1RG9A

S-adenosylmethionine synthetase complexed with sam and ppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the S-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
total genus 122
structure length 383
sequence length 383
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A01
3UOWA 4HPVA 4L7IA 1MXAA 4K0BA 5A1GA 1XRAA 1P7LA 1XRBA 1GPMA 5T8TA 3TDEA 2P02A 5T8SA 1RG9A 1O93A 5A19A 4KTVA 4KTTA 4ODJA 4LE5A 2YWBA 3A4IA 3S82A 1QM4A 1O9TA 2OBVA 5H9UA 5A1IA 1MXCA 1O90A 3IMLA 4L2ZA 4WS9A 1O92A 3RV2A 2DPLA 4NDNA 4L4QA 3SO4A 1XRCA 1FUGA 2YWCA 1MXBA 3TQIA
chains in the Genus database with same CATH superfamily
2QVXX 1XS3A 3VNQA 5BUSA 5K85A 3NYQA 3GPCA 2EGTA 4U5YD 5BUQA 4LF7C 4B3SC 4DV7C 1JOSA 1QM4A 5FLXD 5H9UA 4YY3C 1O90A 3IEVA 2ASBA 3EQ6A 4ISBA 1V25A 4ZLPA 1XHJA 4RMNA 3R9XA 3PBKA 3CQ2A 1MDBA 4L7IA 4DG9A 1LQLA 4R1LA 5BSWA 2CXCA 4NOZA 4PUGA 3R9WA 2KZ0A 2P2MA 2QVYX 4JI3C 1FUGA 2E0GA 5BURA 4DV0C 4LFBC 4FUTA 2JNVA 2PT7G 1P7LA 1IBLC 2WP0C 3AF6A 1NY8A 2PN2A 5E7QA 4WV3A 5AE2A 2BJOA 2DPLA 2PROA 4I9GA 3AY0A 5GTDA 3G7SA 4IR7A 2QVZX 3UEBA 3NPDA 4BBYA 2ONFA 4OYCA 2Z51A 4BSZA 4ODJA 3CQ1A 4YHHC 4B3TC 1USPB 4DUYC 4MH4A 2YWBA 3S82A 4PUHA 2ZZMA 3UZ0A 4AQYC 4GXRA 3A9VA 1USPA 2VSQA 4NDNA 1XNQC 5LCIA 1YJ7A 4DCTA 3LUSA 3K6RA 4LFCC 1MXAA 2M5OA 3TUFA 2D1TA 3TDEA 3UX2A 4LE5A 2E8FA 4OXIA 2P2FA 2UXBC 4R1MA 4FTFA 4RM2A 4JI6C 4I9FA 2CY1A 4NXNC 2QW0X 1VEHA 4D4IA 4D56A 4JV5C 3I08A 5AE1A 3A9UA 1K0RA 1P4EC 2VQEC 2KDNA 4EATA 3A4IA 1J5EC 4DCVA 4PROC 4NXMC 3IMLA 3OTOC 4X64C 2D1QA 3SO4A 2DYJA 4D57A 4DCSA 4DR6C 3E7WA 4JI5C 5DV9A 1MDFA 4B3MC 2XR1A 4JI4C 4LF8C 1GPMA 1ZB8A 3L95X 3J80D 3FCEA 3AF5A 2YCBA 1O9TA 1VLAA 3VNSA 1ZB9A 1EGAA 4PHTA 1WH9A 5BSTA 4WS9A 4RVNA 4TPSB 1M6XA 4D4GA 4GKKC 1BA3A 3B7WA 2MCQA 2ZZNA 2D28C 1FJGC 4XX2A 1AMUA 1I94C 4G36A 1ULTA 1XRBA 3EERA 2UUAC 4KTTA 1IB8A 1WF3A 5BSUA 4DR5C 5IWAC 2D1SA 4X62C 3LNOA 1M6XC 1L2FA 1XRCA 4GXQA 3UOWA 3T1HC 1IBKC 1KKGA 1HH2P 2UU9C 2MM9A 4DG8A 4K0BA 4JYAC 4LF6C 1PA4A 1N36C 5T8TA 5BR8C 2KZFA 2BH1X 5A19A 2E7GA 4MTNA 3PROC 4K0KC 3GR1A 3L8CA 4JI7C 3DLPX 5BSMA 3C5EA 2P2QA 1HNXC 2AYAA 4L2ZA 2JMPA 2M5HA 4IZ6A 1O92A 2YWCA 4G1IA 2Y4NA 3TQIA 1P4EA 1MKYA 2Y27A 4JI0C 4JI8C 5T8SA 1O93A 2P20A 4BC9A 4X65C 2P2JA 4DV1C 3LNVA 1UKKA 3A25A 3VNRA 2OBVA 5ADZA 4PZPA 1N33C 1MXBA 3J81D 4OX9C 2UXCC 4GS5A 3ETOA 5CZVA 3RG2A 1PU1A 1XRAA 4B3RC 2P2BA 4DR2C 4DR4C 3T1YC 3FCCA 5CZXA 2ATWA 5BSRA 4JI2C 2E5LC 2UUBC 4DR3C 4L4QA 1ML8A 5LMNC 1HR0C 3ETCA 3R44A 2F4VC 4FUQA 3CQ3A 1QWIA 3DAYA 4R0MA 1RY2A 2HJGA 1MXCA 3TR3A 3CJEA 4LF4C 1UWDA 4JI1C 3RV2A 1HNZC 3NI2A 3I07A 4HPVA 2D7VA 2UXDC 3IPLA 4DUZC 5KYVA 1NYEA 3N54B 4RM3A 3DHVA 4X66C 2E8EA 4DV6C 4BCAA 1RG9A 1N2FA 1T5DX 1XMQC 1N34C 2HHHC 3LAXA 2DHMA 5IFIA 1LCIA 5K8FA 2D1RA 4LFAC 1XNRC 4RLFA 5KEIA 3O2EA 3A26A 2OPLA 4LF9C 2OO4A 4JM1A 4DR1C 5A1GA 1TH5A 4DV2C 4GKJC 4KTVA 4RVOA 4DV4C 3GR0A 4G37A 1N32C 4BC7A 2D27A 4DV3C 3NYRA 5LMUC 3N2QA 3UX3A 4DV5C 2WD9A 1IBMC 4PUIA 1HNWC 3JAMD 2Y4OA 3E7XA 5IT9D 2V7BA 1FLOA 3GKUA 5A2QD 2OPLB 3IEUA 5BSVA 3CW8X 1T5HX 4DCUA 4RLQA 2QL8A 2VQFC 1V60A 4LF5C 1PG4A 1PG3A 5AE3A 3KXWA 2CU6A 2VZEA 2P02A 3PESA 2YX1A 4DR7C 3H2TA 2UUCC 1XMOC 1MD9A 3LGXA 2ZM6C 5A1IA 2E8CA 4KHPC 5KYTA 2NCLA 5JRHA 3CW9A 2MMAB 1V26A 1WCJA 4ZJZA
chains in the Genus database with same CATH topology
2QVXX 3VNQA 5BUSA 5K85A 3NYQA 3GPCA 2EGTA 4U5YD 5BUQA 4LF7C 4B3SC 4DV7C 1JOSA 1QM4A 5FLXD 5H9UA 4YY3C 1O90A 3IEVA 2ASBA 3EQ6A 4ISBA 1V25A 4ZLPA 4RMNA 3R9XA 3PBKA 1MDBA 4L7IA 4DG9A 1LQLA 4R1LA 5BSWA 2CXCA 4NOZA 3R9WA 2P2MA 2QVYX 4JI3C 1FUGA 2E0GA 5BURA 4DV0C 4LFBC 4FUTA 2PT7G 1P7LA 1IBLC 2WP0C 3AF6A 2PN2A 5E7QA 4WV3A 5AE2A 2BJOA 2DPLA 2PROA 4I9GA 5GTDA 3G7SA 4IR7A 2QVZX 3NPDA 4BBYA 2ONFA 4OYCA 4BSZA 4ODJA 4YHHC 4B3TC 1USPB 4DUYC 4MH4A 2YWBA 3S82A 3UZ0A 4AQYC 4GXRA 3A9VA 1USPA 2VSQA 4NDNA 1XNQC 1YJ7A 4DCTA 3LUSA 4LFCC 1MXAA 3TUFA 2D1TA 3TDEA 4LE5A 2E8FA 4OXIA 2P2FA 2UXBC 4R1MA 4FTFA 4RM2A 4JI6C 4I9FA 2CY1A 4NXNC 2QW0X 4D56A 4D4IA 4JV5C 3I08A 5AE1A 3A9UA 1K0RA 2VQEC 4EATA 3A4IA 1J5EC 4DCVA 4PROC 4NXMC 3IMLA 3OTOC 4X64C 2D1QA 3SO4A 2DYJA 4D57A 4DCSA 4DR6C 3E7WA 4JI5C 5DV9A 1MDFA 4B3MC 2XR1A 4JI4C 4LF8C 1GPMA 1ZB8A 3L95X 3J80D 3FCEA 3AF5A 2YCBA 1O9TA 1VLAA 3VNSA 1ZB9A 1EGAA 4PHTA 1WH9A 5BSTA 4WS9A 4RVNA 4TPSB 4D4GA 4GKKC 1BA3A 3B7WA 2D28C 1FJGC 4XX2A 1AMUA 1I94C 4G36A 1ULTA 1XRBA 3EERA 2UUAC 4KTTA 1WF3A 5BSUA 4DR5C 5IWAC 2D1SA 4X62C 1L2FA 1XRCA 4GXQA 3UOWA 3T1HC 1IBKC 1KKGA 1HH2P 2UU9C 4DG8A 4K0BA 4JYAC 4LF6C 1PA4A 1N36C 5T8TA 5BR8C 2KZFA 2BH1X 5A19A 2E7GA 4MTNA 3PROC 4K0KC 3GR1A 3L8CA 4JI7C 3DLPX 5BSMA 3C5EA 2P2QA 1HNXC 2AYAA 4L2ZA 2JMPA 4IZ6A 1O92A 2YWCA 4G1IA 2Y4NA 3TQIA 1MKYA 2Y27A 4JI0C 4JI8C 5T8SA 1O93A 2P20A 4BC9A 4X65C 2P2JA 4DV1C 3LNVA 1UKKA 3VNRA 2OBVA 5ADZA 4PZPA 1N33C 1MXBA 3J81D 4OX9C 2UXCC 4GS5A 3ETOA 5CZVA 3RG2A 1XRAA 4B3RC 2P2BA 4DR2C 4DR4C 3T1YC 3FCCA 5CZXA 2ATWA 5BSRA 4JI2C 2E5LC 2UUBC 4DR3C 4L4QA 1ML8A 5LMNC 1HR0C 3ETCA 3R44A 2F4VC 4FUQA 1QWIA 3DAYA 4R0MA 1RY2A 2HJGA 1MXCA 4LF4C 3CJEA 4JI1C 3RV2A 1HNZC 3NI2A 3I07A 4HPVA 2D7VA 2UXDC 3IPLA 4DUZC 5KYVA 1NYEA 3N54B 4RM3A 3DHVA 4X66C 2E8EA 4DV6C 4BCAA 1N34C 1RG9A 1N2FA 1T5DX 1XMQC 2HHHC 3LAXA 5IFIA 1LCIA 5K8FA 2D1RA 4LFAC 1XNRC 4RLFA 5KEIA 2OPLA 4LF9C 2OO4A 4JM1A 4DR1C 5A1GA 4DV2C 4GKJC 4KTVA 4RVOA 4DV4C 3GR0A 4G37A 1N32C 4BC7A 2D27A 4DV3C 3NYRA 5LMUC 3N2QA 4DV5C 2WD9A 1IBMC 1HNWC 3JAMD 2Y4OA 3E7XA 5IT9D 2V7BA 3GKUA 5A2QD 2OPLB 3IEUA 5BSVA 3CW8X 1T5HX 4DCUA 4RLQA 2QL8A 2VQFC 4LF5C 1PG4A 1PG3A 5AE3A 3KXWA 2VZEA 2P02A 3PESA 4DR7C 3H2TA 2UUCC 1XMOC 1MD9A 3LGXA 2ZM6C 5A1IA 2E8CA 4KHPC 5KYTA 5JRHA 3CW9A 1V26A 4ZJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOW A;  4HPV A;  4L7I A;  1MXA A;  4K0B A;  5A1G A;  1XRA A;  1P7L A;  1XRB A;  1GPM A;  5T8T A;  3TDE A;  2P02 A;  5T8S A;  1RG9 A;  1O93 A;  5A19 A;  4KTV A;  4KTT A;  4ODJ A;  4LE5 A;  2YWB A;  3A4I A;  3S82 A;  1QM4 A;  1O9T A;  2OBV A;  5H9U A;  5A1I A;  1MXC A;  1O90 A;  3IML A;  4L2Z A;  4WS9 A;  1O92 A;  3RV2 A;  2DPL A;  4NDN A;  4L4Q A;  3SO4 A;  1XRC A;  1FUG A;  2YWC A;  1MXB A;  3TQI A; 
#chains in the Genus database with same CATH topology
 2QVX X;  1XS3 A;  3VNQ A;  5BUS A;  5K85 A;  3NYQ A;  3GPC A;  2EGT A;  4U5Y D;  5BUQ A;  4LF7 C;  4B3S C;  4DV7 C;  1JOS A;  1QM4 A;  5FLX D;  5H9U A;  4YY3 C;  1O90 A;  3IEV A;  2ASB A;  3EQ6 A;  4ISB A;  1V25 A;  4ZLP A;  1XHJ A;  4RMN A;  3R9X A;  3PBK A;  3CQ2 A;  1MDB A;  4L7I A;  4DG9 A;  1LQL A;  4R1L A;  5BSW A;  2CXC A;  4NOZ A;  4PUG A;  3R9W A;  2KZ0 A;  2P2M A;  2QVY X;  4JI3 C;  1FUG A;  2E0G A;  5BUR A;  4DV0 C;  4LFB C;  4FUT A;  2JNV A;  2PT7 G;  1P7L A;  1IBL C;  2WP0 C;  3AF6 A;  1NY8 A;  2PN2 A;  5E7Q A;  4WV3 A;  5AE2 A;  2BJO A;  2DPL A;  2PRO A;  4I9G A;  3AY0 A;  5GTD A;  3G7S A;  4IR7 A;  2QVZ X;  3UEB A;  3NPD A;  4BBY A;  2ONF A;  4OYC A;  2Z51 A;  4BSZ A;  4ODJ A;  3CQ1 A;  4YHH C;  4B3T C;  1USP B;  4DUY C;  4MH4 A;  2YWB A;  3S82 A;  4PUH A;  2ZZM A;  3UZ0 A;  4AQY C;  4GXR A;  3A9V A;  1USP A;  2VSQ A;  4NDN A;  1XNQ C;  5LCI A;  1YJ7 A;  4DCT A;  3LUS A;  3K6R A;  4LFC C;  1MXA A;  2M5O A;  3TUF A;  2D1T A;  3TDE A;  3UX2 A;  4LE5 A;  2E8F A;  4OXI A;  2P2F A;  2UXB C;  4R1M A;  4FTF A;  4RM2 A;  4JI6 C;  4I9F A;  2CY1 A;  4NXN C;  2QW0 X;  1VEH A;  4D4I A;  4D56 A;  4JV5 C;  3I08 A;  5AE1 A;  3A9U A;  1K0R A;  1P4E C;  2VQE C;  2KDN A;  4EAT A;  3A4I A;  1J5E C;  4DCV A;  4PRO C;  4NXM C;  3IML A;  3OTO C;  4X64 C;  2D1Q A;  3SO4 A;  2DYJ A;  4D57 A;  4DCS A;  4DR6 C;  3E7W A;  4JI5 C;  5DV9 A;  1MDF A;  4B3M C;  2XR1 A;  4JI4 C;  4LF8 C;  1GPM A;  1ZB8 A;  3L95 X;  3J80 D;  3FCE A;  3AF5 A;  2YCB A;  1O9T A;  1VLA A;  3VNS A;  1ZB9 A;  1EGA A;  4PHT A;  1WH9 A;  5BST A;  4WS9 A;  4RVN A;  4TPS B;  1M6X A;  4D4G A;  4GKK C;  1BA3 A;  3B7W A;  2MCQ A;  2ZZN A;  2D28 C;  1FJG C;  4XX2 A;  1AMU A;  1I94 C;  4G36 A;  1ULT A;  1XRB A;  3EER A;  2UUA C;  4KTT A;  1IB8 A;  1WF3 A;  5BSU A;  4DR5 C;  5IWA C;  2D1S A;  4X62 C;  3LNO A;  1M6X C;  1L2F A;  1XRC A;  4GXQ A;  3UOW A;  3T1H C;  1IBK C;  1KKG A;  1HH2 P;  2UU9 C;  2MM9 A;  4DG8 A;  4K0B A;  4JYA C;  4LF6 C;  1PA4 A;  1N36 C;  5T8T A;  5BR8 C;  2KZF A;  2BH1 X;  5A19 A;  2E7G A;  4MTN A;  3PRO C;  4K0K C;  3GR1 A;  3L8C A;  4JI7 C;  3DLP X;  5BSM A;  3C5E A;  2P2Q A;  1HNX C;  2AYA A;  4L2Z A;  2JMP A;  2M5H A;  4IZ6 A;  1O92 A;  2YWC A;  4G1I A;  2Y4N A;  3TQI A;  1P4E A;  1MKY A;  2Y27 A;  4JI0 C;  4JI8 C;  5T8S A;  1O93 A;  2P20 A;  4BC9 A;  4X65 C;  2P2J A;  4DV1 C;  3LNV A;  1UKK A;  3A25 A;  3VNR A;  2OBV A;  5ADZ A;  4PZP A;  1N33 C;  1MXB A;  3J81 D;  4OX9 C;  2UXC C;  4GS5 A;  3ETO A;  5CZV A;  3RG2 A;  1PU1 A;  1XRA A;  4B3R C;  2P2B A;  4DR2 C;  4DR4 C;  3T1Y C;  3FCC A;  5CZX A;  2ATW A;  5BSR A;  4JI2 C;  2E5L C;  2UUB C;  4DR3 C;  4L4Q A;  1ML8 A;  5LMN C;  1HR0 C;  3ETC A;  3R44 A;  2F4V C;  4FUQ A;  3CQ3 A;  1QWI A;  3DAY A;  4R0M A;  1RY2 A;  2HJG A;  1MXC A;  3TR3 A;  3CJE A;  4LF4 C;  1UWD A;  4JI1 C;  3RV2 A;  1HNZ C;  3NI2 A;  3I07 A;  4HPV A;  2D7V A;  2UXD C;  3IPL A;  4DUZ C;  5KYV A;  1NYE A;  3N54 B;  4RM3 A;  3DHV A;  4X66 C;  2E8E A;  4DV6 C;  4BCA A;  1RG9 A;  1N2F A;  1T5D X;  1XMQ C;  1N34 C;  2HHH C;  3LAX A;  2DHM A;  5IFI A;  1LCI A;  5K8F A;  2D1R A;  4LFA C;  1XNR C;  4RLF A;  5KEI A;  3O2E A;  3A26 A;  2OPL A;  4LF9 C;  2OO4 A;  4JM1 A;  4DR1 C;  5A1G A;  1TH5 A;  4DV2 C;  4GKJ C;  4KTV A;  4RVO A;  4DV4 C;  3GR0 A;  4G37 A;  1N32 C;  4BC7 A;  2D27 A;  4DV3 C;  3NYR A;  5LMU C;  3N2Q A;  3UX3 A;  4DV5 C;  2WD9 A;  1IBM C;  4PUI A;  1HNW C;  3JAM D;  2Y4O A;  3E7X A;  5IT9 D;  2V7B A;  1FLO A;  3GKU A;  5A2Q D;  2OPL B;  3IEU A;  5BSV A;  3CW8 X;  1T5H X;  4DCU A;  4RLQ A;  2QL8 A;  2VQF C;  1V60 A;  4LF5 C;  1PG4 A;  1PG3 A;  5AE3 A;  3KXW A;  2CU6 A;  2VZE A;  2P02 A;  3PES A;  2YX1 A;  4DR7 C;  3H2T A;  2UUC C;  1XMO C;  1MD9 A;  3LGX A;  2ZM6 C;  5A1I A;  2E8C A;  4KHP C;  5KYT A;  2NCL A;  5JRH A;  3CW9 A;  2MMA B;  1V26 A;  1WCJ A;  4ZJZ A; 
#chains in the Genus database with same CATH homology
 2QVX X;  3VNQ A;  5BUS A;  5K85 A;  3NYQ A;  3GPC A;  2EGT A;  4U5Y D;  5BUQ A;  4LF7 C;  4B3S C;  4DV7 C;  1JOS A;  1QM4 A;  5FLX D;  5H9U A;  4YY3 C;  1O90 A;  3IEV A;  2ASB A;  3EQ6 A;  4ISB A;  1V25 A;  4ZLP A;  4RMN A;  3R9X A;  3PBK A;  1MDB A;  4L7I A;  4DG9 A;  1LQL A;  4R1L A;  5BSW A;  2CXC A;  4NOZ A;  3R9W A;  2P2M A;  2QVY X;  4JI3 C;  1FUG A;  2E0G A;  5BUR A;  4DV0 C;  4LFB C;  4FUT A;  2PT7 G;  1P7L A;  1IBL C;  2WP0 C;  3AF6 A;  2PN2 A;  5E7Q A;  4WV3 A;  5AE2 A;  2BJO A;  2DPL A;  2PRO A;  4I9G A;  5GTD A;  3G7S A;  4IR7 A;  2QVZ X;  3NPD A;  4BBY A;  2ONF A;  4OYC A;  4BSZ A;  4ODJ A;  4YHH C;  4B3T C;  1USP B;  4DUY C;  4MH4 A;  2YWB A;  3S82 A;  3UZ0 A;  4AQY C;  4GXR A;  3A9V A;  1USP A;  2VSQ A;  4NDN A;  1XNQ C;  1YJ7 A;  4DCT A;  3LUS A;  4LFC C;  1MXA A;  3TUF A;  2D1T A;  3TDE A;  4LE5 A;  2E8F A;  4OXI A;  2P2F A;  2UXB C;  4R1M A;  4FTF A;  4RM2 A;  4JI6 C;  4I9F A;  2CY1 A;  4NXN C;  2QW0 X;  4D56 A;  4D4I A;  4JV5 C;  3I08 A;  5AE1 A;  3A9U A;  1K0R A;  2VQE C;  4EAT A;  3A4I A;  1J5E C;  4DCV A;  4PRO C;  4NXM C;  3IML A;  3OTO C;  4X64 C;  2D1Q A;  3SO4 A;  2DYJ A;  4D57 A;  4DCS A;  4DR6 C;  3E7W A;  4JI5 C;  5DV9 A;  1MDF A;  4B3M C;  2XR1 A;  4JI4 C;  4LF8 C;  1GPM A;  1ZB8 A;  3L95 X;  3J80 D;  3FCE A;  3AF5 A;  2YCB A;  1O9T A;  1VLA A;  3VNS A;  1ZB9 A;  1EGA A;  4PHT A;  1WH9 A;  5BST A;  4WS9 A;  4RVN A;  4TPS B;  4D4G A;  4GKK C;  1BA3 A;  3B7W A;  2D28 C;  1FJG C;  4XX2 A;  1AMU A;  1I94 C;  4G36 A;  1ULT A;  1XRB A;  3EER A;  2UUA C;  4KTT A;  1WF3 A;  5BSU A;  4DR5 C;  5IWA C;  2D1S A;  4X62 C;  1L2F A;  1XRC A;  4GXQ A;  3UOW A;  3T1H C;  1IBK C;  1KKG A;  1HH2 P;  2UU9 C;  4DG8 A;  4K0B A;  4JYA C;  4LF6 C;  1PA4 A;  1N36 C;  5T8T A;  5BR8 C;  2KZF A;  2BH1 X;  5A19 A;  2E7G A;  4MTN A;  3PRO C;  4K0K C;  3GR1 A;  3L8C A;  4JI7 C;  3DLP X;  5BSM A;  3C5E A;  2P2Q A;  1HNX C;  2AYA A;  4L2Z A;  2JMP A;  4IZ6 A;  1O92 A;  2YWC A;  4G1I A;  2Y4N A;  3TQI A;  1MKY A;  2Y27 A;  4JI0 C;  4JI8 C;  5T8S A;  1O93 A;  2P20 A;  4BC9 A;  4X65 C;  2P2J A;  4DV1 C;  3LNV A;  1UKK A;  3VNR A;  2OBV A;  5ADZ A;  4PZP A;  1N33 C;  1MXB A;  3J81 D;  4OX9 C;  2UXC C;  4GS5 A;  3ETO A;  5CZV A;  3RG2 A;  1XRA A;  4B3R C;  2P2B A;  4DR2 C;  4DR4 C;  3T1Y C;  3FCC A;  5CZX A;  2ATW A;  5BSR A;  4JI2 C;  2E5L C;  2UUB C;  4DR3 C;  4L4Q A;  1ML8 A;  5LMN C;  1HR0 C;  3ETC A;  3R44 A;  2F4V C;  4FUQ A;  1QWI A;  3DAY A;  4R0M A;  1RY2 A;  2HJG A;  1MXC A;  4LF4 C;  3CJE A;  4JI1 C;  3RV2 A;  1HNZ C;  3NI2 A;  3I07 A;  4HPV A;  2D7V A;  2UXD C;  3IPL A;  4DUZ C;  5KYV A;  1NYE A;  3N54 B;  4RM3 A;  3DHV A;  4X66 C;  2E8E A;  4DV6 C;  4BCA A;  1N34 C;  1RG9 A;  1N2F A;  1T5D X;  1XMQ C;  2HHH C;  3LAX A;  5IFI A;  1LCI A;  5K8F A;  2D1R A;  4LFA C;  1XNR C;  4RLF A;  5KEI A;  2OPL A;  4LF9 C;  2OO4 A;  4JM1 A;  4DR1 C;  5A1G A;  4DV2 C;  4GKJ C;  4KTV A;  4RVO A;  4DV4 C;  3GR0 A;  4G37 A;  1N32 C;  4BC7 A;  2D27 A;  4DV3 C;  3NYR A;  5LMU C;  3N2Q A;  4DV5 C;  2WD9 A;  1IBM C;  1HNW C;  3JAM D;  2Y4O A;  3E7X A;  5IT9 D;  2V7B A;  3GKU A;  5A2Q D;  2OPL B;  3IEU A;  5BSV A;  3CW8 X;  1T5H X;  4DCU A;  4RLQ A;  2QL8 A;  2VQF C;  4LF5 C;  1PG4 A;  1PG3 A;  5AE3 A;  3KXW A;  2VZE A;  2P02 A;  3PES A;  4DR7 C;  3H2T A;  2UUC C;  1XMO C;  1MD9 A;  3LGX A;  2ZM6 C;  5A1I A;  2E8C A;  4KHP C;  5KYT A;  5JRH A;  3CW9 A;  1V26 A;  4ZJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...