1RG9A

S-adenosylmethionine synthetase complexed with sam and ppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthetase
publication title Crystal structure of the S-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 122
structure length 383
sequence length 383
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A01
1GPMA 1O9TA 1O90A 3A4IA 1XRBA 5A1IA 4LE5A 1O93A 1MXBA 2P02A 1QM4A 3SO4A 5T8SA 5A1GA 1FUGA 1MXAA 2DPLA 3TQIA 4K0BA 5T8TA 3UOWA 1O92A 3IMLA 4L2ZA 4ODJA 2OBVA 4L7IA 4KTTA 3TDEA 4L4QA 5H9UA 2YWCA 5A19A 1RG9A 3S82A 2YWBA 1P7LA 4NDNA 1MXCA 4HPVA 1XRAA 4WS9A 3RV2A 4KTVA 1XRCA
chains in the Genus database with same CATH superfamily
4LF6C 3A9VA 1P4EA 1LCIA 1WCJA 4DR1C 4X65C 4JI4C 2M5HA 1XNQC 1ML8A 3J81D 4ZJZA 4D4IA 5LMNC 2KZ0A 4BC9A 2QVZX 1MXCA 4PHTA 3UX3A 4LF4C 1USPB 4NXMC 2D1QA 1XNRC 1HR0C 1QM4A 4PZPA 4TPSB 5BSRA 2ZZNA 5E7QA 4DR7C 4LF5C 3IPLA 1RG9A 5IWAC 4YHHC 4NXNC 5BSVA 1BA3A 5KEIA 1T5DX 1AMUA 3EQ6A 1LQLA 2HHHC 4LF7C 2DPLA 1VEHA 5BURA 3AF5A 3R9WA 4DV5C 3LUSA 4AQYC 3PBKA 1FJGC 1M6XA 2Y4OA 5AE1A 2PROA 4PUGA 5KYTA 4B3TC 1XRCA 4DR3C 3JAMD 1XRBA 4DR5C 3LNVA 3VNRA 2D7VA 4DV0C 1MXBA 3N54B 4RM3A 1YJ7A 5LCIA 3FCEA 1MDBA 4DR4C 3NPDA 3TQIA 4RVNA 3DLPX 2V7BA 2DYJA 1IB8A 1VLAA 4JI6C 2Y4NA 2F4VC 4NDNA 2VQEC 4JI0C 4D57A 3C5EA 2OPLA 3DHVA 4IZ6A 2E0GA 2XR1A 2ZM6C 3RG2A 2UUCC 2UXCC 4DV7C 3GPCA 2MM9A 3H2TA 4DUZC 5T8TA 3GKUA 1HH2P 1N32C 2OO4A 5A19A 2P2QA 3S82A 4OX9C 2QVYX 2JMPA 1EGAA 4BSZA 2D1RA 3I07A 4BC7A 4GKKC 3GR1A 1ZB9A 4MH4A 4LE5A 1O93A 5JRHA 5CZXA 1MD9A 4LFCC 4YY3C 1WH9A 4B3MC 4DUYC 3VNSA 4FTFA 4JI1C 2VZEA 4D4GA 1N36C 3RV2A 4RMNA 4K0KC 1O9TA 4RM2A 2CU6A 1PU1A 1P4EC 2ATWA 3L8CA 5T8SA 3CW9A 3KXWA 1MXAA 3IEUA 2VQFC 2P2FA 4RVOA 4GXRA 4LFBC 2BH1X 2P2BA 2YWCA 1MKYA 3O2EA 1RY2A 4PROC 4G36A 4R0MA 1N33C 3FCCA 2E8EA 3CW8X 4R1LA 2EGTA 3OTOC 3LNOA 1PG3A 1XS3A 3ETCA 4DV3C 3CQ2A 5BUSA 2UUAC 1T5HX 2UU9C 3TDEA 5BSUA 4L4QA 4KHPC 1UKKA 3LGXA 3I08A 4JM1A 4JYAC 3PESA 2CY1A 3J80D 4DV6C 3A25A 5BSWA 3TR3A 1J5EC 4ISBA 4LF9C 4GS5A 5K85A 2D28C 2PN2A 3UOWA 4B3RC 3GR0A 4L7IA 3PROC 4DG8A 4JI3C 2P2MA 1MDFA 1V60A 2WD9A 5KYVA 4WS9A 1UWDA 2AYAA 1HNXC 3G7SA 2BJOA 2QVXX 3DAYA 4I9GA 2YX1A 5ADZA 2D27A 3A9UA 4DV2C 4GXQA 5AE2A 4X64C 2UXBC 4DG9A 3CQ3A 2HJGA 1I94C 1K0RA 2ASBA 2ONFA 3UEBA 4OXIA 3K6RA 4X66C 4FUQA 1HNWC 3AF6A 3EERA 3B7WA 4WV3A 4DCSA 1ULTA 1O90A 4G1IA 2KDNA 4MTNA 4LFAC 4JV5C 4PUHA 2P2JA 2YCBA 4L2ZA 3UZ0A 2PT7G 2NCLA 4NOZA 2YWBA 3LAXA 3N2QA 5GTDA 1HNZC 2D1TA 1XHJA 2MCQA 3E7WA 2E8CA 4OYCA 3SO4A 1V25A 3R9XA 2P20A 3T1HC 1USPA 1NYEA 2OBVA 1V26A 2UUBC 3NYRA 3T1YC 1N34C 4DCVA 4FUTA 4ZLPA 1QWIA 5BR8C 1FLOA 1IBKC 4JI2C 3AY0A 3L95X 3ETOA 1XMQC 2P02A 4DV4C 5A1GA 1IBMC 3VNQA 2QW0X 5BSTA 4GKJC 2KZFA 4JI8C 2E5LC 1KKGA 3CJEA 5FLXD 1XRAA 2DHMA 5A2QD 1XMOC 4PUIA 2UXDC 2VSQA 4X62C 2D1SA 2ZZMA 1FUGA 2E8FA 4XX2A 3TUFA 3NYQA 3IMLA 4ODJA 1N2FA 3E7XA 1NY8A 5K8FA 5CZVA 4BBYA 4D56A 5IFIA 4LF8C 2MMAB 2JNVA 1M6XC 2M5OA 4B3SC 2WP0C 3A4IA 4RLQA 3IEVA 3R44A 5LMUC 5BSMA 3UX2A 4I9FA 1WF3A 4G37A 4K0BA 4DCUA 1IBLC 4U5YD 2OPLB 4DR6C 1ZB8A 1TH5A 1PG4A 4EATA 1GPMA 1JOSA 1PA4A 5A1IA 3A26A 2E7GA 3CQ1A 4BCAA 4IR7A 2CXCA 5AE3A 4DV1C 4R1MA 1O92A 4JI7C 4DCTA 2Y27A 4KTTA 5BUQA 4JI5C 5H9UA 3NI2A 4DR2C 1P7LA 4RLFA 4HPVA 5IT9D 2Z51A 2QL8A 1L2FA 4KTVA 5DV9A
chains in the Genus database with same CATH topology
4LF6C 3A9VA 1LCIA 4DR1C 4X65C 4JI4C 1XNQC 1ML8A 3J81D 4ZJZA 4D4IA 5LMNC 4BC9A 2QVZX 1MXCA 4PHTA 4LF4C 1USPB 4NXMC 2D1QA 1XNRC 1HR0C 1QM4A 4PZPA 4TPSB 5BSRA 5E7QA 4DR7C 4LF5C 3IPLA 1RG9A 5IWAC 4YHHC 4NXNC 5BSVA 1BA3A 5KEIA 1T5DX 1AMUA 3EQ6A 1LQLA 2HHHC 4LF7C 2DPLA 5BURA 3AF5A 3R9WA 4DV5C 3LUSA 4AQYC 3PBKA 1FJGC 2Y4OA 5AE1A 2PROA 5KYTA 4B3TC 1XRCA 4DR3C 3JAMD 1XRBA 4DR5C 3LNVA 3VNRA 2D7VA 4DV0C 1MXBA 3N54B 4RM3A 1YJ7A 3FCEA 1MDBA 4DR4C 3NPDA 3TQIA 4RVNA 3DLPX 2V7BA 2DYJA 1VLAA 4JI6C 2Y4NA 2F4VC 4NDNA 2VQEC 4JI0C 4D57A 3C5EA 2OPLA 3DHVA 4IZ6A 2E0GA 2XR1A 2ZM6C 3RG2A 2UUCC 2UXCC 4DV7C 3GPCA 3H2TA 4DUZC 5T8TA 3GKUA 1HH2P 1N32C 2OO4A 5A19A 2P2QA 3S82A 4OX9C 2QVYX 2JMPA 1EGAA 4BSZA 2D1RA 3I07A 4BC7A 4GKKC 3GR1A 1ZB9A 4MH4A 4LE5A 1O93A 5JRHA 5CZXA 1MD9A 4LFCC 4YY3C 1WH9A 4B3MC 4DUYC 3VNSA 4FTFA 4JI1C 2VZEA 4D4GA 1N36C 3RV2A 4RMNA 4K0KC 1O9TA 4RM2A 2ATWA 3L8CA 5T8SA 3CW9A 3KXWA 1MXAA 3IEUA 2VQFC 2P2FA 4RVOA 4GXRA 4LFBC 2BH1X 2P2BA 2YWCA 1MKYA 1RY2A 4PROC 4G36A 4R0MA 1N33C 3FCCA 2E8EA 3CW8X 4R1LA 2EGTA 3OTOC 1PG3A 3ETCA 4DV3C 5BUSA 2UUAC 1T5HX 2UU9C 3TDEA 5BSUA 4L4QA 4KHPC 1UKKA 3LGXA 3I08A 4JM1A 4JYAC 3PESA 2CY1A 3J80D 4DV6C 5BSWA 1J5EC 4ISBA 4LF9C 4GS5A 5K85A 2D28C 2PN2A 3UOWA 4B3RC 3GR0A 4L7IA 3PROC 4DG8A 4JI3C 2P2MA 1MDFA 2WD9A 5KYVA 4WS9A 2AYAA 1HNXC 3G7SA 2BJOA 2QVXX 3DAYA 4I9GA 5ADZA 2D27A 3A9UA 4DV2C 4GXQA 5AE2A 4X64C 2UXBC 4DG9A 2HJGA 1I94C 1K0RA 2ASBA 2ONFA 4OXIA 4X66C 4FUQA 1HNWC 3AF6A 3EERA 3B7WA 4WV3A 4DCSA 1ULTA 1O90A 4G1IA 4MTNA 4LFAC 4JV5C 2P2JA 2YCBA 4L2ZA 3UZ0A 2PT7G 4NOZA 2YWBA 3LAXA 3N2QA 5GTDA 1HNZC 2D1TA 3E7WA 2E8CA 4OYCA 3SO4A 1V25A 3R9XA 2P20A 3T1HC 1USPA 1NYEA 2OBVA 1V26A 2UUBC 3NYRA 3T1YC 1N34C 4DCVA 4FUTA 4ZLPA 1QWIA 5BR8C 1IBKC 4JI2C 3L95X 3ETOA 1XMQC 2P02A 4DV4C 5A1GA 1IBMC 3VNQA 2QW0X 5BSTA 4GKJC 2KZFA 4JI8C 2E5LC 1KKGA 3CJEA 5FLXD 1XRAA 5A2QD 1XMOC 2UXDC 2VSQA 4X62C 2D1SA 1FUGA 2E8FA 4XX2A 3TUFA 3NYQA 3IMLA 4ODJA 1N2FA 3E7XA 5K8FA 5CZVA 4BBYA 4D56A 5IFIA 4LF8C 4B3SC 2WP0C 3A4IA 4RLQA 3IEVA 3R44A 5LMUC 5BSMA 4I9FA 1WF3A 4G37A 4K0BA 4DCUA 1IBLC 4U5YD 2OPLB 4DR6C 1ZB8A 1PG4A 4EATA 1GPMA 1JOSA 1PA4A 5A1IA 2E7GA 4BCAA 4IR7A 2CXCA 5AE3A 4DV1C 4R1MA 1O92A 4JI7C 4DCTA 2Y27A 4KTTA 5BUQA 4JI5C 5H9UA 3NI2A 4DR2C 1P7LA 4RLFA 4HPVA 5IT9D 2QL8A 1L2FA 4KTVA 5DV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPM A;  1O9T A;  1O90 A;  3A4I A;  1XRB A;  5A1I A;  4LE5 A;  1O93 A;  1MXB A;  2P02 A;  1QM4 A;  3SO4 A;  5T8S A;  5A1G A;  1FUG A;  1MXA A;  2DPL A;  3TQI A;  4K0B A;  5T8T A;  3UOW A;  1O92 A;  3IML A;  4L2Z A;  4ODJ A;  2OBV A;  4L7I A;  4KTT A;  3TDE A;  4L4Q A;  5H9U A;  2YWC A;  5A19 A;  1RG9 A;  3S82 A;  2YWB A;  1P7L A;  4NDN A;  1MXC A;  4HPV A;  1XRA A;  4WS9 A;  3RV2 A;  4KTV A;  1XRC A; 
#chains in the Genus database with same CATH topology
 4LF6 C;  3A9V A;  1P4E A;  1LCI A;  1WCJ A;  4DR1 C;  4X65 C;  4JI4 C;  2M5H A;  1XNQ C;  1ML8 A;  3J81 D;  4ZJZ A;  4D4I A;  5LMN C;  2KZ0 A;  4BC9 A;  2QVZ X;  1MXC A;  4PHT A;  3UX3 A;  4LF4 C;  1USP B;  4NXM C;  2D1Q A;  1XNR C;  1HR0 C;  1QM4 A;  4PZP A;  4TPS B;  5BSR A;  2ZZN A;  5E7Q A;  4DR7 C;  4LF5 C;  3IPL A;  1RG9 A;  5IWA C;  4YHH C;  4NXN C;  5BSV A;  1BA3 A;  5KEI A;  1T5D X;  1AMU A;  3EQ6 A;  1LQL A;  2HHH C;  4LF7 C;  2DPL A;  1VEH A;  5BUR A;  3AF5 A;  3R9W A;  4DV5 C;  3LUS A;  4AQY C;  3PBK A;  1FJG C;  1M6X A;  2Y4O A;  5AE1 A;  2PRO A;  4PUG A;  5KYT A;  4B3T C;  1XRC A;  4DR3 C;  3JAM D;  1XRB A;  4DR5 C;  3LNV A;  3VNR A;  2D7V A;  4DV0 C;  1MXB A;  3N54 B;  4RM3 A;  1YJ7 A;  5LCI A;  3FCE A;  1MDB A;  4DR4 C;  3NPD A;  3TQI A;  4RVN A;  3DLP X;  2V7B A;  2DYJ A;  1IB8 A;  1VLA A;  4JI6 C;  2Y4N A;  2F4V C;  4NDN A;  2VQE C;  4JI0 C;  4D57 A;  3C5E A;  2OPL A;  3DHV A;  4IZ6 A;  2E0G A;  2XR1 A;  2ZM6 C;  3RG2 A;  2UUC C;  2UXC C;  4DV7 C;  3GPC A;  2MM9 A;  3H2T A;  4DUZ C;  5T8T A;  3GKU A;  1HH2 P;  1N32 C;  2OO4 A;  5A19 A;  2P2Q A;  3S82 A;  4OX9 C;  2QVY X;  2JMP A;  1EGA A;  4BSZ A;  2D1R A;  3I07 A;  4BC7 A;  4GKK C;  3GR1 A;  1ZB9 A;  4MH4 A;  4LE5 A;  1O93 A;  5JRH A;  5CZX A;  1MD9 A;  4LFC C;  4YY3 C;  1WH9 A;  4B3M C;  4DUY C;  3VNS A;  4FTF A;  4JI1 C;  2VZE A;  4D4G A;  1N36 C;  3RV2 A;  4RMN A;  4K0K C;  1O9T A;  4RM2 A;  2CU6 A;  1PU1 A;  1P4E C;  2ATW A;  3L8C A;  5T8S A;  3CW9 A;  3KXW A;  1MXA A;  3IEU A;  2VQF C;  2P2F A;  4RVO A;  4GXR A;  4LFB C;  2BH1 X;  2P2B A;  2YWC A;  1MKY A;  3O2E A;  1RY2 A;  4PRO C;  4G36 A;  4R0M A;  1N33 C;  3FCC A;  2E8E A;  3CW8 X;  4R1L A;  2EGT A;  3OTO C;  3LNO A;  1PG3 A;  1XS3 A;  3ETC A;  4DV3 C;  3CQ2 A;  5BUS A;  2UUA C;  1T5H X;  2UU9 C;  3TDE A;  5BSU A;  4L4Q A;  4KHP C;  1UKK A;  3LGX A;  3I08 A;  4JM1 A;  4JYA C;  3PES A;  2CY1 A;  3J80 D;  4DV6 C;  3A25 A;  5BSW A;  3TR3 A;  1J5E C;  4ISB A;  4LF9 C;  4GS5 A;  5K85 A;  2D28 C;  2PN2 A;  3UOW A;  4B3R C;  3GR0 A;  4L7I A;  3PRO C;  4DG8 A;  4JI3 C;  2P2M A;  1MDF A;  1V60 A;  2WD9 A;  5KYV A;  4WS9 A;  1UWD A;  2AYA A;  1HNX C;  3G7S A;  2BJO A;  2QVX X;  3DAY A;  4I9G A;  2YX1 A;  5ADZ A;  2D27 A;  3A9U A;  4DV2 C;  4GXQ A;  5AE2 A;  4X64 C;  2UXB C;  4DG9 A;  3CQ3 A;  2HJG A;  1I94 C;  1K0R A;  2ASB A;  2ONF A;  3UEB A;  4OXI A;  3K6R A;  4X66 C;  4FUQ A;  1HNW C;  3AF6 A;  3EER A;  3B7W A;  4WV3 A;  4DCS A;  1ULT A;  1O90 A;  4G1I A;  2KDN A;  4MTN A;  4LFA C;  4JV5 C;  4PUH A;  2P2J A;  2YCB A;  4L2Z A;  3UZ0 A;  2PT7 G;  2NCL A;  4NOZ A;  2YWB A;  3LAX A;  3N2Q A;  5GTD A;  1HNZ C;  2D1T A;  1XHJ A;  2MCQ A;  3E7W A;  2E8C A;  4OYC A;  3SO4 A;  1V25 A;  3R9X A;  2P20 A;  3T1H C;  1USP A;  1NYE A;  2OBV A;  1V26 A;  2UUB C;  3NYR A;  3T1Y C;  1N34 C;  4DCV A;  4FUT A;  4ZLP A;  1QWI A;  5BR8 C;  1FLO A;  1IBK C;  4JI2 C;  3AY0 A;  3L95 X;  3ETO A;  1XMQ C;  2P02 A;  4DV4 C;  5A1G A;  1IBM C;  3VNQ A;  2QW0 X;  5BST A;  4GKJ C;  2KZF A;  4JI8 C;  2E5L C;  1KKG A;  3CJE A;  5FLX D;  1XRA A;  2DHM A;  5A2Q D;  1XMO C;  4PUI A;  2UXD C;  2VSQ A;  4X62 C;  2D1S A;  2ZZM A;  1FUG A;  2E8F A;  4XX2 A;  3TUF A;  3NYQ A;  3IML A;  4ODJ A;  1N2F A;  3E7X A;  1NY8 A;  5K8F A;  5CZV A;  4BBY A;  4D56 A;  5IFI A;  4LF8 C;  2MMA B;  2JNV A;  1M6X C;  2M5O A;  4B3S C;  2WP0 C;  3A4I A;  4RLQ A;  3IEV A;  3R44 A;  5LMU C;  5BSM A;  3UX2 A;  4I9F A;  1WF3 A;  4G37 A;  4K0B A;  4DCU A;  1IBL C;  4U5Y D;  2OPL B;  4DR6 C;  1ZB8 A;  1TH5 A;  1PG4 A;  4EAT A;  1GPM A;  1JOS A;  1PA4 A;  5A1I A;  3A26 A;  2E7G A;  3CQ1 A;  4BCA A;  4IR7 A;  2CXC A;  5AE3 A;  4DV1 C;  4R1M A;  1O92 A;  4JI7 C;  4DCT A;  2Y27 A;  4KTT A;  5BUQ A;  4JI5 C;  5H9U A;  3NI2 A;  4DR2 C;  1P7L A;  4RLF A;  4HPV A;  5IT9 D;  2Z51 A;  2QL8 A;  1L2F A;  4KTV A;  5DV9 A; 
#chains in the Genus database with same CATH homology
 4LF6 C;  3A9V A;  1LCI A;  4DR1 C;  4X65 C;  4JI4 C;  1XNQ C;  1ML8 A;  3J81 D;  4ZJZ A;  4D4I A;  5LMN C;  4BC9 A;  2QVZ X;  1MXC A;  4PHT A;  4LF4 C;  1USP B;  4NXM C;  2D1Q A;  1XNR C;  1HR0 C;  1QM4 A;  4PZP A;  4TPS B;  5BSR A;  5E7Q A;  4DR7 C;  4LF5 C;  3IPL A;  1RG9 A;  5IWA C;  4YHH C;  4NXN C;  5BSV A;  1BA3 A;  5KEI A;  1T5D X;  1AMU A;  3EQ6 A;  1LQL A;  2HHH C;  4LF7 C;  2DPL A;  5BUR A;  3AF5 A;  3R9W A;  4DV5 C;  3LUS A;  4AQY C;  3PBK A;  1FJG C;  2Y4O A;  5AE1 A;  2PRO A;  5KYT A;  4B3T C;  1XRC A;  4DR3 C;  3JAM D;  1XRB A;  4DR5 C;  3LNV A;  3VNR A;  2D7V A;  4DV0 C;  1MXB A;  3N54 B;  4RM3 A;  1YJ7 A;  3FCE A;  1MDB A;  4DR4 C;  3NPD A;  3TQI A;  4RVN A;  3DLP X;  2V7B A;  2DYJ A;  1VLA A;  4JI6 C;  2Y4N A;  2F4V C;  4NDN A;  2VQE C;  4JI0 C;  4D57 A;  3C5E A;  2OPL A;  3DHV A;  4IZ6 A;  2E0G A;  2XR1 A;  2ZM6 C;  3RG2 A;  2UUC C;  2UXC C;  4DV7 C;  3GPC A;  3H2T A;  4DUZ C;  5T8T A;  3GKU A;  1HH2 P;  1N32 C;  2OO4 A;  5A19 A;  2P2Q A;  3S82 A;  4OX9 C;  2QVY X;  2JMP A;  1EGA A;  4BSZ A;  2D1R A;  3I07 A;  4BC7 A;  4GKK C;  3GR1 A;  1ZB9 A;  4MH4 A;  4LE5 A;  1O93 A;  5JRH A;  5CZX A;  1MD9 A;  4LFC C;  4YY3 C;  1WH9 A;  4B3M C;  4DUY C;  3VNS A;  4FTF A;  4JI1 C;  2VZE A;  4D4G A;  1N36 C;  3RV2 A;  4RMN A;  4K0K C;  1O9T A;  4RM2 A;  2ATW A;  3L8C A;  5T8S A;  3CW9 A;  3KXW A;  1MXA A;  3IEU A;  2VQF C;  2P2F A;  4RVO A;  4GXR A;  4LFB C;  2BH1 X;  2P2B A;  2YWC A;  1MKY A;  1RY2 A;  4PRO C;  4G36 A;  4R0M A;  1N33 C;  3FCC A;  2E8E A;  3CW8 X;  4R1L A;  2EGT A;  3OTO C;  1PG3 A;  3ETC A;  4DV3 C;  5BUS A;  2UUA C;  1T5H X;  2UU9 C;  3TDE A;  5BSU A;  4L4Q A;  4KHP C;  1UKK A;  3LGX A;  3I08 A;  4JM1 A;  4JYA C;  3PES A;  2CY1 A;  3J80 D;  4DV6 C;  5BSW A;  1J5E C;  4ISB A;  4LF9 C;  4GS5 A;  5K85 A;  2D28 C;  2PN2 A;  3UOW A;  4B3R C;  3GR0 A;  4L7I A;  3PRO C;  4DG8 A;  4JI3 C;  2P2M A;  1MDF A;  2WD9 A;  5KYV A;  4WS9 A;  2AYA A;  1HNX C;  3G7S A;  2BJO A;  2QVX X;  3DAY A;  4I9G A;  5ADZ A;  2D27 A;  3A9U A;  4DV2 C;  4GXQ A;  5AE2 A;  4X64 C;  2UXB C;  4DG9 A;  2HJG A;  1I94 C;  1K0R A;  2ASB A;  2ONF A;  4OXI A;  4X66 C;  4FUQ A;  1HNW C;  3AF6 A;  3EER A;  3B7W A;  4WV3 A;  4DCS A;  1ULT A;  1O90 A;  4G1I A;  4MTN A;  4LFA C;  4JV5 C;  2P2J A;  2YCB A;  4L2Z A;  3UZ0 A;  2PT7 G;  4NOZ A;  2YWB A;  3LAX A;  3N2Q A;  5GTD A;  1HNZ C;  2D1T A;  3E7W A;  2E8C A;  4OYC A;  3SO4 A;  1V25 A;  3R9X A;  2P20 A;  3T1H C;  1USP A;  1NYE A;  2OBV A;  1V26 A;  2UUB C;  3NYR A;  3T1Y C;  1N34 C;  4DCV A;  4FUT A;  4ZLP A;  1QWI A;  5BR8 C;  1IBK C;  4JI2 C;  3L95 X;  3ETO A;  1XMQ C;  2P02 A;  4DV4 C;  5A1G A;  1IBM C;  3VNQ A;  2QW0 X;  5BST A;  4GKJ C;  2KZF A;  4JI8 C;  2E5L C;  1KKG A;  3CJE A;  5FLX D;  1XRA A;  5A2Q D;  1XMO C;  2UXD C;  2VSQ A;  4X62 C;  2D1S A;  1FUG A;  2E8F A;  4XX2 A;  3TUF A;  3NYQ A;  3IML A;  4ODJ A;  1N2F A;  3E7X A;  5K8F A;  5CZV A;  4BBY A;  4D56 A;  5IFI A;  4LF8 C;  4B3S C;  2WP0 C;  3A4I A;  4RLQ A;  3IEV A;  3R44 A;  5LMU C;  5BSM A;  4I9F A;  1WF3 A;  4G37 A;  4K0B A;  4DCU A;  1IBL C;  4U5Y D;  2OPL B;  4DR6 C;  1ZB8 A;  1PG4 A;  4EAT A;  1GPM A;  1JOS A;  1PA4 A;  5A1I A;  2E7G A;  4BCA A;  4IR7 A;  2CXC A;  5AE3 A;  4DV1 C;  4R1M A;  1O92 A;  4JI7 C;  4DCT A;  2Y27 A;  4KTT A;  5BUQ A;  4JI5 C;  5H9U A;  3NI2 A;  4DR2 C;  1P7L A;  4RLF A;  4HPV A;  5IT9 D;  2QL8 A;  1L2F A;  4KTV A;  5DV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...