1RG9A

S-adenosylmethionine synthetase complexed with sam and ppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
total genus 122
structure length 383
sequence length 383
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A01
4L2ZA 2P02A 4ODJA 5T8TA 5A19A 1O92A 4KTVA 1O9TA 1FUGA 4L7IA 1P7LA 2DPLA 1RG9A 1GPMA 1MXCA 2YWBA 1O93A 2OBVA 1XRAA 1QM4A 3IMLA 1O90A 1MXBA 5A1GA 3TQIA 4KTTA 4HPVA 1MXAA 4NDNA 3RV2A 4L4QA 3TDEA 3UOWA 4K0BA 1XRCA 4WS9A 5H9UA 3SO4A 5A1IA 3S82A 5T8SA 3A4IA 4LE5A 2YWCA 1XRBA
chains in the Genus database with same CATH superfamily
1PG4A 3B7WA 1MDBA 3LGXA 3AY0A 4XX2A 2D7VA 1RG9A 3E7WA 5LMNC 4DUYC 4BC7A 1QM4A 4HPVA 2M5HA 2JNVA 3AF6A 3R44A 2HHHC 5T8TA 2D1RA 5A19A 3DAYA 1M6XA 1PG3A 4RVNA 2KZ0A 4OXIA 1FUGA 4NXMC 2DPLA 3A26A 3R9WA 4G36A 3DLPX 3TR3A 1MXBA 1HNWC 5JRHA 1XHJA 1RY2A 3RV2A 5ADZA 4WS9A 1IBLC 2PROA 2WD9A 2P20A 2EGTA 2JMPA 3T1HC 2E7GA 1TH5A 2E8EA 3JAMD 1I94C 3KXWA 1WF3A 2DHMA 4D57A 3T1YC 4L7IA 4DG8A 5DV9A 1P7LA 3NYQA 5IT9D 3PROC 4LFAC 1O93A 2D1QA 1FJGC 1XRAA 2UUCC 4NOZA 1PU1A 3PESA 5KYVA 3O2EA 2MM9A 4B3TC 4KHPC 1XNQC 2P2QA 2YWCA 4IR7A 4RMNA 1O9TA 1IBKC 1MD9A 4PUGA 2YX1A 4LF6C 2YWBA 4K0KC 5AE1A 3N2QA 3LNOA 2NCLA 3J81D 2ATWA 3CQ1A 4MTNA 4JI8C 5IFIA 4DV3C 1KKGA 2E0GA 4RLQA 4PUHA 4LF7C 3VNRA 1N36C 3CJEA 1V26A 1USPB 2CU6A 4FUTA 4LFCC 3GR0A 2P2MA 3N54B 3VNSA 4GS5A 4L2ZA 1USPA 4ODJA 3NYRA 2QVZX 1ZB8A 4B3SC 4DV7C 1ML8A 4D56A 3NPDA 2UUAC 2BJOA 3K6RA 5KEIA 4AQYC 3CQ3A 1BA3A 4JV5C 2D28C 3RG2A 3UOWA 4K0BA 5T8SA 3VNQA 3ETCA 3UEBA 4JI7C 1ZB9A 4R0MA 4DR6C 4DR7C 4JI5C 2VQFC 2Y4OA 1V25A 3G7SA 4BCAA 1O92A 5LCIA 1J5EC 4KTVA 3IPLA 5IWAC 3LNVA 1JOSA 4BBYA 4R1LA 4EATA 1N33C 1GPMA 4DCTA 2UUBC 2E5LC 4LF5C 2VSQA 4I9FA 4DV2C 4X66C 3TDEA 1WCJA 3IEVA 5H9UA 4G1IA 1XMOC 4DR4C 3A25A 3H2TA 3UX3A 2CY1A 4PZPA 1FLOA 2P02A 3PBKA 2QVYX 2P2BA 1UWDA 2OPLA 4JYAC 2Y4NA 1N34C 4DR2C 2OBVA 2KDNA 3ETOA 1MXAA 5BURA 2Y27A 3A9VA 4DR3C 4DR1C 2M5OA 4ISBA 3GPCA 2ONFA 4WV3A 4LFBC 4GKJC 2KZFA 1MXCA 2QVXX 4GXQA 2OPLB 1O90A 2PT7G 4OYCA 4RLFA 3J80D 3AF5A 4MH4A 4PROC 2F4VC 1L2FA 1N2FA 5AE2A 1HR0C 3LAXA 2WP0C 1AMUA 2ZZMA 1NYEA 4JI0C 4BSZA 1PA4A 1QWIA 4FTFA 5E7QA 5BSWA 4DG9A 1XS3A 4NDNA 1MDFA 1IB8A 5K8FA 1P4EA 1XRCA 5LMUC 2MMAB 4DV5C 5BSTA 5CZXA 5BUSA 5BSUA 2BH1X 4JI3C 3FCEA 4DV0C 4B3RC 2D1SA 1HH2P 1N32C 4X62C 4KTTA 5AE3A 1T5DX 3CW9A 4DUZC 1NY8A 5A1IA 4RM2A 1ULTA 1HNXC 1IBMC 5FLXD 5BUQA 4JM1A 4JI6C 2UXCC 1MKYA 3LUSA 3UX2A 3IMLA 4LF8C 2D27A 4R1MA 4RVOA 3FCCA 3IEUA 5BSVA 1UKKA 3EERA 1T5HX 1XRBA 4GKKC 4YY3C 1XMQC 2AYAA 4DCUA 2UXDC 3I07A 2E8FA 4YHHC 2P2JA 4ZJZA 2MCQA 2OO4A 4JI4C 3E7XA 1LQLA 1WH9A 4TPSB 2QL8A 5A1GA 2CXCA 3TUFA 3TQIA 4LF4C 2HJGA 2UU9C 4X64C 3DHVA 3R9XA 3A9UA 4D4GA 3GKUA 2P2FA 5BSMA 1P4EC 1V60A 5BR8C 3GR1A 1M6XC 4U5YD 5K85A 3L95X 5A2QD 2E8CA 4X65C 4OX9C 2QW0X 1HNZC 4FUQA 3SO4A 2DYJA 1VEHA 4DV1C 2VZEA 3S82A 1YJ7A 4ZLPA 4DR5C 1LCIA 5CZVA 4NXNC 1EGAA 3CW8X 4D4IA 4B3MC 4G37A 1XNRC 2XR1A 5KYTA 4I9GA 4L4QA 3NI2A 2D1TA 3OTOC 4DCSA 2V7BA 4PHTA 2YCBA 2ASBA 3A4IA 3CQ2A 3L8CA 2UXBC 3EQ6A 3I08A 4IZ6A 2Z51A 5BSRA 4RM3A 4DCVA 4PUIA 1K0RA 4JI1C 3UZ0A 2ZZNA 4GXRA 1VLAA 2VQEC 4DV6C 4LF9C 2ZM6C 3C5EA 4DV4C 4JI2C 5GTDA 4BC9A 2PN2A 4LE5A
chains in the Genus database with same CATH topology
1PG4A 3B7WA 1MDBA 3LGXA 4XX2A 2D7VA 1RG9A 3E7WA 5LMNC 4DUYC 4BC7A 1QM4A 4HPVA 3AF6A 3R44A 2HHHC 5T8TA 2D1RA 5A19A 3DAYA 1PG3A 4RVNA 4OXIA 1FUGA 4NXMC 2DPLA 3R9WA 4G36A 3DLPX 1MXBA 1HNWC 5JRHA 1RY2A 3RV2A 5ADZA 4WS9A 1IBLC 2PROA 2WD9A 2P20A 2EGTA 2JMPA 3T1HC 2E7GA 2E8EA 3JAMD 1I94C 3KXWA 1WF3A 3T1YC 4D57A 4L7IA 4DG8A 5DV9A 1P7LA 3NYQA 5IT9D 3PROC 4LFAC 1O93A 2D1QA 1FJGC 1XRAA 2UUCC 4NOZA 3PESA 5KYVA 4B3TC 4KHPC 1XNQC 2P2QA 2YWCA 4IR7A 4RMNA 1O9TA 1IBKC 1MD9A 4LF6C 2YWBA 4K0KC 5AE1A 3N2QA 3J81D 2ATWA 4MTNA 4JI8C 5IFIA 4DV3C 1KKGA 2E0GA 4RLQA 4LF7C 3VNRA 1N36C 3CJEA 1V26A 1USPB 4FUTA 4LFCC 3GR0A 2P2MA 3N54B 3VNSA 4GS5A 4L2ZA 1USPA 4ODJA 3NYRA 2QVZX 1ZB8A 4B3SC 4DV7C 1ML8A 4D56A 3NPDA 2UUAC 2BJOA 5KEIA 4AQYC 1BA3A 4JV5C 2D28C 3RG2A 3UOWA 4K0BA 5T8SA 3VNQA 3ETCA 4JI7C 1ZB9A 4R0MA 4DR6C 4DR7C 4JI5C 2VQFC 2Y4OA 1V25A 3G7SA 4BCAA 1O92A 1J5EC 4KTVA 3IPLA 5IWAC 3LNVA 1JOSA 4BBYA 4R1LA 4EATA 1N33C 1GPMA 4DCTA 2UUBC 2E5LC 4LF5C 2VSQA 4I9FA 4DV2C 4X66C 3TDEA 3IEVA 5H9UA 4G1IA 1XMOC 4DR4C 3H2TA 2CY1A 4PZPA 2P02A 3PBKA 2QVYX 2P2BA 2OPLA 4JYAC 2Y4NA 1N34C 4DR2C 2OBVA 3ETOA 1MXAA 5BURA 2Y27A 3A9VA 4DR3C 4DR1C 4ISBA 3GPCA 2ONFA 4WV3A 4LFBC 4GKJC 2KZFA 1MXCA 2QVXX 4GXQA 2OPLB 1O90A 2PT7G 4OYCA 4RLFA 3J80D 3AF5A 4MH4A 4PROC 2F4VC 1L2FA 1N2FA 5AE2A 1HR0C 3LAXA 2WP0C 1AMUA 1NYEA 4JI0C 4BSZA 1PA4A 1QWIA 4FTFA 5E7QA 5BSWA 4DG9A 4NDNA 1MDFA 5K8FA 1XRCA 5LMUC 4DV5C 5BSTA 5CZXA 5BUSA 5BSUA 2BH1X 4JI3C 3FCEA 4DV0C 4B3RC 2D1SA 1HH2P 1N32C 4X62C 4KTTA 5AE3A 1T5DX 3CW9A 4DUZC 5A1IA 4RM2A 1ULTA 1HNXC 1IBMC 5FLXD 5BUQA 4JM1A 4JI6C 2UXCC 1MKYA 3LUSA 3IMLA 4LF8C 2D27A 4R1MA 4RVOA 3FCCA 3IEUA 5BSVA 1UKKA 3EERA 1T5HX 1XRBA 4GKKC 4YY3C 1XMQC 2AYAA 4DCUA 2UXDC 3I07A 2E8FA 4YHHC 2P2JA 4ZJZA 2OO4A 4JI4C 3E7XA 1LQLA 1WH9A 4TPSB 2QL8A 5A1GA 2CXCA 3TUFA 3TQIA 4LF4C 2HJGA 2UU9C 4X64C 3DHVA 3R9XA 3A9UA 4D4GA 3GKUA 2P2FA 5BSMA 5BR8C 3GR1A 4U5YD 5K85A 3L95X 5A2QD 2E8CA 4X65C 4OX9C 2QW0X 1HNZC 4FUQA 3SO4A 2DYJA 4DV1C 2VZEA 3S82A 1YJ7A 4ZLPA 4DR5C 1LCIA 5CZVA 4NXNC 1EGAA 3CW8X 4D4IA 4B3MC 4G37A 1XNRC 2XR1A 5KYTA 4I9GA 4L4QA 3NI2A 2D1TA 3OTOC 4DCSA 2V7BA 4PHTA 2YCBA 2ASBA 3A4IA 3L8CA 2UXBC 3EQ6A 3I08A 4IZ6A 5BSRA 4RM3A 4DCVA 1K0RA 4JI1C 3UZ0A 4GXRA 1VLAA 2VQEC 4DV6C 4LF9C 2ZM6C 3C5EA 4DV4C 4JI2C 5GTDA 4BC9A 2PN2A 4LE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L2Z A;  2P02 A;  4ODJ A;  5T8T A;  5A19 A;  1O92 A;  4KTV A;  1O9T A;  1FUG A;  4L7I A;  1P7L A;  2DPL A;  1RG9 A;  1GPM A;  1MXC A;  2YWB A;  1O93 A;  2OBV A;  1XRA A;  1QM4 A;  3IML A;  1O90 A;  1MXB A;  5A1G A;  3TQI A;  4KTT A;  4HPV A;  1MXA A;  4NDN A;  3RV2 A;  4L4Q A;  3TDE A;  3UOW A;  4K0B A;  1XRC A;  4WS9 A;  5H9U A;  3SO4 A;  5A1I A;  3S82 A;  5T8S A;  3A4I A;  4LE5 A;  2YWC A;  1XRB A; 
#chains in the Genus database with same CATH topology
 1PG4 A;  3B7W A;  1MDB A;  3LGX A;  3AY0 A;  4XX2 A;  2D7V A;  1RG9 A;  3E7W A;  5LMN C;  4DUY C;  4BC7 A;  1QM4 A;  4HPV A;  2M5H A;  2JNV A;  3AF6 A;  3R44 A;  2HHH C;  5T8T A;  2D1R A;  5A19 A;  3DAY A;  1M6X A;  1PG3 A;  4RVN A;  2KZ0 A;  4OXI A;  1FUG A;  4NXM C;  2DPL A;  3A26 A;  3R9W A;  4G36 A;  3DLP X;  3TR3 A;  1MXB A;  1HNW C;  5JRH A;  1XHJ A;  1RY2 A;  3RV2 A;  5ADZ A;  4WS9 A;  1IBL C;  2PRO A;  2WD9 A;  2P20 A;  2EGT A;  2JMP A;  3T1H C;  2E7G A;  1TH5 A;  2E8E A;  3JAM D;  1I94 C;  3KXW A;  1WF3 A;  2DHM A;  4D57 A;  3T1Y C;  4L7I A;  4DG8 A;  5DV9 A;  1P7L A;  3NYQ A;  5IT9 D;  3PRO C;  4LFA C;  1O93 A;  2D1Q A;  1FJG C;  1XRA A;  2UUC C;  4NOZ A;  1PU1 A;  3PES A;  5KYV A;  3O2E A;  2MM9 A;  4B3T C;  4KHP C;  1XNQ C;  2P2Q A;  2YWC A;  4IR7 A;  4RMN A;  1O9T A;  1IBK C;  1MD9 A;  4PUG A;  2YX1 A;  4LF6 C;  2YWB A;  4K0K C;  5AE1 A;  3N2Q A;  3LNO A;  2NCL A;  3J81 D;  2ATW A;  3CQ1 A;  4MTN A;  4JI8 C;  5IFI A;  4DV3 C;  1KKG A;  2E0G A;  4RLQ A;  4PUH A;  4LF7 C;  3VNR A;  1N36 C;  3CJE A;  1V26 A;  1USP B;  2CU6 A;  4FUT A;  4LFC C;  3GR0 A;  2P2M A;  3N54 B;  3VNS A;  4GS5 A;  4L2Z A;  1USP A;  4ODJ A;  3NYR A;  2QVZ X;  1ZB8 A;  4B3S C;  4DV7 C;  1ML8 A;  4D56 A;  3NPD A;  2UUA C;  2BJO A;  3K6R A;  5KEI A;  4AQY C;  3CQ3 A;  1BA3 A;  4JV5 C;  2D28 C;  3RG2 A;  3UOW A;  4K0B A;  5T8S A;  3VNQ A;  3ETC A;  3UEB A;  4JI7 C;  1ZB9 A;  4R0M A;  4DR6 C;  4DR7 C;  4JI5 C;  2VQF C;  2Y4O A;  1V25 A;  3G7S A;  4BCA A;  1O92 A;  5LCI A;  1J5E C;  4KTV A;  3IPL A;  5IWA C;  3LNV A;  1JOS A;  4BBY A;  4R1L A;  4EAT A;  1N33 C;  1GPM A;  4DCT A;  2UUB C;  2E5L C;  4LF5 C;  2VSQ A;  4I9F A;  4DV2 C;  4X66 C;  3TDE A;  1WCJ A;  3IEV A;  5H9U A;  4G1I A;  1XMO C;  4DR4 C;  3A25 A;  3H2T A;  3UX3 A;  2CY1 A;  4PZP A;  1FLO A;  2P02 A;  3PBK A;  2QVY X;  2P2B A;  1UWD A;  2OPL A;  4JYA C;  2Y4N A;  1N34 C;  4DR2 C;  2OBV A;  2KDN A;  3ETO A;  1MXA A;  5BUR A;  2Y27 A;  3A9V A;  4DR3 C;  4DR1 C;  2M5O A;  4ISB A;  3GPC A;  2ONF A;  4WV3 A;  4LFB C;  4GKJ C;  2KZF A;  1MXC A;  2QVX X;  4GXQ A;  2OPL B;  1O90 A;  2PT7 G;  4OYC A;  4RLF A;  3J80 D;  3AF5 A;  4MH4 A;  4PRO C;  2F4V C;  1L2F A;  1N2F A;  5AE2 A;  1HR0 C;  3LAX A;  2WP0 C;  1AMU A;  2ZZM A;  1NYE A;  4JI0 C;  4BSZ A;  1PA4 A;  1QWI A;  4FTF A;  5E7Q A;  5BSW A;  4DG9 A;  1XS3 A;  4NDN A;  1MDF A;  1IB8 A;  5K8F A;  1P4E A;  1XRC A;  5LMU C;  2MMA B;  4DV5 C;  5BST A;  5CZX A;  5BUS A;  5BSU A;  2BH1 X;  4JI3 C;  3FCE A;  4DV0 C;  4B3R C;  2D1S A;  1HH2 P;  1N32 C;  4X62 C;  4KTT A;  5AE3 A;  1T5D X;  3CW9 A;  4DUZ C;  1NY8 A;  5A1I A;  4RM2 A;  1ULT A;  1HNX C;  1IBM C;  5FLX D;  5BUQ A;  4JM1 A;  4JI6 C;  2UXC C;  1MKY A;  3LUS A;  3UX2 A;  3IML A;  4LF8 C;  2D27 A;  4R1M A;  4RVO A;  3FCC A;  3IEU A;  5BSV A;  1UKK A;  3EER A;  1T5H X;  1XRB A;  4GKK C;  4YY3 C;  1XMQ C;  2AYA A;  4DCU A;  2UXD C;  3I07 A;  2E8F A;  4YHH C;  2P2J A;  4ZJZ A;  2MCQ A;  2OO4 A;  4JI4 C;  3E7X A;  1LQL A;  1WH9 A;  4TPS B;  2QL8 A;  5A1G A;  2CXC A;  3TUF A;  3TQI A;  4LF4 C;  2HJG A;  2UU9 C;  4X64 C;  3DHV A;  3R9X A;  3A9U A;  4D4G A;  3GKU A;  2P2F A;  5BSM A;  1P4E C;  1V60 A;  5BR8 C;  3GR1 A;  1M6X C;  4U5Y D;  5K85 A;  3L95 X;  5A2Q D;  2E8C A;  4X65 C;  4OX9 C;  2QW0 X;  1HNZ C;  4FUQ A;  3SO4 A;  2DYJ A;  1VEH A;  4DV1 C;  2VZE A;  3S82 A;  1YJ7 A;  4ZLP A;  4DR5 C;  1LCI A;  5CZV A;  4NXN C;  1EGA A;  3CW8 X;  4D4I A;  4B3M C;  4G37 A;  1XNR C;  2XR1 A;  5KYT A;  4I9G A;  4L4Q A;  3NI2 A;  2D1T A;  3OTO C;  4DCS A;  2V7B A;  4PHT A;  2YCB A;  2ASB A;  3A4I A;  3CQ2 A;  3L8C A;  2UXB C;  3EQ6 A;  3I08 A;  4IZ6 A;  2Z51 A;  5BSR A;  4RM3 A;  4DCV A;  4PUI A;  1K0R A;  4JI1 C;  3UZ0 A;  2ZZN A;  4GXR A;  1VLA A;  2VQE C;  4DV6 C;  4LF9 C;  2ZM6 C;  3C5E A;  4DV4 C;  4JI2 C;  5GTD A;  4BC9 A;  2PN2 A;  4LE5 A; 
#chains in the Genus database with same CATH homology
 1PG4 A;  3B7W A;  1MDB A;  3LGX A;  4XX2 A;  2D7V A;  1RG9 A;  3E7W A;  5LMN C;  4DUY C;  4BC7 A;  1QM4 A;  4HPV A;  3AF6 A;  3R44 A;  2HHH C;  5T8T A;  2D1R A;  5A19 A;  3DAY A;  1PG3 A;  4RVN A;  4OXI A;  1FUG A;  4NXM C;  2DPL A;  3R9W A;  4G36 A;  3DLP X;  1MXB A;  1HNW C;  5JRH A;  1RY2 A;  3RV2 A;  5ADZ A;  4WS9 A;  1IBL C;  2PRO A;  2WD9 A;  2P20 A;  2EGT A;  2JMP A;  3T1H C;  2E7G A;  2E8E A;  3JAM D;  1I94 C;  3KXW A;  1WF3 A;  3T1Y C;  4D57 A;  4L7I A;  4DG8 A;  5DV9 A;  1P7L A;  3NYQ A;  5IT9 D;  3PRO C;  4LFA C;  1O93 A;  2D1Q A;  1FJG C;  1XRA A;  2UUC C;  4NOZ A;  3PES A;  5KYV A;  4B3T C;  4KHP C;  1XNQ C;  2P2Q A;  2YWC A;  4IR7 A;  4RMN A;  1O9T A;  1IBK C;  1MD9 A;  4LF6 C;  2YWB A;  4K0K C;  5AE1 A;  3N2Q A;  3J81 D;  2ATW A;  4MTN A;  4JI8 C;  5IFI A;  4DV3 C;  1KKG A;  2E0G A;  4RLQ A;  4LF7 C;  3VNR A;  1N36 C;  3CJE A;  1V26 A;  1USP B;  4FUT A;  4LFC C;  3GR0 A;  2P2M A;  3N54 B;  3VNS A;  4GS5 A;  4L2Z A;  1USP A;  4ODJ A;  3NYR A;  2QVZ X;  1ZB8 A;  4B3S C;  4DV7 C;  1ML8 A;  4D56 A;  3NPD A;  2UUA C;  2BJO A;  5KEI A;  4AQY C;  1BA3 A;  4JV5 C;  2D28 C;  3RG2 A;  3UOW A;  4K0B A;  5T8S A;  3VNQ A;  3ETC A;  4JI7 C;  1ZB9 A;  4R0M A;  4DR6 C;  4DR7 C;  4JI5 C;  2VQF C;  2Y4O A;  1V25 A;  3G7S A;  4BCA A;  1O92 A;  1J5E C;  4KTV A;  3IPL A;  5IWA C;  3LNV A;  1JOS A;  4BBY A;  4R1L A;  4EAT A;  1N33 C;  1GPM A;  4DCT A;  2UUB C;  2E5L C;  4LF5 C;  2VSQ A;  4I9F A;  4DV2 C;  4X66 C;  3TDE A;  3IEV A;  5H9U A;  4G1I A;  1XMO C;  4DR4 C;  3H2T A;  2CY1 A;  4PZP A;  2P02 A;  3PBK A;  2QVY X;  2P2B A;  2OPL A;  4JYA C;  2Y4N A;  1N34 C;  4DR2 C;  2OBV A;  3ETO A;  1MXA A;  5BUR A;  2Y27 A;  3A9V A;  4DR3 C;  4DR1 C;  4ISB A;  3GPC A;  2ONF A;  4WV3 A;  4LFB C;  4GKJ C;  2KZF A;  1MXC A;  2QVX X;  4GXQ A;  2OPL B;  1O90 A;  2PT7 G;  4OYC A;  4RLF A;  3J80 D;  3AF5 A;  4MH4 A;  4PRO C;  2F4V C;  1L2F A;  1N2F A;  5AE2 A;  1HR0 C;  3LAX A;  2WP0 C;  1AMU A;  1NYE A;  4JI0 C;  4BSZ A;  1PA4 A;  1QWI A;  4FTF A;  5E7Q A;  5BSW A;  4DG9 A;  4NDN A;  1MDF A;  5K8F A;  1XRC A;  5LMU C;  4DV5 C;  5BST A;  5CZX A;  5BUS A;  5BSU A;  2BH1 X;  4JI3 C;  3FCE A;  4DV0 C;  4B3R C;  2D1S A;  1HH2 P;  1N32 C;  4X62 C;  4KTT A;  5AE3 A;  1T5D X;  3CW9 A;  4DUZ C;  5A1I A;  4RM2 A;  1ULT A;  1HNX C;  1IBM C;  5FLX D;  5BUQ A;  4JM1 A;  4JI6 C;  2UXC C;  1MKY A;  3LUS A;  3IML A;  4LF8 C;  2D27 A;  4R1M A;  4RVO A;  3FCC A;  3IEU A;  5BSV A;  1UKK A;  3EER A;  1T5H X;  1XRB A;  4GKK C;  4YY3 C;  1XMQ C;  2AYA A;  4DCU A;  2UXD C;  3I07 A;  2E8F A;  4YHH C;  2P2J A;  4ZJZ A;  2OO4 A;  4JI4 C;  3E7X A;  1LQL A;  1WH9 A;  4TPS B;  2QL8 A;  5A1G A;  2CXC A;  3TUF A;  3TQI A;  4LF4 C;  2HJG A;  2UU9 C;  4X64 C;  3DHV A;  3R9X A;  3A9U A;  4D4G A;  3GKU A;  2P2F A;  5BSM A;  5BR8 C;  3GR1 A;  4U5Y D;  5K85 A;  3L95 X;  5A2Q D;  2E8C A;  4X65 C;  4OX9 C;  2QW0 X;  1HNZ C;  4FUQ A;  3SO4 A;  2DYJ A;  4DV1 C;  2VZE A;  3S82 A;  1YJ7 A;  4ZLP A;  4DR5 C;  1LCI A;  5CZV A;  4NXN C;  1EGA A;  3CW8 X;  4D4I A;  4B3M C;  4G37 A;  1XNR C;  2XR1 A;  5KYT A;  4I9G A;  4L4Q A;  3NI2 A;  2D1T A;  3OTO C;  4DCS A;  2V7B A;  4PHT A;  2YCB A;  2ASB A;  3A4I A;  3L8C A;  2UXB C;  3EQ6 A;  3I08 A;  4IZ6 A;  5BSR A;  4RM3 A;  4DCV A;  1K0R A;  4JI1 C;  3UZ0 A;  4GXR A;  1VLA A;  2VQE C;  4DV6 C;  4LF9 C;  2ZM6 C;  3C5E A;  4DV4 C;  4JI2 C;  5GTD A;  4BC9 A;  2PN2 A;  4LE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...