;  1ZB9 A;  4DUZ C;  3I07 A;  2ONF A;  4NOZ A;  5A2Q D;  4X65 C;  1IBL C;  4LF9 C;  4AQY C;  4GKK C;  1USP B;  4DV1 C;  2PN2 A;  1EGA A;  3IEV A;  4B3S C;  3R9X A;  4BSZ A;  4B3R C;  2PT7 G;  1NYE A;  4DV6 C;  4DV4 C;  4LFB C;  3T1H C;  4DCU A;  1HH2 P;  4DR1 C;  4DR5 C;  4DR6 C;  5FLX D;  2UUC C;  1N33 C;  2OPL B;  1WF3 A;  1N2F A;  3J81 D;  4DV5 C;  2E8E A;  1HR0 C;  4B3T C;  4DR3 C;  2OPL A;  5IWA C;  3J80 D;  2VQE C;  2D7V A;  4X64 C;  1N34 C;  2XR1 A;  2YCB A;  1QWI A;  1FJG C;  1LQL A;  4DV0 C;  4DCT A;  2UXD C;  4NXN C;  4OX9 C;  2UXB C;  4JI5 C;  1HNW C;  1KKG A;  4B3M C;  4MH4 A;  1HNZ C;  4DV3 C;  2KZF A;  5BR8 C;  2UUA C;  4DR7 C;  4JV5 C;  1UKK A;  4DCV A;  5LMN C;  3EER A;  2BJO A;  4NXM C;  1WH9 A;  4KHP C;  2HJG A;  2ZM6 C;  2UUB C;  1XMQ C;  4XX2 A;  3R9W A;  2JMP A;  3IEU A;  2HHH C;  1L2F A;  2E8F A;  3CJE A;  3JAM D;  4DV2 C;  1XNR C;  4YHH C;  4JI1 C;  4GKJ C;  1IBK C;  1XNQ C;  2CY1 A;  1USP A;  2UXC C;  2E8C A;  2EGT A;  3GKU A;  1N36 C;  3AF5 A;  3OTO C;  4LF4 C;  4JYA C;  1I94 C;  1HNX C;  3AF6 A;  1VLA A;  2VQF C;  2DYJ A;  4JI0 C;  5IT9 D;  1PA4 A;  1ML8 A;  4DUY C;  4LF5 C;  4LF7 C;  1MKY A;  4MTN A;  4LF8 C;  4JI3 C;  2E5L C; 
#chains in the Genus database with same CATH topology
 3VNR A;  4D57 A;  3DHV A;  4JI4 C;  4IZ6 A;  1J5E C;  2QL8 A;  3N2Q A;  3C5E A;  2ASB A;  4DCS A;  4FTF A;  2VSQ A;  4LFA C;  2ATW A;  4GS5 A;  3VNQ A;  3A26 A;  4JI7 C;  3IML A;  2DPL A;  3T1Y C;  1O90 A;  4DUZ C;  2CU6 A;  4TPS B;  4X65 C;  4LF9 C;  1O9T A;  4AQY C;  2Y27 A;  5A1G A;  3UOW A;  2D1S A;  3RG2 A;  3T1H C;  5JRH A;  1HH2 P;  4DR1 C;  5ADZ A;  1V26 A;  4DR6 C;  5K8F A;  1N33 C;  3A9U A;  2BH1 X;  4L2Z A;  3J81 D;  4DV5 C;  4D4G A;  2E8E A;  1HR0 C;  1NY8 A;  5H9U A;  5DV9 A;  1MXC A;  2YCB A;  4G36 A;  5KEI A;  3PBK A;  4ISB A;  3NPD A;  1V25 A;  2M5O A;  4BBY A;  4U5Y D;  1HNW C;  2DHM A;  5AE1 A;  5BSW A;  3B7W A;  4DCV A;  5LMN C;  3UEB A;  2HJG A;  2MCQ A;  4OXI A;  5T8S A;  3IEU A;  1FLO A;  3A25 A;  1XNR C;  3O2E A;  2KDN A;  4YHH C;  3KXW A;  1XNQ C;  2CY1 A;  5BSM A;  2JNV A;  4JYA C;  2WP0 C;  2VQF C;  1VLA A;  4PRO C;  4BCA A;  3EQ6 A;  1PA4 A;  3VNS A;  3TR3 A;  1P4E C;  3CW8 X;  3UX2 A;  2P2B A;  4JI3 C;  5LMU C;  4JI6 C;  3I08 A;  2KZ0 A;  2QVZ X;  2CXC A;  4DR4 C;  1ZB8 A;  3FCE A;  2OO4 A;  5BUR A;  4LFC C;  3E7W A;  2F4V C;  2Y4O A;  2YX1 A;  1YJ7 A;  3L8C A;  4RM2 A;  3FCC A;  1M6X C;  4YY3 C;  2QW0 X;  3DLP X;  1ZB9 A;  3G7S A;  1MD9 A;  3H2T A;  4D4I A;  4FUQ A;  5AE3 A;  1USP B;  4RMN A;  1MXB A;  4PHT A;  4K0B A;  4I9G A;  3IEV A;  3IPL A;  2PT7 G;  4DV4 C;  4DCU A;  4IR7 A;  2D1R A;  1IB8 A;  5FLX D;  1O93 A;  1WF3 A;  2MMA B;  3CW9 A;  3LGX A;  4GXR A;  4DG9 A;  1XRA A;  4B3T C;  5IWA C;  3J80 D;  1N34 C;  2QVX X;  4DCT A;  2UXD C;  4NDN A;  4OX9 C;  4KTT A;  5A1I A;  4JI5 C;  3K6R A;  4R1L A;  4MH4 A;  4DV3 C;  1VEH A;  5BR8 C;  3GR1 A;  3UX3 A;  4NXM C;  4KHP C;  2ZM6 C;  3R9W A;  3LNO A;  2HHH C;  3CJE A;  2E0G A;  1WCJ A;  3GR0 A;  2Z51 A;  3R44 A;  2ZZM A;  2UXC C;  3PRO C;  2E8C A;  5IFI A;  3CQ2 A;  2NCL A;  4G1I A;  5T8T A;  1HNX C;  3AF6 A;  5IT9 D;  1ULT A;  1RY2 A;  1QM4 A;  3S82 A;  4LF5 C;  4LF7 C;  1MKY A;  2D1T A;  4LE5 A;  4MTN A;  2E5L C;  4DR2 C;  3NYR A;  1GPM A;  1IBM C;  4BC7 A;  1M6X A;  1LCI A;  1JOS A;  2P2J A;  4K0K C;  3CQ3 A;  4G37 A;  5AE2 A;  3A4I A;  4X62 C;  3LUS A;  2UU9 C;  4JI2 C;  3SO4 A;  5KYT A;  2ONF A;  5A2Q D;  4GKK C;  2ZZN A;  4RVO A;  5CZX A;  2YWB A;  4L7I A;  3A9V A;  1EGA A;  1AMU A;  4B3S C;  4BSZ A;  4B3R C;  2VZE A;  5BST A;  3TQI A;  1XRB A;  4DV6 C;  4LFB C;  4PZP A;  1O92 A;  2MM9 A;  2OPL B;  4WS9 A;  5KYV A;  4I9F A;  5K85 A;  4DR3 C;  2OPL A;  5CZV A;  1XS3 A;  4X64 C;  2XR1 A;  1LQL A;  4DV0 C;  1UWD A;  4NXN C;  1PG3 A;  1MDF A;  4B3M C;  4PUH A;  4ZJZ A;  4HPV A;  2UUA C;  4DR7 C;  2BJO A;  2P20 A;  5E7Q A;  3L95 X;  1XMQ C;  3E7X A;  4XX2 A;  3TDE A;  1V60 A;  2JMP A;  2E8F A;  4PUI A;  3JAM D;  4DV2 C;  4RLQ A;  4DG8 A;  4R0M A;  4JI1 C;  1IBK C;  2EGT A;  1N36 C;  4LF4 C;  3OTO C;  3LAX A;  1RG9 A;  3ETC A;  2DYJ A;  4JI0 C;  1ML8 A;  5LCI A;  4RLF A;  4RM3 A;  4BC9 A;  4R1M A;  4LF8 C;  5BSU A;  3CQ1 A;  1XMO C;  4X66 C;  4PUG A;  4JI8 C;  3RV2 A;  2Y4N A;  2E7G A;  5BUQ A;  1N32 C;  4GXQ A;  4LF6 C;  2D27 A;  4DV7 C;  3AY0 A;  5A19 A;  2QVY X;  3UZ0 A;  4ZLP A;  1MXA A;  2D1Q A;  1K0R A;  1PG4 A;  3I07 A;  4NOZ A;  2D28 C;  1IBL C;  4DV1 C;  2V7B A;  2PN2 A;  2M5H A;  4ODJ A;  3R9X A;  3PES A;  5BUS A;  3N54 B;  1NYE A;  4JM1 A;  1BA3 A;  1FUG A;  4OYC A;  1XRC A;  2YWC A;  4DR5 C;  4EAT A;  2UUC C;  3NI2 A;  2OBV A;  1N2F A;  4RVN A;  5BSV A;  2VQE C;  2D7V A;  3DAY A;  2AYA A;  1QWI A;  1FJG C;  1T5H X;  3TUF A;  2UXB C;  4KTV A;  1KKG A;  4WV3 A;  1HNZ C;  2KZF A;  4D56 A;  2P02 A;  2P2F A;  4JV5 C;  1UKK A;  2P2Q A;  3EER A;  1WH9 A;  3NYQ A;  2UUB C;  3ETO A;  1L2F A;  2PRO A;  1XHJ A;  1P4E A;  5BSR A;  4GKJ C;  1USP A;  1TH5 A;  3GKU A;  3AF5 A;  1I94 C;  2P2M A;  4FUT A;  1P7L A;  4DUY C;  1MDB A;  2WD9 A;  5GTD A;  1PU1 A;  4L4Q A;  3LNV A;  3GPC A;  1T5D X; 
#chains in the Genus database with same CATH homology
 3VNR A;  4D57 A;  3DHV A;  4JI4 C;  4IZ6 A;  1J5E C;  2QL8 A;  3N2Q A;  3C5E A;  2ASB A;  4DCS A;  4FTF A;  2VSQ A;  4LFA C;  2ATW A;  4GS5 A;  3VNQ A;  4JI7 C;  3IML A;  2DPL A;  3T1Y C;  1O90 A;  4DUZ C;  4TPS B;  4X65 C;  4LF9 C;  1O9T A;  4AQY C;  2Y27 A;  5A1G A;  3UOW A;  2D1S A;  3RG2 A;  3T1H C;  5JRH A;  1HH2 P;  4DR1 C;  5ADZ A;  1V26 A;  4DR6 C;  5K8F A;  1N33 C;  3A9U A;  2BH1 X;  4L2Z A;  3J81 D;  4DV5 C;  4D4G A;  2E8E A;  1HR0 C;  5H9U A;  5DV9 A;  1MXC A;  2YCB A;  4G36 A;  5KEI A;  3PBK A;  4ISB A;  3NPD A;  1V25 A;  4BBY A;  4U5Y D;  1HNW C;  5AE1 A;  5BSW A;  3B7W A;  4DCV A;  5LMN C;  2HJG A;  4OXI A;  5T8S A;  3IEU A;  1XNR C;  4YHH C;  3KXW A;  1XNQ C;  2CY1 A;  5BSM A;  4JYA C;  2WP0 C;  2VQF C;  1VLA A;  4PRO C;  4BCA A;  3EQ6 A;  1PA4 A;  3VNS A;  3CW8 X;  2P2B A;  4JI3 C;  5LMU C;  4JI6 C;  3I08 A;  2QVZ X;  2CXC A;  4DR4 C;  1ZB8 A;  3FCE A;  2OO4 A;  5BUR A;  4LFC C;  3E7W A;  2F4V C;  2Y4O A;  1YJ7 A;  3L8C A;  4RM2 A;  3FCC A;  4YY3 C;  2QW0 X;  3DLP X;  1ZB9 A;  3G7S A;  1MD9 A;  3H2T A;  4D4I A;  4FUQ A;  5AE3 A;  1USP B;  4RMN A;  1MXB A;  4PHT A;  4K0B A;  4I9G A;  3IEV A;  3IPL A;  2PT7 G;  4DV4 C;  4DCU A;  4IR7 A;  2D1R A;  5FLX D;  1O93 A;  1WF3 A;  3CW9 A;  3LGX A;  4GXR A;  4DG9 A;  1XRA A;  4B3T C;  5IWA C;  3J80 D;  1N34 C;  2QVX X;  4DCT A;  2UXD C;  4NDN A;  4OX9 C;  4KTT A;  5A1I A;  4JI5 C;  4R1L A;  4MH4 A;  4DV3 C;  5BR8 C;  3GR1 A;  4NXM C;  4KHP C;  2ZM6 C;  3R9W A;  2HHH C;  3CJE A;  2E0G A;  3GR0 A;  3R44 A;  2UXC C;  3PRO C;  2E8C A;  5IFI A;  4G1I A;  5T8T A;  1HNX C;  3AF6 A;  5IT9 D;  1ULT A;  1RY2 A;  1QM4 A;  3S82 A;  4LF5 C;  4LF7 C;  1MKY A;  2D1T A;  4LE5 A;  4MTN A;  2E5L C;  4DR2 C;  3NYR A;  1GPM A;  1IBM C;  4BC7 A;  1LCI A;  1JOS A;  2P2J A;  4K0K C;  4G37 A;  5AE2 A;  3A4I A;  4X62 C;  3LUS A;  2UU9 C;  4JI2 C;  3SO4 A;  5KYT A;  2ONF A;  5A2Q D;  4GKK C;  4RVO A;  5CZX A;  2YWB A;  4L7I A;  3A9V A;  1EGA A;  1AMU A;  4B3S C;  4BSZ A;  4B3R C;  2VZE A;  5BST A;  3TQI A;  1XRB A;  4DV6 C;  4LFB C;  4PZP A;  1O92 A;  2OPL B;  4WS9 A;  5KYV A;  4I9F A;  5K85 A;  4DR3 C;  2OPL A;  5CZV A;  4X64 C;  2XR1 A;  1LQL A;  4DV0 C;  4NXN C;  1PG3 A;  1MDF A;  4B3M C;  4ZJZ A;  4HPV A;  2UUA C;  4DR7 C;  2BJO A;  2P20 A;  5E7Q A;  3L95 X;  1XMQ C;  3E7X A;  4XX2 A;  3TDE A;  2JMP A;  2E8F A;  3JAM D;  4DV2 C;  4RLQ A;  4DG8 A;  4R0M A;  4JI1 C;  1IBK C;  2EGT A;  1N36 C;  4LF4 C;  3OTO C;  3LAX A;  1RG9 A;  3ETC A;  2DYJ A;  4JI0 C;  1ML8 A;  4RLF A;  4RM3 A;  4BC9 A;  4LF8 C;  4R1M A;  5BSU A;  1XMO C;  4X66 C;  4JI8 C;  3RV2 A;  2Y4N A;  2E7G A;  5BUQ A;  1N32 C;  4GXQ A;  4LF6 C;  2D27 A;  4DV7 C;  5A19 A;  2QVY X;  3UZ0 A;  4ZLP A;  1MXA A;  2D1Q A;  1K0R A;  1PG4 A;  3I07 A;  4NOZ A;  2D28 C;  1IBL C;  4DV1 C;  2V7B A;  2PN2 A;  4ODJ A;  3R9X A;  3PES A;  5BUS A;  3N54 B;  1NYE A;  4JM1 A;  1BA3 A;  1FUG A;  4OYC A;  1XRC A;  2YWC A;  4DR5 C;  4EAT A;  2UUC C;  3NI2 A;  2OBV A;  1N2F A;  4RVN A;  5BSV A;  2VQE C;  2D7V A;  3DAY A;  2AYA A;  1QWI A;  1FJG C;  1T5H X;  3TUF A;  2UXB C;  4KTV A;  1KKG A;  4WV3 A;  1HNZ C;  2KZF A;  4D56 A;  2P02 A;  2P2F A;  4JV5 C;  1UKK A;  2P2Q A;  3EER A;  1WH9 A;  3NYQ A;  2UUB C;  3ETO A;  1L2F A;  2PRO A;  5BSR A;  4GKJ C;  1USP A;  3GKU A;  3AF5 A;  1I94 C;  2P2M A;  4FUT A;  1P7L A;  4DUY C;  1MDB A;  2WD9 A;  5GTD A;  4L4Q A;  3LNV A;  3GPC A;  1T5D X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...