1RG9A

S-adenosylmethionine synthetase complexed with sam and ppnp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
Knots found
sequence length
383
structure length
383
Chain Sequence
b'AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthetase
publication title Crystal structure of the S-adenosylmethionine synthetase ternary complex: a novel catalytic mechanism of s-adenosylmethionine synthesis from ATP and MET.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 122
structure length 383
sequence length 383
chains with identical sequence B, C, D
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1rg9A01
1FUGA 1O9TA 1GPMA 4LE5A 1QM4A 4L2ZA 1O90A 2DPLA 3SO4A 1MXCA 4KTTA 1MXBA 4L4QA 5H9UA 5T8SA 3UOWA 1O93A 4ODJA 1P7LA 1XRAA 1XRCA 2P02A 5T8TA 1XRBA 2OBVA 2YWBA 3TDEA 1MXAA 4HPVA 4WS9A 5A19A 3A4IA 3S82A 5A1GA 2YWCA 4KTVA 4L7IA 1RG9A 3TQIA 1O92A 4K0BA 3RV2A 5A1IA 3IMLA 4NDNA
chains in the Genus database with same CATH superfamily
2CU6A 4DR7C 4X62C 5LMNC 5KYTA 2UU9C 2D1QA 4OX9C 3A9VA 3L8CA 3IEVA 2KDNA 1XRBA 2YWBA 4RM3A 1NY8A 5BURA 4GXRA 1V26A 2D1SA 2QW0X 2YX1A 3FCEA 1MDFA 1K0RA 4DG9A 1N2FA 4D56A 4KTTA 1FJGC 1T5DX 4OXIA 3CW8X 1VLAA 4LF8C 3RG2A 3DLPX 5BSRA 1XMQC 1I94C 2E8EA 4DUZC 2OBVA 2E8FA 4PROC 4BC9A 4JI7C 4KHPC 4LFBC 3UX2A 2P2QA 3TR3A 4GS5A 3J81D 5BSMA 5ADZA 2ZZNA 4DR6C 1QM4A 4LF7C 4L2ZA 4R0MA 2P2FA 3IEUA 1MDBA 3LAXA 3PROC 1RY2A 4I9FA 3NI2A 3I08A 4JV5C 2AYAA 4DCUA 5E7QA 5BSWA 3S82A 2ASBA 3TUFA 4IR7A 3L95X 1V60A 4XX2A 3R9WA 3GPCA 5DV9A 3ETOA 3J80D 4DCSA 4NOZA 4G1IA 4LF9C 4IZ6A 2ZM6C 3EQ6A 1IB8A 4MTNA 1MD9A 3CJEA 2DHMA 1MKYA 2ONFA 3AY0A 5IFIA 3NPDA 3T1YC 1ZB9A 3DAYA 4DV4C 1RG9A 3CQ2A 2QVZX 2VQFC 3UX3A 1ML8A 1O90A 5BR8C 4JI3C 2OPLB 4ODJA 1T5HX 1HH2P 5KYVA 1YJ7A 4DV3C 5BUSA 3FCCA 5AE2A 2CY1A 2D27A 2BJOA 1NYEA 2JMPA 4DR4C 2BH1X 5K85A 4LE5A 4DV7C 2OPLA 5KEIA 4RM2A 5BSVA 5IT9D 5FLXD 4GKJC 1P7LA 4PUHA 4MH4A 5GTDA 1TH5A 1HNZC 2PN2A 3DHVA 4DG8A 2JNVA 5BSUA 2DYJA 4NDNA 3VNQA 2KZ0A 5BUQA 2QVXX 4ISBA 1UKKA 3N54B 4NXNC 1XRAA 3GR0A 1WCJA 5JRHA 4PUIA 4DV5C 3TDEA 4AQYC 2KZFA 3CQ3A 1QWIA 1PG4A 2QVYX 4RLQA 3E7XA 4YHHC 4GKKC 1LQLA 3IPLA 2VSQA 1N33C 4JI2C 1P4EC 4RVOA 3SO4A 4JYAC 4X64C 3UEBA 4DR2C 3H2TA 4JI0C 3UZ0A 1PA4A 2NCLA 3AF6A 4B3RC 4LF5C 2QL8A 2ZZMA 4GXQA 1IBLC 3T1HC 1UWDA 1ULTA 5A1IA 4D57A 1L2FA 4BBYA 3A26A 4DCTA 1MXBA 2EGTA 4DV6C 2E0GA 4EATA 2E8CA 3LNVA 2MM9A 5AE1A 1P4EA 3A25A 3TQIA 2PROA 1O92A 2Y4OA 1N34C 3VNRA 4JI8C 2UXCC 1MXCA 1HR0C 1V25A 2P2JA 4BCAA 5BSTA 3C5EA 3JAMD 4PUGA 4LFCC 4PHTA 4ZLPA 5A1GA 4OYCA 2MMAB 1N32C 4JM1A 2D7VA 5CZXA 4U5YD 4B3TC 3IMLA 3N2QA 4PZPA 1PG3A 2DPLA 3K6RA 5A2QD 5H9UA 4G37A 5CZVA 4D4GA 1IBMC 5LCIA 1FLOA 4JI4C 4D4IA 3GKUA 2E5LC 1XS3A 4RLFA 1HNXC 2UXBC 2XR1A 3B7WA 3VNSA 3A9UA 4FTFA 4K0BA 2D1TA 4JI1C 1N36C 5IWAC 1XNRC 2VQEC 1KKGA 2VZEA 3E7WA 2P02A 5T8TA 2M5HA 1WF3A 1MXAA 4ZJZA 4LFAC 3CQ1A 2MCQA 4X66C 2HJGA 2PT7G 4WV3A 2ATWA 3I07A 2Y4NA 4DV1C 3AF5A 3R44A 4FUTA 2OO4A 4RMNA 1AMUA 4DV0C 2V7BA 2F4VC 1O93A 4TPSB 1BA3A 3CW9A 3G7SA 3O2EA 1XRCA 1USPB 2UUAC 3NYQA 4BC7A 1ZB8A 3LUSA 4G36A 5K8FA 1IBKC 3PBKA 4RVNA 2Z51A 3OTOC 5LMUC 4DV2C 4DR3C 4L4QA 5T8SA 1USPA 3ETCA 4DCVA 4I9GA 2P2BA 1HNWC 4YY3C 3A4IA 4L7IA 1EGAA 2Y27A 1J5EC 3GR1A 3PESA 2M5OA 2D1RA 5AE3A 1FUGA 1M6XC 1GPMA 4R1MA 2WP0C 4NXMC 4X65C 4LF4C 2UXDC 1VEHA 4DUYC 4B3MC 4BSZA 5A19A 4WS9A 3EERA 1WH9A 2CXCA 3LGXA 2YWCA 4KTVA 4K0KC 2D28C 1XNQC 1O9TA 2WD9A 2E7GA 2UUCC 4DR5C 2UUBC 3UOWA 4B3SC 4R1LA 2P20A 2YCBA 1XHJA 3NYRA 4LF6C 1PU1A 3R9XA 3KXWA 4HPVA 4JI5C 1JOSA 1M6XA 1LCIA 2HHHC 4DR1C 1XMOC 4FUQA 3LNOA 4JI6C 3RV2A 2P2MA
chains in the Genus database with same CATH topology
4DR7C 4X62C 5LMNC 5KYTA 2UU9C 2D1QA 4OX9C 3A9VA 3L8CA 3IEVA 1XRBA 2YWBA 4RM3A 5BURA 4GXRA 1V26A 2D1SA 2QW0X 3FCEA 1MDFA 1K0RA 4DG9A 1N2FA 4D56A 4KTTA 1FJGC 1T5DX 4OXIA 3CW8X 1VLAA 4LF8C 3RG2A 3DLPX 5BSRA 1XMQC 1I94C 2E8EA 4DUZC 2OBVA 2E8FA 4PROC 4BC9A 4JI7C 4KHPC 4LFBC 2P2QA 4GS5A 3J81D 5BSMA 5ADZA 4DR6C 1QM4A 4LF7C 4L2ZA 4R0MA 2P2FA 3IEUA 1MDBA 3LAXA 3PROC 1RY2A 4I9FA 3NI2A 3I08A 4JV5C 2AYAA 4DCUA 5E7QA 5BSWA 3S82A 2ASBA 4IR7A 3TUFA 3L95X 4XX2A 3R9WA 3GPCA 5DV9A 3ETOA 3J80D 4DCSA 4NOZA 4G1IA 4LF9C 4IZ6A 2ZM6C 3EQ6A 4MTNA 1MD9A 3CJEA 1MKYA 2ONFA 5IFIA 3NPDA 3T1YC 1ZB9A 3DAYA 4DV4C 1RG9A 2QVZX 2VQFC 1ML8A 1O90A 5BR8C 4JI3C 2OPLB 4ODJA 1T5HX 1HH2P 5KYVA 1YJ7A 4DV3C 5BUSA 3FCCA 5AE2A 2CY1A 2D27A 2BJOA 1NYEA 2JMPA 4DR4C 2BH1X 5K85A 4LE5A 4DV7C 2OPLA 5KEIA 4RM2A 5BSVA 5IT9D 5FLXD 4GKJC 1P7LA 4MH4A 5GTDA 1HNZC 2PN2A 3DHVA 4DG8A 5BSUA 2DYJA 4NDNA 3VNQA 5BUQA 2QVXX 4ISBA 1UKKA 3N54B 4NXNC 1XRAA 3GR0A 5JRHA 4DV5C 3TDEA 4AQYC 2KZFA 1QWIA 1PG4A 2QVYX 4RLQA 3E7XA 4YHHC 4GKKC 1LQLA 3IPLA 2VSQA 1N33C 4JI2C 4RVOA 3SO4A 4JYAC 4X64C 4DR2C 3H2TA 4JI0C 3UZ0A 1PA4A 3AF6A 4B3RC 4LF5C 2QL8A 4GXQA 1IBLC 3T1HC 1ULTA 5A1IA 4D57A 1L2FA 4BBYA 4DCTA 1MXBA 2EGTA 4DV6C 2E0GA 4EATA 2E8CA 3LNVA 5AE1A 3TQIA 2PROA 1O92A 2Y4OA 1N34C 3VNRA 4JI8C 2UXCC 1MXCA 1HR0C 1V25A 2P2JA 4BCAA 5BSTA 3C5EA 3JAMD 4LFCC 4PHTA 4ZLPA 5A1GA 4OYCA 1N32C 4JM1A 2D7VA 5CZXA 4U5YD 4B3TC 3IMLA 3N2QA 4PZPA 1PG3A 2DPLA 5A2QD 5H9UA 4G37A 5CZVA 4D4GA 1IBMC 4JI4C 4D4IA 3GKUA 2E5LC 4RLFA 1HNXC 2UXBC 2XR1A 3B7WA 3VNSA 3A9UA 4FTFA 4K0BA 2D1TA 4JI1C 1N36C 5IWAC 1XNRC 2VQEC 1KKGA 2VZEA 3E7WA 2P02A 5T8TA 1WF3A 1MXAA 4ZJZA 4LFAC 4X66C 2HJGA 2PT7G 4WV3A 2ATWA 3I07A 2Y4NA 4DV1C 3AF5A 3R44A 4FUTA 2OO4A 4RMNA 1AMUA 4DV0C 2V7BA 2F4VC 1O93A 4TPSB 1BA3A 3CW9A 3G7SA 1XRCA 1USPB 2UUAC 3NYQA 4BC7A 1ZB8A 3LUSA 4G36A 5K8FA 1IBKC 3PBKA 4RVNA 3OTOC 5LMUC 4DV2C 4DR3C 4L4QA 5T8SA 1USPA 3ETCA 4DCVA 4I9GA 2P2BA 1HNWC 4YY3C 3A4IA 4L7IA 1EGAA 2Y27A 1J5EC 3GR1A 3PESA 2D1RA 5AE3A 1FUGA 1GPMA 4R1MA 2WP0C 4NXMC 4X65C 4LF4C 2UXDC 4DUYC 4B3MC 4BSZA 5A19A 4WS9A 3EERA 1WH9A 2CXCA 3LGXA 2YWCA 4KTVA 4K0KC 2D28C 1XNQC 1O9TA 2WD9A 2E7GA 2UUCC 4DR5C 2UUBC 3UOWA 4B3SC 4R1LA 2P20A 2YCBA 3NYRA 4LF6C 3R9XA 3KXWA 4HPVA 4JI5C 1JOSA 1LCIA 2HHHC 4DR1C 1XMOC 4FUQA 4JI6C 3RV2A 2P2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FUG A;  1O9T A;  1GPM A;  4LE5 A;  1QM4 A;  4L2Z A;  1O90 A;  2DPL A;  3SO4 A;  1MXC A;  4KTT A;  1MXB A;  4L4Q A;  5H9U A;  5T8S A;  3UOW A;  1O93 A;  4ODJ A;  1P7L A;  1XRA A;  1XRC A;  2P02 A;  5T8T A;  1XRB A;  2OBV A;  2YWB A;  3TDE A;  1MXA A;  4HPV A;  4WS9 A;  5A19 A;  3A4I A;  3S82 A;  5A1G A;  2YWC A;  4KTV A;  4L7I A;  1RG9 A;  3TQI A;  1O92 A;  4K0B A;  3RV2 A;  5A1I A;  3IML A;  4NDN A; 
#chains in the Genus database with same CATH topology
 2CU6 A;  4DR7 C;  4X62 C;  5LMN C;  5KYT A;  2UU9 C;  2D1Q A;  4OX9 C;  3A9V A;  3L8C A;  3IEV A;  2KDN A;  1XRB A;  2YWB A;  4RM3 A;  1NY8 A;  5BUR A;  4GXR A;  1V26 A;  2D1S A;  2QW0 X;  2YX1 A;  3FCE A;  1MDF A;  1K0R A;  4DG9 A;  1N2F A;  4D56 A;  4KTT A;  1FJG C;  1T5D X;  4OXI A;  3CW8 X;  1VLA A;  4LF8 C;  3RG2 A;  3DLP X;  5BSR A;  1XMQ C;  1I94 C;  2E8E A;  4DUZ C;  2OBV A;  2E8F A;  4PRO C;  4BC9 A;  4JI7 C;  4KHP C;  4LFB C;  3UX2 A;  2P2Q A;  3TR3 A;  4GS5 A;  3J81 D;  5BSM A;  5ADZ A;  2ZZN A;  4DR6 C;  1QM4 A;  4LF7 C;  4L2Z A;  4R0M A;  2P2F A;  3IEU A;  1MDB A;  3LAX A;  3PRO C;  1RY2 A;  4I9F A;  3NI2 A;  3I08 A;  4JV5 C;  2AYA A;  4DCU A;  5E7Q A;  5BSW A;  3S82 A;  2ASB A;  3TUF A;  4IR7 A;  3L95 X;  1V60 A;  4XX2 A;  3R9W A;  3GPC A;  5DV9 A;  3ETO A;  3J80 D;  4DCS A;  4NOZ A;  4G1I A;  4LF9 C;  4IZ6 A;  2ZM6 C;  3EQ6 A;  1IB8 A;  4MTN A;  1MD9 A;  3CJE A;  2DHM A;  1MKY A;  2ONF A;  3AY0 A;  5IFI A;  3NPD A;  3T1Y C;  1ZB9 A;  3DAY A;  4DV4 C;  1RG9 A;  3CQ2 A;  2QVZ X;  2VQF C;  3UX3 A;  1ML8 A;  1O90 A;  5BR8 C;  4JI3 C;  2OPL B;  4ODJ A;  1T5H X;  1HH2 P;  5KYV A;  1YJ7 A;  4DV3 C;  5BUS A;  3FCC A;  5AE2 A;  2CY1 A;  2D27 A;  2BJO A;  1NYE A;  2JMP A;  4DR4 C;  2BH1 X;  5K85 A;  4LE5 A;  4DV7 C;  2OPL A;  5KEI A;  4RM2 A;  5BSV A;  5IT9 D;  5FLX D;  4GKJ C;  1P7L A;  4PUH A;  4MH4 A;  5GTD A;  1TH5 A;  1HNZ C;  2PN2 A;  3DHV A;  4DG8 A;  2JNV A;  5BSU A;  2DYJ A;  4NDN A;  3VNQ A;  2KZ0 A;  5BUQ A;  2QVX X;  4ISB A;  1UKK A;  3N54 B;  4NXN C;  1XRA A;  3GR0 A;  1WCJ A;  5JRH A;  4PUI A;  4DV5 C;  3TDE A;  4AQY C;  2KZF A;  3CQ3 A;  1QWI A;  1PG4 A;  2QVY X;  4RLQ A;  3E7X A;  4YHH C;  4GKK C;  1LQL A;  3IPL A;  2VSQ A;  1N33 C;  4JI2 C;  1P4E C;  4RVO A;  3SO4 A;  4JYA C;  4X64 C;  3UEB A;  4DR2 C;  3H2T A;  4JI0 C;  3UZ0 A;  1PA4 A;  2NCL A;  3AF6 A;  4B3R C;  4LF5 C;  2QL8 A;  2ZZM A;  4GXQ A;  1IBL C;  3T1H C;  1UWD A;  1ULT A;  5A1I A;  4D57 A;  1L2F A;  4BBY A;  3A26 A;  4DCT A;  1MXB A;  2EGT A;  4DV6 C;  2E0G A;  4EAT A;  2E8C A;  3LNV A;  2MM9 A;  5AE1 A;  1P4E A;  3A25 A;  3TQI A;  2PRO A;  1O92 A;  2Y4O A;  1N34 C;  3VNR A;  4JI8 C;  2UXC C;  1MXC A;  1HR0 C;  1V25 A;  2P2J A;  4BCA A;  5BST A;  3C5E A;  3JAM D;  4PUG A;  4LFC C;  4PHT A;  4ZLP A;  5A1G A;  4OYC A;  2MMA B;  1N32 C;  4JM1 A;  2D7V A;  5CZX A;  4U5Y D;  4B3T C;  3IML A;  3N2Q A;  4PZP A;  1PG3 A;  2DPL A;  3K6R A;  5A2Q D;  5H9U A;  4G37 A;  5CZV A;  4D4G A;  1IBM C;  5LCI A;  1FLO A;  4JI4 C;  4D4I A;  3GKU A;  2E5L C;  1XS3 A;  4RLF A;  1HNX C;  2UXB C;  2XR1 A;  3B7W A;  3VNS A;  3A9U A;  4FTF A;  4K0B A;  2D1T A;  4JI1 C;  1N36 C;  5IWA C;  1XNR C;  2VQE C;  1KKG A;  2VZE A;  3E7W A;  2P02 A;  5T8T A;  2M5H A;  1WF3 A;  1MXA A;  4ZJZ A;  4LFA C;  3CQ1 A;  2MCQ A;  4X66 C;  2HJG A;  2PT7 G;  4WV3 A;  2ATW A;  3I07 A;  2Y4N A;  4DV1 C;  3AF5 A;  3R44 A;  4FUT A;  2OO4 A;  4RMN A;  1AMU A;  4DV0 C;  2V7B A;  2F4V C;  1O93 A;  4TPS B;  1BA3 A;  3CW9 A;  3G7S A;  3O2E A;  1XRC A;  1USP B;  2UUA C;  3NYQ A;  4BC7 A;  1ZB8 A;  3LUS A;  4G36 A;  5K8F A;  1IBK C;  3PBK A;  4RVN A;  2Z51 A;  3OTO C;  5LMU C;  4DV2 C;  4DR3 C;  4L4Q A;  5T8S A;  1USP A;  3ETC A;  4DCV A;  4I9G A;  2P2B A;  1HNW C;  4YY3 C;  3A4I A;  4L7I A;  1EGA A;  2Y27 A;  1J5E C;  3GR1 A;  3PES A;  2M5O A;  2D1R A;  5AE3 A;  1FUG A;  1M6X C;  1GPM A;  4R1M A;  2WP0 C;  4NXM C;  4X65 C;  4LF4 C;  2UXD C;  1VEH A;  4DUY C;  4B3M C;  4BSZ A;  5A19 A;  4WS9 A;  3EER A;  1WH9 A;  2CXC A;  3LGX A;  2YWC A;  4KTV A;  4K0K C;  2D28 C;  1XNQ C;  1O9T A;  2WD9 A;  2E7G A;  2UUC C;  4DR5 C;  2UUB C;  3UOW A;  4B3S C;  4R1L A;  2P20 A;  2YCB A;  1XHJ A;  3NYR A;  4LF6 C;  1PU1 A;  3R9X A;  3KXW A;  4HPV A;  4JI5 C;  1JOS A;  1M6X A;  1LCI A;  2HHH C;  4DR1 C;  1XMO C;  4FUQ A;  3LNO A;  4JI6 C;  3RV2 A;  2P2M A; 
#chains in the Genus database with same CATH homology
 4DR7 C;  4X62 C;  5LMN C;  5KYT A;  2UU9 C;  2D1Q A;  4OX9 C;  3A9V A;  3L8C A;  3IEV A;  1XRB A;  2YWB A;  4RM3 A;  5BUR A;  4GXR A;  1V26 A;  2D1S A;  2QW0 X;  3FCE A;  1MDF A;  1K0R A;  4DG9 A;  1N2F A;  4D56 A;  4KTT A;  1FJG C;  1T5D X;  4OXI A;  3CW8 X;  1VLA A;  4LF8 C;  3RG2 A;  3DLP X;  5BSR A;  1XMQ C;  1I94 C;  2E8E A;  4DUZ C;  2OBV A;  2E8F A;  4PRO C;  4BC9 A;  4JI7 C;  4KHP C;  4LFB C;  2P2Q A;  4GS5 A;  3J81 D;  5BSM A;  5ADZ A;  4DR6 C;  1QM4 A;  4LF7 C;  4L2Z A;  4R0M A;  2P2F A;  3IEU A;  1MDB A;  3LAX A;  3PRO C;  1RY2 A;  4I9F A;  3NI2 A;  3I08 A;  4JV5 C;  2AYA A;  4DCU A;  5E7Q A;  5BSW A;  3S82 A;  2ASB A;  4IR7 A;  3TUF A;  3L95 X;  4XX2 A;  3R9W A;  3GPC A;  5DV9 A;  3ETO A;  3J80 D;  4DCS A;  4NOZ A;  4G1I A;  4LF9 C;  4IZ6 A;  2ZM6 C;  3EQ6 A;  4MTN A;  1MD9 A;  3CJE A;  1MKY A;  2ONF A;  5IFI A;  3NPD A;  3T1Y C;  1ZB9 A;  3DAY A;  4DV4 C;  1RG9 A;  2QVZ X;  2VQF C;  1ML8 A;  1O90 A;  5BR8 C;  4JI3 C;  2OPL B;  4ODJ A;  1T5H X;  1HH2 P;  5KYV A;  1YJ7 A;  4DV3 C;  5BUS A;  3FCC A;  5AE2 A;  2CY1 A;  2D27 A;  2BJO A;  1NYE A;  2JMP A;  4DR4 C;  2BH1 X;  5K85 A;  4LE5 A;  4DV7 C;  2OPL A;  5KEI A;  4RM2 A;  5BSV A;  5IT9 D;  5FLX D;  4GKJ C;  1P7L A;  4MH4 A;  5GTD A;  1HNZ C;  2PN2 A;  3DHV A;  4DG8 A;  5BSU A;  2DYJ A;  4NDN A;  3VNQ A;  5BUQ A;  2QVX X;  4ISB A;  1UKK A;  3N54 B;  4NXN C;  1XRA A;  3GR0 A;  5JRH A;  4DV5 C;  3TDE A;  4AQY C;  2KZF A;  1QWI A;  1PG4 A;  2QVY X;  4RLQ A;  3E7X A;  4YHH C;  4GKK C;  1LQL A;  3IPL A;  2VSQ A;  1N33 C;  4JI2 C;  4RVO A;  3SO4 A;  4JYA C;  4X64 C;  4DR2 C;  3H2T A;  4JI0 C;  3UZ0 A;  1PA4 A;  3AF6 A;  4B3R C;  4LF5 C;  2QL8 A;  4GXQ A;  1IBL C;  3T1H C;  1ULT A;  5A1I A;  4D57 A;  1L2F A;  4BBY A;  4DCT A;  1MXB A;  2EGT A;  4DV6 C;  2E0G A;  4EAT A;  2E8C A;  3LNV A;  5AE1 A;  3TQI A;  2PRO A;  1O92 A;  2Y4O A;  1N34 C;  3VNR A;  4JI8 C;  2UXC C;  1MXC A;  1HR0 C;  1V25 A;  2P2J A;  4BCA A;  5BST A;  3C5E A;  3JAM D;  4LFC C;  4PHT A;  4ZLP A;  5A1G A;  4OYC A;  1N32 C;  4JM1 A;  2D7V A;  5CZX A;  4U5Y D;  4B3T C;  3IML A;  3N2Q A;  4PZP A;  1PG3 A;  2DPL A;  5A2Q D;  5H9U A;  4G37 A;  5CZV A;  4D4G A;  1IBM C;  4JI4 C;  4D4I A;  3GKU A;  2E5L C;  4RLF A;  1HNX C;  2UXB C;  2XR1 A;  3B7W A;  3VNS A;  3A9U A;  4FTF A;  4K0B A;  2D1T A;  4JI1 C;  1N36 C;  5IWA C;  1XNR C;  2VQE C;  1KKG A;  2VZE A;  3E7W A;  2P02 A;  5T8T A;  1WF3 A;  1MXA A;  4ZJZ A;  4LFA C;  4X66 C;  2HJG A;  2PT7 G;  4WV3 A;  2ATW A;  3I07 A;  2Y4N A;  4DV1 C;  3AF5 A;  3R44 A;  4FUT A;  2OO4 A;  4RMN A;  1AMU A;  4DV0 C;  2V7B A;  2F4V C;  1O93 A;  4TPS B;  1BA3 A;  3CW9 A;  3G7S A;  1XRC A;  1USP B;  2UUA C;  3NYQ A;  4BC7 A;  1ZB8 A;  3LUS A;  4G36 A;  5K8F A;  1IBK C;  3PBK A;  4RVN A;  3OTO C;  5LMU C;  4DV2 C;  4DR3 C;  4L4Q A;  5T8S A;  1USP A;  3ETC A;  4DCV A;  4I9G A;  2P2B A;  1HNW C;  4YY3 C;  3A4I A;  4L7I A;  1EGA A;  2Y27 A;  1J5E C;  3GR1 A;  3PES A;  2D1R A;  5AE3 A;  1FUG A;  1GPM A;  4R1M A;  2WP0 C;  4NXM C;  4X65 C;  4LF4 C;  2UXD C;  4DUY C;  4B3M C;  4BSZ A;  5A19 A;  4WS9 A;  3EER A;  1WH9 A;  2CXC A;  3LGX A;  2YWC A;  4KTV A;  4K0K C;  2D28 C;  1XNQ C;  1O9T A;  2WD9 A;  2E7G A;  2UUC C;  4DR5 C;  2UUB C;  3UOW A;  4B3S C;  4R1L A;  2P20 A;  2YCB A;  3NYR A;  4LF6 C;  3R9X A;  3KXW A;  4HPV A;  4JI5 C;  1JOS A;  1LCI A;  2HHH C;  4DR1 C;  1XMO C;  4FUQ A;  4JI6 C;  3RV2 A;  2P2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...