1RG9A

S-adenosylmethionine synthetase complexed with sam and ppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
Knots found
sequence length
383
structure length
383
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
publication title Crystal structure of the S-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
source organism Escherichia coli
total genus 122
structure length 383
sequence length 383
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A01
4L2ZA 4KTTA 4L4QA 1RG9A 5T8SA 2OBVA 1MXCA 5H9UA 1O90A 3TDEA 3IMLA 1XRAA 1XRCA 4NDNA 5A1IA 1QM4A 4K0BA 3RV2A 3S82A 3UOWA 4ODJA 4L7IA 3SO4A 1O92A 1GPMA 1O93A 1P7LA 4KTVA 3TQIA 2YWBA 2DPLA 5A19A 1FUGA 3A4IA 5T8TA 4WS9A 1MXAA 5A1GA 4HPVA 2YWCA 2P02A 4LE5A 1O9TA 1XRBA 1MXBA
chains in the Genus database with same CATH superfamily
4PUIA 4KTTA 4JI3C 4GKJC 1XHJA 3FCEA 3NYRA 2YX1A 3O2EA 4BC9A 4DR3C 1WH9A 2D1QA 1XRAA 3VNSA 1P4EC 2ONFA 3RV2A 1RY2A 2M5HA 1PU1A 2VZEA 4LF5C 3EQ6A 3PROC 3ETOA 5AE2A 2UXCC 5K8FA 3R44A 4GS5A 2P2QA 3A26A 4R1LA 2E0GA 3DHVA 4TPSB 3L95X 3DLPX 3GPCA 3CW9A 4DG9A 3LGXA 4GKKC 5BUSA 4ZJZA 4DCTA 1ULTA 4PHTA 5AE3A 1USPA 2ZM6C 3N54B 2KZFA 1N34C 2F4VC 1XNRC 4YY3C 4DR4C 5K85A 5T8TA 2PN2A 5BSWA 3JAMD 3LNVA 2YWCA 1PG4A 4FUTA 4G36A 4ISBA 3PESA 3TUFA 2OBVA 4NXNC 2D1SA 5H9UA 4JI5C 2WP0C 2CXCA 4DV5C 2JMPA 1WF3A 5IWAC 2MM9A 1O93A 3A9UA 4D4GA 5A1GA 4DUYC 4PROC 2ASBA 4L2ZA 4D56A 4DCVA 2E8CA 2E7GA 4G1IA 3CQ3A 1YJ7A 3I07A 4ODJA 1O92A 4BSZA 4BCAA 4IZ6A 4MTNA 1PG3A 3A4IA 4PZPA 2D7VA 2KDNA 3GR0A 4WS9A 4JI0C 1FLOA 2P02A 3E7XA 1T5HX 4DR5C 3AF5A 4DV2C 1MKYA 2DHMA 1J5EC 4R0MA 1N32C 1I94C 4DR7C 3IPLA 5KYVA 3UEBA 1TH5A 4X66C 4IR7A 2P2MA 3ETCA 4JI1C 3TR3A 2D1RA 4RLQA 1K0RA 2QVYX 1GPMA 2QVZX 3R9WA 2P2BA 3RG2A 2Y4NA 4B3TC 4LFCC 2D27A 3LUSA 4FTFA 2HJGA 1LQLA 3VNRA 2BJOA 1N36C 3N2QA 1XNQC 3L8CA 1NYEA 5FLXD 4LF8C 1N33C 2MCQA 2P2FA 5A1IA 1QM4A 4X62C 3UX2A 2UUCC 4DG8A 4LF6C 3C5EA 1UKKA 4OX9C 4X65C 3TQIA 5BSVA 5GTDA 2OO4A 3IEVA 1UWDA 4OYCA 3CQ1A 1MXCA 3T1HC 5IFIA 5JRHA 4JI4C 2D1TA 1XMQC 4PUGA 2UUAC 4RM3A 4NXMC 4RM2A 1XMOC 4DV0C 4LFAC 3NPDA 1HNZC 2E8EA 4D57A 4JYAC 1XRBA 1MDBA 1PA4A 2NCLA 5KEIA 4OXIA 4DCUA 2Z51A 3TDEA 1XRCA 2PROA 4K0BA 1P4EA 2ZZNA 2QW0X 1M6XA 1VLAA 4JM1A 4L7IA 5BUQA 3UZ0A 2UUBC 1MDFA 4DR6C 3I08A 1FUGA 4NOZA 2CY1A 2WD9A 4FUQA 5BSRA 3IEUA 2PT7G 4LE5A 5LCIA 2E5LC 4LFBC 2OPLB 4DV1C 4RVNA 4GXQA 1LCIA 3IMLA 3UOWA 3A25A 1HNWC 1XS3A 3DAYA 2E8FA 4D4IA 2Y27A 1MXBA 2VSQA 1HR0C 1V26A 5CZVA 2OPLA 4K0KC 3AY0A 1VEHA 5ADZA 3T1YC 2P2JA 2D28C 2XR1A 2YWBA 4RLFA 3CQ2A 4DV7C 1ZB9A 2EGTA 5DV9A 4B3MC 1IBLC 4MH4A 1AMUA 1RG9A 2QL8A 5T8SA 1ZB8A 5BR8C 2VQEC 5AE1A 3NI2A 1M6XC 3S82A 4PUHA 4RVOA 3GKUA 1USPB 4JI2C 3EERA 1P7LA 5A19A 2M5OA 2V7BA 3KXWA 2JNVA 4DV4C 1MD9A 1HH2P 5BSTA 1IBKC 4YHHC 1FJGC 1HNXC 4JV5C 1V25A 4NDNA 4LF7C 3VNQA 1JOSA 2QVXX 3SO4A 4DR1C 3OTOC 1IB8A 4I9FA 2Y4OA 3GR1A 3PBKA 4LF4C 4I9GA 4U5YD 4AQYC 4JI7C 2ATWA 2UXBC 2UXDC 4GXRA 1T5DX 1O90A 4B3SC 1NY8A 1QWIA 1ML8A 2BH1X 3LAXA 3CJEA 4BC7A 4RMNA 5BURA 2YCBA 2MMAB 2P20A 3G7SA 4JI8C 4KTVA 5A2QD 3UX3A 4DV6C 4DR2C 4X64C 3AF6A 1V60A 3NYQA 1KKGA 3E7WA 2UU9C 4DUZC 2ZZMA 5E7QA 2HHHC 3J80D 2VQFC 3A9VA 4LF9C 3LNOA 4ZLPA 2AYAA 5IT9D 3K6RA 5KYTA 2KZ0A 4KHPC 3B7WA 3R9XA 5BSUA 2DYJA 3FCCA 4L4QA 3H2TA 4DCSA 4G37A 1N2FA 1IBMC 4DV3C 4EATA 3CW8X 4XX2A 1EGAA 1BA3A 1WCJA 4JI6C 4WV3A 1L2FA 4B3RC 5LMNC 4BBYA 3J81D 2DPLA 5BSMA 4R1MA 1MXAA 5LMUC 4HPVA 2CU6A 5CZXA 1O9TA
chains in the Genus database with same CATH topology
4KTTA 4JI3C 4GKJC 3FCEA 3NYRA 4DR3C 4BC9A 1WH9A 2D1QA 1XRAA 3VNSA 2ONFA 3RV2A 1RY2A 2VZEA 4LF5C 3EQ6A 3PROC 3ETOA 5AE2A 2UXCC 5K8FA 3R44A 4GS5A 2P2QA 4R1LA 2E0GA 3DHVA 4TPSB 3L95X 3DLPX 3GPCA 3CW9A 4DG9A 3LGXA 4GKKC 5BUSA 4ZJZA 4DCTA 1ULTA 4PHTA 5AE3A 1USPA 2ZM6C 3N54B 2KZFA 1N34C 2F4VC 1XNRC 4YY3C 4DR4C 5K85A 5T8TA 2PN2A 5BSWA 3JAMD 3LNVA 2YWCA 1PG4A 4FUTA 4G36A 4ISBA 3PESA 3TUFA 2OBVA 4NXNC 2D1SA 5H9UA 4JI5C 2WP0C 2CXCA 4DV5C 2JMPA 1WF3A 5IWAC 1O93A 3A9UA 4D4GA 5A1GA 4DUYC 4PROC 2ASBA 4L2ZA 4D56A 4DCVA 2E8CA 2E7GA 4G1IA 1YJ7A 3I07A 4ODJA 1O92A 4BSZA 4BCAA 4IZ6A 4MTNA 1PG3A 3A4IA 4PZPA 2D7VA 3GR0A 4WS9A 4JI0C 2P02A 3E7XA 1T5HX 4DR5C 3AF5A 4DV2C 1MKYA 1J5EC 4R0MA 1N32C 1I94C 4DR7C 3IPLA 5KYVA 4X66C 4IR7A 2P2MA 3ETCA 4JI1C 2D1RA 4RLQA 1K0RA 2QVYX 1GPMA 2QVZX 3R9WA 2P2BA 3RG2A 2Y4NA 4B3TC 4LFCC 2D27A 3LUSA 4FTFA 2HJGA 1LQLA 3VNRA 2BJOA 1N36C 3N2QA 1XNQC 3L8CA 1NYEA 5FLXD 4LF8C 1N33C 2P2FA 5A1IA 1QM4A 4X62C 2UUCC 4DG8A 4LF6C 3C5EA 1UKKA 4OX9C 4X65C 3TQIA 5BSVA 5GTDA 2OO4A 3IEVA 4OYCA 1MXCA 3T1HC 5IFIA 5JRHA 4JI4C 2D1TA 1XMQC 2UUAC 4RM3A 4NXMC 4RM2A 1XMOC 4DV0C 4LFAC 3NPDA 1HNZC 2E8EA 4D57A 4JYAC 1XRBA 1MDBA 1PA4A 5KEIA 4OXIA 4DCUA 3TDEA 1XRCA 2PROA 4K0BA 2QW0X 1VLAA 4JM1A 4L7IA 5BUQA 3UZ0A 2UUBC 1MDFA 4DR6C 3I08A 1FUGA 4NOZA 2CY1A 2WD9A 4FUQA 5BSRA 3IEUA 2PT7G 4LE5A 2E5LC 4LFBC 2OPLB 4DV1C 4RVNA 4GXQA 1LCIA 3IMLA 3UOWA 1HNWC 3DAYA 2E8FA 4D4IA 2Y27A 1MXBA 2VSQA 1HR0C 1V26A 5CZVA 2OPLA 4K0KC 5ADZA 3T1YC 2P2JA 2D28C 2XR1A 2YWBA 4RLFA 4DV7C 1ZB9A 2EGTA 5DV9A 4B3MC 1IBLC 4MH4A 1AMUA 1RG9A 2QL8A 5T8SA 1ZB8A 5BR8C 2VQEC 5AE1A 3NI2A 3S82A 4RVOA 3GKUA 1USPB 4JI2C 3EERA 1P7LA 5A19A 2V7BA 3KXWA 4DV4C 1MD9A 1HH2P 5BSTA 1IBKC 4YHHC 1FJGC 1HNXC 4JV5C 1V25A 4NDNA 4LF7C 3VNQA 1JOSA 2QVXX 3SO4A 4DR1C 3OTOC 4I9FA 2Y4OA 3GR1A 3PBKA 4LF4C 4I9GA 4U5YD 4AQYC 4JI7C 2ATWA 2UXBC 2UXDC 4GXRA 1T5DX 1O90A 4B3SC 1QWIA 1ML8A 2BH1X 3LAXA 3CJEA 4BC7A 4RMNA 5BURA 2YCBA 2P20A 3G7SA 4JI8C 4KTVA 5A2QD 4DV6C 4DR2C 4X64C 3AF6A 3NYQA 1KKGA 3E7WA 2UU9C 4DUZC 5E7QA 2HHHC 3J80D 2VQFC 3A9VA 4LF9C 4ZLPA 2AYAA 5IT9D 5KYTA 4KHPC 3B7WA 3R9XA 5BSUA 2DYJA 3FCCA 4L4QA 3H2TA 4DCSA 4G37A 1N2FA 1IBMC 4DV3C 4EATA 3CW8X 4XX2A 1EGAA 1BA3A 4JI6C 4WV3A 1L2FA 4B3RC 5LMNC 4BBYA 3J81D 2DPLA 5BSMA 4R1MA 1MXAA 5LMUC 4HPVA 5CZXA 1O9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L2Z A;  4KTT A;  4L4Q A;  1RG9 A;  5T8S A;  2OBV A;  1MXC A;  5H9U A;  1O90 A;  3TDE A;  3IML A;  1XRA A;  1XRC A;  4NDN A;  5A1I A;  1QM4 A;  4K0B A;  3RV2 A;  3S82 A;  3UOW A;  4ODJ A;  4L7I A;  3SO4 A;  1O92 A;  1GPM A;  1O93 A;  1P7L A;  4KTV A;  3TQI A;  2YWB A;  2DPL A;  5A19 A;  1FUG A;  3A4I A;  5T8T A;  4WS9 A;  1MXA A;  5A1G A;  4HPV A;  2YWC A;  2P02 A;  4LE5 A;  1O9T A;  1XRB A;  1MXB A; 
#chains in the Genus database with same CATH topology
 4PUI A;  4KTT A;  4JI3 C;  4GKJ C;  1XHJ A;  3FCE A;  3NYR A;  2YX1 A;  3O2E A;  4BC9 A;  4DR3 C;  1WH9 A;  2D1Q A;  1XRA A;  3VNS A;  1P4E C;  2ONF A;  3RV2 A;  1RY2 A;  2M5H A;  1PU1 A;  2VZE A;  4LF5 C;  3EQ6 A;  3PRO C;  3ETO A;  5AE2 A;  2UXC C;  5K8F A;  3R44 A;  4GS5 A;  2P2Q A;  3A26 A;  4R1L A;  2E0G A;  3DHV A;  4TPS B;  3L95 X;  3DLP X;  3GPC A;  3CW9 A;  4DG9 A;  3LGX A;  4GKK C;  5BUS A;  4ZJZ A;  4DCT A;  1ULT A;  4PHT A;  5AE3 A;  1USP A;  2ZM6 C;  3N54 B;  2KZF A;  1N34 C;  2F4V C;  1XNR C;  4YY3 C;  4DR4 C;  5K85 A;  5T8T A;  2PN2 A;  5BSW A;  3JAM D;  3LNV A;  2YWC A;  1PG4 A;  4FUT A;  4G36 A;  4ISB A;  3PES A;  3TUF A;  2OBV A;  4NXN C;  2D1S A;  5H9U A;  4JI5 C;  2WP0 C;  2CXC A;  4DV5 C;  2JMP A;  1WF3 A;  5IWA C;  2MM9 A;  1O93 A;  3A9U A;  4D4G A;  5A1G A;  4DUY C;  4PRO C;  2ASB A;  4L2Z A;  4D56 A;  4DCV A;  2E8C A;  2E7G A;  4G1I A;  3CQ3 A;  1YJ7 A;  3I07 A;  4ODJ A;  1O92 A;  4BSZ A;  4BCA A;  4IZ6 A;  4MTN A;  1PG3 A;  3A4I A;  4PZP A;  2D7V A;  2KDN A;  3GR0 A;  4WS9 A;  4JI0 C;  1FLO A;  2P02 A;  3E7X A;  1T5H X;  4DR5 C;  3AF5 A;  4DV2 C;  1MKY A;  2DHM A;  1J5E C;  4R0M A;  1N32 C;  1I94 C;  4DR7 C;  3IPL A;  5KYV A;  3UEB A;  1TH5 A;  4X66 C;  4IR7 A;  2P2M A;  3ETC A;  4JI1 C;  3TR3 A;  2D1R A;  4RLQ A;  1K0R A;  2QVY X;  1GPM A;  2QVZ X;  3R9W A;  2P2B A;  3RG2 A;  2Y4N A;  4B3T C;  4LFC C;  2D27 A;  3LUS A;  4FTF A;  2HJG A;  1LQL A;  3VNR A;  2BJO A;  1N36 C;  3N2Q A;  1XNQ C;  3L8C A;  1NYE A;  5FLX D;  4LF8 C;  1N33 C;  2MCQ A;  2P2F A;  5A1I A;  1QM4 A;  4X62 C;  3UX2 A;  2UUC C;  4DG8 A;  4LF6 C;  3C5E A;  1UKK A;  4OX9 C;  4X65 C;  3TQI A;  5BSV A;  5GTD A;  2OO4 A;  3IEV A;  1UWD A;  4OYC A;  3CQ1 A;  1MXC A;  3T1H C;  5IFI A;  5JRH A;  4JI4 C;  2D1T A;  1XMQ C;  4PUG A;  2UUA C;  4RM3 A;  4NXM C;  4RM2 A;  1XMO C;  4DV0 C;  4LFA C;  3NPD A;  1HNZ C;  2E8E A;  4D57 A;  4JYA C;  1XRB A;  1MDB A;  1PA4 A;  2NCL A;  5KEI A;  4OXI A;  4DCU A;  2Z51 A;  3TDE A;  1XRC A;  2PRO A;  4K0B A;  1P4E A;  2ZZN A;  2QW0 X;  1M6X A;  1VLA A;  4JM1 A;  4L7I A;  5BUQ A;  3UZ0 A;  2UUB C;  1MDF A;  4DR6 C;  3I08 A;  1FUG A;  4NOZ A;  2CY1 A;  2WD9 A;  4FUQ A;  5BSR A;  3IEU A;  2PT7 G;  4LE5 A;  5LCI A;  2E5L C;  4LFB C;  2OPL B;  4DV1 C;  4RVN A;  4GXQ A;  1LCI A;  3IML A;  3UOW A;  3A25 A;  1HNW C;  1XS3 A;  3DAY A;  2E8F A;  4D4I A;  2Y27 A;  1MXB A;  2VSQ A;  1HR0 C;  1V26 A;  5CZV A;  2OPL A;  4K0K C;  3AY0 A;  1VEH A;  5ADZ A;  3T1Y C;  2P2J A;  2D28 C;  2XR1 A;  2YWB A;  4RLF A;  3CQ2 A;  4DV7 C;  1ZB9 A;  2EGT A;  5DV9 A;  4B3M C;  1IBL C;  4MH4 A;  1AMU A;  1RG9 A;  2QL8 A;  5T8S A;  1ZB8 A;  5BR8 C;  2VQE C;  5AE1 A;  3NI2 A;  1M6X C;  3S82 A;  4PUH A;  4RVO A;  3GKU A;  1USP B;  4JI2 C;  3EER A;  1P7L A;  5A19 A;  2M5O A;  2V7B A;  3KXW A;  2JNV A;  4DV4 C;  1MD9 A;  1HH2 P;  5BST A;  1IBK C;  4YHH C;  1FJG C;  1HNX C;  4JV5 C;  1V25 A;  4NDN A;  4LF7 C;  3VNQ A;  1JOS A;  2QVX X;  3SO4 A;  4DR1 C;  3OTO C;  1IB8 A;  4I9F A;  2Y4O A;  3GR1 A;  3PBK A;  4LF4 C;  4I9G A;  4U5Y D;  4AQY C;  4JI7 C;  2ATW A;  2UXB C;  2UXD C;  4GXR A;  1T5D X;  1O90 A;  4B3S C;  1NY8 A;  1QWI A;  1ML8 A;  2BH1 X;  3LAX A;  3CJE A;  4BC7 A;  4RMN A;  5BUR A;  2YCB A;  2MMA B;  2P20 A;  3G7S A;  4JI8 C;  4KTV A;  5A2Q D;  3UX3 A;  4DV6 C;  4DR2 C;  4X64 C;  3AF6 A;  1V60 A;  3NYQ A;  1KKG A;  3E7W A;  2UU9 C;  4DUZ C;  2ZZM A;  5E7Q A;  2HHH C;  3J80 D;  2VQF C;  3A9V A;  4LF9 C;  3LNO A;  4ZLP A;  2AYA A;  5IT9 D;  3K6R A;  5KYT A;  2KZ0 A;  4KHP C;  3B7W A;  3R9X A;  5BSU A;  2DYJ A;  3FCC A;  4L4Q A;  3H2T A;  4DCS A;  4G37 A;  1N2F A;  1IBM C;  4DV3 C;  4EAT A;  3CW8 X;  4XX2 A;  1EGA A;  1BA3 A;  1WCJ A;  4JI6 C;  4WV3 A;  1L2F A;  4B3R C;  5LMN C;  4BBY A;  3J81 D;  2DPL A;  5BSM A;  4R1M A;  1MXA A;  5LMU C;  4HPV A;  2CU6 A;  5CZX A;  1O9T A; 
#chains in the Genus database with same CATH homology
 4KTT A;  4JI3 C;  4GKJ C;  3FCE A;  3NYR A;  4DR3 C;  4BC9 A;  1WH9 A;  2D1Q A;  1XRA A;  3VNS A;  2ONF A;  3RV2 A;  1RY2 A;  2VZE A;  4LF5 C;  3EQ6 A;  3PRO C;  3ETO A;  5AE2 A;  2UXC C;  5K8F A;  3R44 A;  4GS5 A;  2P2Q A;  4R1L A;  2E0G A;  3DHV A;  4TPS B;  3L95 X;  3DLP X;  3GPC A;  3CW9 A;  4DG9 A;  3LGX A;  4GKK C;  5BUS A;  4ZJZ A;  4DCT A;  1ULT A;  4PHT A;  5AE3 A;  1USP A;  2ZM6 C;  3N54 B;  2KZF A;  1N34 C;  2F4V C;  1XNR C;  4YY3 C;  4DR4 C;  5K85 A;  5T8T A;  2PN2 A;  5BSW A;  3JAM D;  3LNV A;  2YWC A;  1PG4 A;  4FUT A;  4G36 A;  4ISB A;  3PES A;  3TUF A;  2OBV A;  4NXN C;  2D1S A;  5H9U A;  4JI5 C;  2WP0 C;  2CXC A;  4DV5 C;  2JMP A;  1WF3 A;  5IWA C;  1O93 A;  3A9U A;  4D4G A;  5A1G A;  4DUY C;  4PRO C;  2ASB A;  4L2Z A;  4D56 A;  4DCV A;  2E8C A;  2E7G A;  4G1I A;  1YJ7 A;  3I07 A;  4ODJ A;  1O92 A;  4BSZ A;  4BCA A;  4IZ6 A;  4MTN A;  1PG3 A;  3A4I A;  4PZP A;  2D7V A;  3GR0 A;  4WS9 A;  4JI0 C;  2P02 A;  3E7X A;  1T5H X;  4DR5 C;  3AF5 A;  4DV2 C;  1MKY A;  1J5E C;  4R0M A;  1N32 C;  1I94 C;  4DR7 C;  3IPL A;  5KYV A;  4X66 C;  4IR7 A;  2P2M A;  3ETC A;  4JI1 C;  2D1R A;  4RLQ A;  1K0R A;  2QVY X;  1GPM A;  2QVZ X;  3R9W A;  2P2B A;  3RG2 A;  2Y4N A;  4B3T C;  4LFC C;  2D27 A;  3LUS A;  4FTF A;  2HJG A;  1LQL A;  3VNR A;  2BJO A;  1N36 C;  3N2Q A;  1XNQ C;  3L8C A;  1NYE A;  5FLX D;  4LF8 C;  1N33 C;  2P2F A;  5A1I A;  1QM4 A;  4X62 C;  2UUC C;  4DG8 A;  4LF6 C;  3C5E A;  1UKK A;  4OX9 C;  4X65 C;  3TQI A;  5BSV A;  5GTD A;  2OO4 A;  3IEV A;  4OYC A;  1MXC A;  3T1H C;  5IFI A;  5JRH A;  4JI4 C;  2D1T A;  1XMQ C;  2UUA C;  4RM3 A;  4NXM C;  4RM2 A;  1XMO C;  4DV0 C;  4LFA C;  3NPD A;  1HNZ C;  2E8E A;  4D57 A;  4JYA C;  1XRB A;  1MDB A;  1PA4 A;  5KEI A;  4OXI A;  4DCU A;  3TDE A;  1XRC A;  2PRO A;  4K0B A;  2QW0 X;  1VLA A;  4JM1 A;  4L7I A;  5BUQ A;  3UZ0 A;  2UUB C;  1MDF A;  4DR6 C;  3I08 A;  1FUG A;  4NOZ A;  2CY1 A;  2WD9 A;  4FUQ A;  5BSR A;  3IEU A;  2PT7 G;  4LE5 A;  2E5L C;  4LFB C;  2OPL B;  4DV1 C;  4RVN A;  4GXQ A;  1LCI A;  3IML A;  3UOW A;  1HNW C;  3DAY A;  2E8F A;  4D4I A;  2Y27 A;  1MXB A;  2VSQ A;  1HR0 C;  1V26 A;  5CZV A;  2OPL A;  4K0K C;  5ADZ A;  3T1Y C;  2P2J A;  2D28 C;  2XR1 A;  2YWB A;  4RLF A;  4DV7 C;  1ZB9 A;  2EGT A;  5DV9 A;  4B3M C;  1IBL C;  4MH4 A;  1AMU A;  1RG9 A;  2QL8 A;  5T8S A;  1ZB8 A;  5BR8 C;  2VQE C;  5AE1 A;  3NI2 A;  3S82 A;  4RVO A;  3GKU A;  1USP B;  4JI2 C;  3EER A;  1P7L A;  5A19 A;  2V7B A;  3KXW A;  4DV4 C;  1MD9 A;  1HH2 P;  5BST A;  1IBK C;  4YHH C;  1FJG C;  1HNX C;  4JV5 C;  1V25 A;  4NDN A;  4LF7 C;  3VNQ A;  1JOS A;  2QVX X;  3SO4 A;  4DR1 C;  3OTO C;  4I9F A;  2Y4O A;  3GR1 A;  3PBK A;  4LF4 C;  4I9G A;  4U5Y D;  4AQY C;  4JI7 C;  2ATW A;  2UXB C;  2UXD C;  4GXR A;  1T5D X;  1O90 A;  4B3S C;  1QWI A;  1ML8 A;  2BH1 X;  3LAX A;  3CJE A;  4BC7 A;  4RMN A;  5BUR A;  2YCB A;  2P20 A;  3G7S A;  4JI8 C;  4KTV A;  5A2Q D;  4DV6 C;  4DR2 C;  4X64 C;  3AF6 A;  3NYQ A;  1KKG A;  3E7W A;  2UU9 C;  4DUZ C;  5E7Q A;  2HHH C;  3J80 D;  2VQF C;  3A9V A;  4LF9 C;  4ZLP A;  2AYA A;  5IT9 D;  5KYT A;  4KHP C;  3B7W A;  3R9X A;  5BSU A;  2DYJ A;  3FCC A;  4L4Q A;  3H2T A;  4DCS A;  4G37 A;  1N2F A;  1IBM C;  4DV3 C;  4EAT A;  3CW8 X;  4XX2 A;  1EGA A;  1BA3 A;  4JI6 C;  4WV3 A;  1L2F A;  4B3R C;  5LMN C;  4BBY A;  3J81 D;  2DPL A;  5BSM A;  4R1M A;  1MXA A;  5LMU C;  4HPV A;  5CZX A;  1O9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...