4PZPA

Substrate-free structure of d-alanine carrier protein ligase dlta from bacillus cereus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
501
structure length
464
Chain Sequence
b'AKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSKAFTMIDGERAYKTGDAGYVENGLLFYNGIEHHLRACSYVEGAVIVPILLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
publication title Thiolation-enhanced substrate recognition by D-alanyl carrier protein ligase DltA from Bacillus cereus.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
total genus 148
structure length 464
sequence length 501
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4pzpA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pzpA01
2P20A 3RIXA 4OXIA 4D4IA 3O82A 3NYRA 3O83A 2P2QA 3O84A 2P2MA 3E7WA 5BSWA 4GXRA 3DLPX 3B7WA 4R0MA 4RVNA 4OYCA 4GR4A 1MD9A 3VNRA 3G7SA 3IPLA 3ETCA 4GS5A 4U5YD 4WV3A 5JRHA 4RM3A 5IFIA 4IZ6A 2QVYX 2WD9A 3RG2A 3E53A 4DG9A 4LGCA 3ITEA 4FUQA 4D4GA 1ULTA 3VNSA 4W8OA 5K85A 5KEIA 2Y4OA 1AMUA 5BURA 5K8FA 4E5DA 2P2JA 3CW8X 4FUTA 4M46A 3WV4A 5BSUA 4EATA 1MDFA 3PBKA 4ZJZA 2QW0X 2V7BA 1PG4A 5BUSA 1BA3A 4PZPA 3A9UA 1MDBA 4G36A 3IERA 3EQ6A 2P2FA 3IVRA 5DV9A 2P2BA 3KXWA 3IESA 2D1QA 3CW9A 4RLQA 3DAYA 2Y27A 1PG3A 3IEPA 3TSYA 2D1RA 5BSVA 1RY2A 3NYQA 4G37A 3T5CA 3U17A 3WVNA 2Y4NA 3DHVA 4R1LA 1T5HX 1T5DX 2QVXX 3NI2A 4ISBA 5KYTA 1V25A 3VNQA 5DWVA 3E7XA 5BUQA 5E7QA 2QVZX 2D1TA 4R1MA 3R44A 3A9VA 4RVOA 2VZEA 4RMNA 3LNVA 4RM2A 5KYVA 3U16A 4D57A 4DG8A 1LCIA 3GPCA 5D6NA 3LAXA 4GXQA 3FCEA 5GTDA 2VSQA 5BSRA 3L8CA 3QYAA 3WV5A 1YJ7A 1V26A 4IR7A 4D4HA 4RLFA 4GR5A 3T5BA 4D56A 2D1SA 3LGXA 3FCCA 5BSTA 3T5AA 5BSMA 3C5EA
chains in the Genus database with same CATH superfamily
3U56A 3O9MA 1A7KA 5J2UF 1ZCJA 3BRWA 1XI2A 3BEDA 3EZGA 1SXHA 4LZNA 3P0HA 1YAHA 3AJ9A 1W5AA 2BBOA 3OO0A 3OMLA 3KWMA 5BSWA 3JATA 1HF3A 4G8JA 1E3EA 1I36A 3D02A 4LYGA 1NQTA 2V7PA 3QGMA 4Y9RA 2VRCD 3U0VA 4TKUA 5HFJA 4BVHA 4D74A 4F7WA 5ICMA 1GUZA 1KFEB 4MIYA 1WSBA 2YKGA 3JALB 3KUCA 1CZUA 3RU9A 1CP2A 2G0NA 2SKEA 1V37A 2WK1A 3PQCA 1L7BA 1S2DA 3R3JA 2HNKA 3E48A 2C4MA 4HZGA 1KBOA 3AY3A 3C39A 2A1TR 3C3CA 3ROFA 1Z45A 2WTXA 4YO8A 3ONVA 4AZ0B 2YFQA 2AKAB 1HKUA 4IUDS 4ALJA 4S04A 1SBTA 4J91A 3PD0A 4CETA 2Z2ZA 1P1CA 4Z9BA 3TL6A 3V4ZA 4BVEA 1I4OA 1LVHA 3OWXA 2V7QA 5ES3A 1RQNA 5IDQA 1IZ0A 3EQ8A 5BWBA 1SNYA 2AL7A 5L53A 1G2IA 4G2TA 2J5QA 5ECGC 4L4QA 5I8ZA 1B93A 1G18A 4MHSA 1EHIA 1H22A 1O9BA 4HFNA 1A2BA 4EYQA 1VJRA 5AKXA 1XMPA 4Y2XA 1AKVA 4F60A 4YT4A 2Q9BA 3FYDA 3CKMA 5B1EA 1N2EA 2EYQA 3HJRA 2FVYA 5LYJB 4HAVA 3FZYA 3GGDA 4QOGA 3BF7A 2OGWA 4ZMBA 4B3HA 4BO2A 4QO7A 2XVMA 2EX4A 5JCPA 2RD2A 3FMFA 3MHPA 3WBBA 3DF7A 1G9XA 2DQ4A 3IPAA 3FMVA 3CM0A 4PTZA 1A7AA 2OFWA 4MW9A 5EVJA 4GOLD 4ZOLF 4E1VA 2RE8A 2F3RA 4KREA 4UEKA 2IU3A 4P54A 2AFVA 2B8NA 3B1JA 3HR7A 4U2DA 1XS3A 3WGZA 3HLTA 2D5BA 1TO2E 4D82A 1OIXA 3E9DA 2CY1A 3KU4A 4I4TA 4MQBA 1KEEB 4TLAA 4RF4A 2K5UA 2E8CA 1U0HC 2UV8A 1HORA 2DTEA 2GR9A 4IX9A 6Q21A 3DDWA 3ORSA 1TDJA 4I1SA 2J3KA 1XEXA 4D9EA 2XOKA 1P39A 5K3AA 1HNWC 2QRQA 2WYHA 2YDYA 3JQQA 3QWIA 1CC1S 5B53A 4RQAA 3RIEA 3SHOA 2Q6IA 1VZ2A 3IXLA 3V42A 2Z3VA 2OO7A 3MGGA 2OCXA 4LV6A 2QRMA 3THYA 3ZLBA 4ILKA 1PR4A 1T5HX 3VR5D 5JV5A 1D8TA 1C9EA 1LS6A 5FL3A 3T4XA 1SFRA 4BVBA 2PNFA 3ZKWB 3CGWA 7REQA 1X13A 1N6KA 3F6SA 3RQIA 2C8LA 2UVPA 1BRMA 3U26A 1LW7A 3DNFA 3NUQA 3VVLA 2GWRA 4BRWA 1KHTA 2DR0A 3ENKA 5JS2A 3TKLA 2CMFA 3GLRA 2VCEA 3DXXA 5JAMA 1KS9A 2MYUA 1GFZA 2E18A 3K7EA 2H5IA 4KGZA 1RWXA 3FKQA 4BWGA 2P27A 4X93A 3RYHB 4IFBA 4XGIA 1ORIA 5B58T 4LGMA 2IYQA 4JGBA 5CDTA 4KR2A 5C1BA 3KKQA 2BE9A 5DULA 3AVYA 1IHUA 4DDTA 2VNHA 4LSGA 3GNQA 4R1TA 1K63A 4P3KA 9LDBA 3P27A 2R7AA 2V9CA 3HS3A 3JR7A 4GBED 2AOWA 3UM9A 1XZGA 4MLZA 3NYRA 4Q9LA 5HTOA 5CVDA 3DYBA 1QONA 4JZYA 1NMZA 2WABA 2C1EA 3HB7A 3ZQKA 1U11A 3SC3A 2AWNA 3RYIA 1NVTA 4QPCA 1AV6A 2B9VA 3OX2A 4I50B 2QSUA 4BV3A 1I5RA 1DOHA 1YQGA 3COPA 3R9IA 2AF4C 2NO9A 3RS7A 4CMHA 4RDCA 2ZUCA 1MPXA 3OU2A 1T5BA 4FHZA 3ILXA 4GLLA 2R25B 5KKAA 2HEGA 3IQIX 3KFXA 3B36A 1CG6A 1FU8A 2ERCA 2P2DA 3NP9A 1RYDA 4JY7A 4YONB 3CVUA 1KRWA 2UYQA 3D4LA 5EC8A 1JEOA 4G4SO 4J1QA 4WUVA 4BIIA 1RWPA 4ZIRB 1LSSA 2WHPA 2I3BA 2W90A 5IT9D 3Q7RA 3RS5A 3ZXXA 4DV1B 4DLYA 4AMYA 3DT6A 4HHEA 2H00A 3TQRA 5BRJA 1T34A 3ABZA 3KXIA 1EFCA 4JIGA 2O0MA 3H5WA 2JJ2A 3UJAA 5LKRA 4DSUA 1DO8A 4QREA 1TXGA 4NDAA 3C1TA 4W6QA 3VHXA 5AK0A 1IBSA 1KNXA 2NSYA 2GT1A 3AO0B 3DFFA 4RSMA 4ME6A 5L3ZA 4D4JA 3O74A 3OZUA 1HLPA 3ASYA 2ODAA 2R8XA 2AZDA 1S3SA 3LRTA 3MPUA 2I55A 4KJXA 3L2OB 5H83A 5DZSA 4S24A 3KVRA 1G5TA 3VYVA 1UEIA 4BN0A 3DDUA 4JLSA 2WFAA 2J3JA 3DT8A 3MJSA 4QUBA 4Q9HA 4CV0A 3UG6A 2XQKA 4RQBA 2IDJA 2WAYA 3FH0A 3LP5A 4JK3A 3SHWA 3W8RA 4B6QA 2KM1A 2JIOA 1UJMA 2JI9A 4JL8A 3GFQA 1BX3A 1WR8A 3AMVA 4MS3A 3EMBA 4QL3A 3UOGA 2KLHA 4KBFA 3VU8A 2JCGA 3X1ZA 4B45A 3DBIA 3MRXA 3PDUA 4WNYA 4N47A 4S1PA 3K4QA 5LA6B 1YB7A 2XAAA 4KO3S 4UNIA 2XB2A 1GRCA 4UVEA 1Q1BA 1WXQA 4P08A 2WJVA 1R18A 2FFAA 1PFYA 1Z4PX 5C4GB 2JFHA 1PS0A 4H3VA 5CX1A 3ETOA 1ZA2A 3ES9A 3G8CA 4G5OA 1UBRS 3KSMA 1L4KA 1CS0A 2Z6QA 1E1RA 3QMWA 4C30A 4ERXA 4FLFA 1O94D 1GZ7A 2BLLA 3K35A 4UC0A 5ALNA 3K70B 4HGOA 4EGAA 5C35A 2FPGB 1LF5A 1UBKS 1VCHA 3IQEA 5LLSA 2LE0A 4F3TA 4RMNA 4UTVA 2XOEA 1RM5A 4NARA 4NFYA 4NFHA 4LTDA 1KYWA 3SQOA 4EB8A 4DR5B 2Q0QA 5KOJA 3ZWNA 2IX9A 2Z9CA 1KP2A 1MNQA 3FNQA 3ILSA 5LZ9A 1IBLC 1K7CA 1R64A 2C9CA 1JFVA 3JD2A 4R8LA 4HWKA 1EUQA 2PKRA 3F96A 3UNXA 3PDHA 1LB1B 3E9RA 4K3VA 4PZDA 3SEQA 4MQMA 4IFEA 4US1R 2P20A 2KZFA 3COSA 3N2LA 2NU6B 3NKFA 4LOAA 4LF8B 3KFVA 1WE2A 3OCVA 4Q7EA 2Z3ZA 4PNZA 3UKOA 1RW4A 3WLQA 3HM9A 2PQ6A 4R2LA 1ZEJA 4CQMA 2CL6X 4O2BB 2JAHA 4B6OA 4DYVA 3D6AA 5SZJA 1Z4MA 1JYSA 2O0HA 2GZAA 2YVQA 1U1FA 4EA8A 4H1UA 2WWRA 2L18A 4ER5A 4HPWA 4XLLA 3SC2B 4FFLA 5JXIA 4B9EA 5K0TA 1J8FA 5A04A 1E5XA 5IYZF 4JP1A 2WPDA 4IIXA 1OKKD 5ADVA 2R86A 1EB9A 1IK6A 1IB0A 4QASA 2CCJA 4KHZA 1SBYA 5FNVB 1RNLA 3I9FA 1NWHA 2BRUA 4A15A 3VZQA 3E23A 1P7LA 2GESA 4WAUA 2WU0A 3PESA 1JGTA 4KCGA 2C1XA 3K5HA 4U3JA 3TLCA 1WCJA 3IP8A 2VYVA 3TLJA 2XE8A 2J7PD 3C6QA 2JLZA 1NOKA 4IHJA 1PK8A 4O0LA 3AVPA 2HHJA 2V9ZA 3L0YA 5HJ7A 3OFND 2A5FA 1KY5A 4IDAA 2QY6A 4E0BA 2W6ID 3WTBA 3MF4A 1WY5A 4GM0A 5KYUA 3UOAB 2O0LA 5LP6F 4DV5C 4LDJA 4FIDA 2UKDA 2HRZA 4HAXA 5C4IA 4YXWD 2H2AA 3ENQA 1Q1QA 2V58A 3I1FA 3JWGA 1P7VA 1QV9A 2OBXA 4HCJA 4W5JA 4N0EA 2C00A 3GJQA 3KXPA 4LYAA 2Q2OA 4LA4A 4RVCA 5BNIA 1RI3A 3A2MA 1FSZA 4KXMA 3V7WA 4BE7B 5E95A 1QO0A 4PYQA 1L7OA 1JDZA 1QU2A 3HACA 4MVJH 3ZHVA 1L2TA 1H85A 1MU0A 2DLNA 3MWLA 3G2IA 4PPFA 5LDDC 1N77A 2UAGA 3OA2A 4OFBA 5KJCA 5T8SA 4JVMA 4M6WB 1OZFA 4MS4A 3U62A 4GM1A 3A9WA 5AJWA 3EGWA 2VBFA 4RK6A 1OFUX 4K0KC 1OF1A 3CVOA 4ZQGA 5B3LA 2BEUA 3JQGA 1UR5A 4EKYA 4DDWA 4G37A 3MS4A 3ZKAA 4CM3A 5LJLA 1R27A 5IKEA 3W3ZB 4G0OA 5ITVA 3I1IA 2GJKA 3IO5A 3MAJA 1V47A 3T7CA 1EP3B 2W98A 2Z8YM 3ABIA 2P91A 4FYIA 5ITZA 2EDCA 4A1OA 1KJZA 4JEUA 4AF8A 2ZFUA 4FILA 1FP1D 1MUUA 4H1TA 5M34A 3NWOA 4A2CA 3OCUA 4ZYWA 4MKRA 4B44A 1NIJA 2FSHA 3IKMB 1GGMA 3QYJA 3X1YA 1PL0A 1FBTA 1ZVMA 2C5BA 4ODIA 4RD2A 5A5FA 3EIFA 3ESAA 2UUAC 1SC6A 1SVLA 2I7DA 4Q34A 3UZUA 1JSZA 3GQVA 2W2KA 4X97A 2W2OA 5ICCA 4D26A 4CF4A 2CMDA 1JG2A 4WOCA 2RB4A 2AOUA 3D5TA 4R01A 3NQ41 4U1RA 4X8LA 4HC4A 1R0SA 4P4NA 1SD5A 3VR4H 2VAWA 3BMOA 2I4IA 3PDJA 1KKUA 3W3AA 4HDMB 4HSEA 4RH0A 3VO1A 1IBKC 1BIFA 1X8KA 2ECQA 1JR6A 2C3YA 4P9NA 1Q0TA 2IH2A 2DLCX 2BGGA 4MHTA 1FF9A 2GBPA 2HQBA 4POAA 1L4EA 2REXB 2AW3A 1YS6A 1USIA 4BMNA 2R8RA 2G7ZA 3PL1A 1PJ2A 1T2UA 5FYDA 4FKBA 4F5DA 1AB5A 5I01A 721PA 1K06A 3VYUB 2PS9A 4IQ8A 4NG5A 1AC5A 1HFWA 2W2XA 3ORYA 2GFHA 4ZGBA 2R2GA 2UZ1B 2FPWA 1JE1A 3FFBA 3KUKA 3LQYA 4IHAA 4MV9A 4P53A 3HA5A 4BPBA 4R4JA 4QJ3A 4HF7A 1XU7A 3R6TA 4NHEA 3TPZA 3WIVA 4C0XA 3NNNA 3VPHA 2YZNA 3LFUA 5E1OA 3RAPR 1UWVA 2F3TA 3ND6A 1I7NA 3IA2A 2Q28A 2YWEA 2LZ0A 1S4MA 3D4BA 4WKBA 1UZUA 1E2IA 2H08A 3ADPA 3CXRA 4NJEB 4OJMX 3EIUA 3SZ3A 2O2ZA 1F0NA 1AN0A 4FFMA 5LMCA 1Y1KE 1W96A 2F7SA 2OC4A 3BWEA 4RYLA 4W7HA 5E2BA 4QKQA 1JJIA 4PUGA 3A6KA 2NO0A 4OKIA 1NY6A 3QTTA 4KG7A 4NC9A 1N5KA 3BB1A 2BFMA 1HLDA 5TGDA 4QDXA 2ZRPA 5KTSA 1CRQA 2W6JD 4TXLA 2QR5A 3LY5A 5CDGA 1N34B 1ODFA 1U8CB 1KY4A 4G1VA 1Z07A 2X6RA 3DBRB 2WYVA 3NETA 4YRLA 2DT8A 1QU3A 1TKRA 2PMBA 2WY2D 5CFMA 3EFBA 3PX3A 2Y1WA 2FPMA 3PU6A 1Z5WA 4KIGA 1DIOB 1KH1A 1LNSA 1VL5A 3TBFA 4EB0A 3HBFA 1LBEA 4PANA 1RC8A 3W8EA 4CMEC 2Q4DA 3N8IA 3QQ5A 2J3LA 5FA6A 1CJSA 1BDJA 4HNHA 1EM6A 2XITA 3ABQB 1SOUA 4AZVA 4CEJB 1DWUA 2EV9A 2FFBA 5JJ5A 4F5ZA 1EHCA 5JAOA 2FR1A 5E3JA 1R9JA 1T4DA 5K8CA 5IBCA 1XNHA 1EAMA 3DTNA 3VNBA 5K3OA 2I2CA 5DNUA 3HGMA 1N57A 4HY3A 4L9SA 1U94A 2V9PA 2FN8A 2R65A 3BS4A 2QTWB 5KTMA 1O96B 3CC8A 2CL7X 1X7HA 2Q8PA 4GGPA 4GMFA 3AOEC 3E4CA 3R8CA 3H5TA 2CD7A 2KLBA 3O90A 2HRBA 3OZGA 4NNPA 5EHNA 5JTUA 1RY2A 1QK4A 3AF6A 1VMIA 3AKEA 3O3OB 1DUVG 2FJPA 3BEOA 1IXSB 3F5FA 2G1PA 1QH1B 4EA6A 1CIPA 3I39X 1IZ9A 1FY2A 3S2SA 3WHLA 1C8BA 4EAQA 4ALMA 2ZSAA 3E7XA 3G49A 2YL2A 4AICA 4C1NA 4HYQA 4L9AA 5CVJA 1ZDMA 2E37A 4YRFA 3DWFA 4WZBA 1I2AA 2GCIA 2KS6A 1QZ3A 4M98A 4BTVA 4X44A 5KIAA 2ATWA 1E5TA 4DEVA 2EGHA 3CGGA 2KBFA 1E7MA 3VDQA 3U16A 1RXWA 2REQB 2W6PA 1VJ0A 4UAUA 1R0KA 1EH5A 3B2EA 3CY6A 1A8HA 3SOPA 3DXFA 2V0NA 3NUZA 4Y3UA 3ICPA 1FQJA 3STWA 3UWDA 4QTYA 2YVAA 1G6OA 2ISCA 1QRAA 1ZGCA 4L0QA 3WOHA 1GZHB 1MO4A 2ZJZA 4DIDA 3N0TA 1Z22A 4ESOA 1ZGGA 4CF7A 3QVXA 4OQXA 1PX0A 2E21A 1KF0A 1G5FA 1MVOA 1SG9A 4OBXA 1J0DA 4MIEA 4TRMA 3CNQS 4IQGA 4E70A 4EHHA 3UHFA 3TQIA 2QW1A 2ILTA 3W9SA 2PN2A 4UE3S 1WZNA 5HJEA 4L02A 1WKBA 1KIMA 3I1JA 5EPEA 3MWEA 4IGEA 3S4YA 2BJVA 5I3ZA 5CB0A 3GPDG 2BM9A 1Z38A 1CHNA 4YQEA 3UK2A 3VO8A 1H1TA 1XKTA 4EARA 5LUBA 3J7AC 3VH3A 3VXKA 4D0RA 2MR6A 5KQPA 3T4EA 2QS9A 3LF1A 4BTEA 1TKAA 1NV9A 3Q6IA 2GASA 5H0IA 1NJ1A 4EDFA 2BONA 5LQUA 1VLLA 5DP2A 5EUBA 4CFZA 2C7OA 3IYLW 5JDIA 2BBWA 4XCXA 2GN9A 3CF4G 4FDLA 4W1QA 1S01A 2HMUA 2VDQB 4ZAZA 1MF7A 1QKIA 2JIBA 2FP4A 2O2IA 5T4EA 3IQFA 2FPOA 3LK7A 5THKA 4GKBA 4H6VA 4H17A 4R83A 1W5BA 1SK8A 2I2XB 4P3PA 2OT3B 4ZT7A 3BRQA 1N2GA 3CTMA 1N4AA 2QX4A 2UZAA 3P2JA 1U3TA 4OHZA 4AIRA 4QGBA 3UYLA 2W0MA 2WR8A 2DB3A 2DPLA 4H4DA 5KPDA 4WZBE 2B8EA 3ADBA 3G9XA 2LRHA 1LX6A 4I8DA 4DANA 3IIJA 3OQMA 4N5LA 4QU9A 4XR4A 4KGVA 3WIBA 2YFHA 1ISIA 2JBAB 1T2FA 1YCHA 1Z88A 1UFQA 1KAOA 2COUA 2QTZA 3I01M 5DGCA 1OV6A 5E8RA 5H59A 4GAEA 4KWTA 3ZY6A 5C18A 4KODA 2R1UA 2ECPA 3N2IA 2YWHA 4BFWA 4R69A 4CQNA 4OL9A 4YY3B 2D5IA 4AWXA 2C94A 3FXAA 2NOAA 1L7VC 2H1OA 1YDGA 3GBPA 3K9BA 1M34A 2NT4A 1GTG1 3NEAA 1JEJA 2XVXA 3G8YA 4UPDA 5K0LA 4WGGA 4ARSA 1SCQA 4IWYA 4NZPA 1VL8A 4ENVA 1NT4A 2WFLB 2N1MA 1IUNA 3SFVA 4N41A 3T5CA 2NP7A 1QGED 5CDSA 3HXKA 3T3NA 3AHJA 1U9ZA 3GLIA 3OE4A 1NFRA 3SIWA 3B5IA 1UT6A 1G55A 2AQIA 2FQXA 2V3CC 3VNQA 1MO3A 2IF2A 4NXNB 4X90A 2F1OA 1AA9A 5TEWA 1DPFA 4QXPA 4B2IA 3QMMA 2EAUA 4MGHA 1HDEA 4TQ9A 2EP7A 2C83A 3CE9A 1M2GA 3F5DA 3IAAA 5CVEA 2FZWA 3NJRA 3AUJB 3I05A 2Y92A 3GFTA 4RWEA 4CI0B 2OHGA 1I3KA 5HPYB 1CQPA 2C96A 3B1YA 1HO3A 5CDYA 3K70D 2IYOA 1DAKA 1GGKA 1A7UA 2VSQA 2I6XA 1L5GB 1H0HA 5AIAA 2ZJ1A 3WZLA 1XV5A 3I04A 1I9GA 1WX1A 2PGIA 2VZLA 1U8FO 3AEYA 3QPCA 5GZ6A 2NU7A 2BGIA 2WU4A 1KWGA 3GGJA 1E5QA 4AZ3B 1UOPA 3HVRA 3CX3A 2IYXA 1F4LA 3MCTA 4Y2HA 2X4DA 5J2TA 1FDUA 4BVAA 1SU8A 3WKDA 4XQEA 3GEGA 1WIWA 2C0QA 2YHIB 1QX4A 1F0PA 3E7WA 2ODEA 2M98A 4U6NA 6PFKA 5DK6A 1YA4A 3WDLA 3PXXA 2C1ZA 3TZEA 2IZ1A 4RMGA 5FO0A 3TSWA 4JJGA 4OU4A 4QJIA 3KL4A 2JH9A 2QTCA 2JLCA 4R98A 3RE1A 3IMGA 3SP1A 4PYIA 2W6OA 5JLJA 2BFWA 5CEJA 1U0JA 3O6VA 1TKCA 1Z8FA 3IL2A 1QC5B 1VLJA 5J5VA 4DW8A 2VP5A 2QUAA 1XJWA 3H3FA 1TC2A 3KZXA 4I7EA 1XZIA 3ZWCA 4REMA 1D3AA 3BTSA 3QZUA 4J76A 5J58A 4B7UA 2DU8A 1R6UA 3EISA 2ZRDA 3K5IA 2WYIA 3ENZA 1PSZA 1X8LA 2BBSA 3H04A 2B25A 3AGQA 4OHWA 4G23A 1LPBB 1XDBA 3ITEA 4FUQA 1FYWA 4BMPB 4WOKA 3NALA 4HGYA 5LQCA 1PJZA 1SBCA 5EMLA 3R3WA 3GLIE 4YV7A 1OB2A 2RGCA 4C5BA 2WG0A 5L6MB 5LYJF 4BFCA 1XDSA 4XB6B 3ZW9A 4I2VA 3L49A 1GHTA 2OM2A 2KHZA 3NWEA 2BEJA 4F9FA 1JR4A 3BMNA 3Q41A 3ET5A 2O7VA 1JP7A 2WNIA 1I8TA 1T9CA 3ZV5A 1UJCA 2FJ0A 1PJQA 4W8GA 5FO1A 3T5TA 5IFKA 1XE3A 2GF9A 3AY7A 4C0JA 1PT7A 3KT0A 2BW0A 5FBLB 2J4FA 5IN5A 1N1GA 1S2OA 5TPWB 1N6RA 1N2OA 4HLNA 4PZ0A 1GQOA 5ADWA 1K5HA 1K6XA 2JARA 3P94A 3HP4A 1PZEA 1WQ4A 5K0GA 5C53B 1UC4B 4DCTA 3MWDA 1G1AA 4XYBA 1B43A 1NXOA 3V7UA 3RF7A 3UAZA 3CSSA 4KWEA 4YRRA 1BMTA 4RF2A 3UMRA 2ZI6A 3A3YA 1KMHA 3VR0A 3C5VA 4NDZA 2Y77A 1Z74A 3A6LA 5HKAA 1MOSA 8LDHA 5IARA 5EGSA 4MA4A 4DDVA 1QS0A 3BH0A 2JMPA 3K0BA 4Q5IA 3TS1A 1XHFA 5ALPA 3DHVA 2R11A 2HBYA 3WMXA 1BEEA 3VKFA 1YZKA 4ER0A 1GKYA 1C80A 3NO4A 4XGRA 1LD3A 2Y71A 4ER3A 2IU4A 1K3TA 5C7LO 2HH9A 4ZO8A 1UK8A 3RS3A 4F3RA 2A8YA 5LOVF 2RCYA 1U1IA 1WNFA 2DSNA 3OIGA 4P4GA 3FKSA 1N2FA 4QWMA 5IDVA 3C5HA 3O1LA 3LIPA 3TRIA 4B3MB 3GIWA 4Y9UA 4G0QA 4CLRA 2HKIA 2KJQA 3N2GA 3P2OA 3QE3A 3QIAA 4KE7A 4OHCA 4BP9A 5HSGA 4L6AA 4JYPA 1Q15A 4MYTA 1ISSA 2A9VA 2VS1A 3WA6A 1EEHA 3CNOA 3O3NB 4PZAA 2XHEA 4XDYA 3M6LA 1M8PA 5B1SA 4KV7A 3NIFB 3E9YA 4FOTA 1KKGA 1H2BA 5AE2A 1PE0A 2K2QB 1DEKA 1F8GA 2VNJA 2MWMA 4OI2A 5F1PA 1XMIA 3UMJA 3AI3A 1GWNA 1D5CA 1SO8A 4EBBA 3DJYA 4TMWA 1LNZA 2BRUC 3GFGA 4LMBA 4MQ5A 5C9ZA 3PWSA 4MAMA 3L4KA 2XAUA 1DC7A 3GKUA 4JI8C 1LBTA 3Q5EA 4I50F 4N7MA 1O95D 5SYAA 3FSRA 4CCWA 4TTVA 4A92A 1XYVA 4J0GA 5HMLA 4RVUA 3NPDA 3ZZMA 4IXDA 3M6VA 4OJTA 4EPWA 1O4WA 4UNSA 1IPEA 4XFDA 2F1HA 2G06A 3C3BA 3KXKA 3VPBA 2Z2JA 3G2JA 5A3JA 1C9JA 4D9BA 1AXRA 1I6MA 1Y3FE 3JX9A 4X61A 2OAQ1 4FNGA 5TR9A 4RW0A 2H06A 4EMTA 3N53A 4OAPA 4KO8A 1RM3A 2BFCA 3TSZA 1Z0UA 3EOAI 4YYEA 1XFAA 4ZRDA 1OAAA 3ML1A 5JU6A 1G3MA 3H17A 3MEQA 1Z5UA 4IXTA 2X41A 4OLHA 4ZOCA 1W6RA 3JQRA 3PPWA 2QN3A 4DM3A 1C0IA 1OLOA 2JCBA 2R2AA 3HTXA 1TM4E 2YFKA 3D7NA 4H16A 1XNJA 5FH9A 3WLNA 2PLAA 3V7NA 5HKKD 1I5EA 2HR1A 2N3ZA 1VBMA 3TCXB 4IMIB 5BW8A 2Z08A 1GCGA 1V16A 2O2SA 3D6TB 5AKGA 5A0TA 1RCUA 3IAFA 1ZMRA 5CLGA 1R3UA 2AOTA 2R8OA 4ZVNA 2GK4A 1K88A 2HCFA 1MH1A 2ZUFA 3E9CA 4PHFA 5BUCA 1BRTA 4WGFA 2ZBRA 4IH4A 3S3TA 2AZTA 4YCCA 1VA5A 2HWWA 1R6VA 4J0QA 4PGFA 2R1TA 1KWKA 1CNEA 1YS4A 2CJWA 5D3MB 4CR7A 3HLYA 2WOOA 3ZE7A 5CZXA 3F98A 1YHYA 3L06A 5E9WA 2P1RA 5LA6F 1AO3A 2AB0A 3IAS1 3ZU3A 1TO1E 2BHTA 4PHTA 5G4KB 2WJAA 5EQDA 3V55A 1YK0A 1FRNA 4OXKA 3OJXA 4CEHA 2ST1A 1RRKA 1NKVA 5CITA 1ZJ6A 4J4BA 2HL6A 3WGLA 4J7XA 4R8RA 3O8QA 1Y7IA 1J0EA 4L85A 4EJSC 2DE0X 3L0BA 4EB6A 4QELA 4YJFA 1WJGA 2PEYA 1J0XO 4QDJA 2I54A 3P97A 4YAUA 4ARZA 3KSAC 2E7ZA 2CMKA 4MK4A 4Q1BA 4NONA 4CM4A 4BMDA 3QLTA 4D92A 4P3YA 2Z1NA 5J5AA 3WBJA 4W5QA 3R09A 5J63A 3RVMA 1J2UA 3FVRA 1A0OA 3O8CA 4J1TA 2OAGA 2A9KA 2NUBA 1BN6A 1CNMA 1MA0A 2BKVA 4F2DA 2OFPA 5I47A 1M2OB 3GJ0A 2ZYRA 3AF1A 5TPZA 1OT3A 1OX4B 3RSQA 1HPLA 4LVUA 2VSXA 1J21A 3CKYA 2O7SA 4TTSA 4ZEWA 2OORC 5J1TB 4F4HA 1RPNA 1XC7A 4ZAVA 4JKIA 4XVCA 3N76A 1JDBB 1CUEA 4QO8A 5ALRA 3JYOA 5CLJA 2O8BB 1EZ4A 4QQNA 4HDSA 1XVLA 3G89A 4J2HA 1DAGA 4CQJA 4KVFA 3CZMA 4XQ0A 3PUVA 3U3OA 4MDHA 5IM5A 3FVWA 4N3AA 3UPDA 3IE0A 2YOHA 3PQ7A 4LWPA 5JADA 4BUZA 3L6BA 1U3UA 1NU6A 4O2BF 5EIBD 2O4UX 1YBMA 3AINA 4IL5A 3HHEA 2ZYSA 3RBAA 1JQKA 4B83A 1MJGA 2VNAA 4GMHA 1SUSA 3H8SA 5KNLA 3LUJA 2DHEA 1QXSA 1DMSA 3TBKA 4DTIA 2KPOA 2VF4X 4JI7C 2I1VB 3IOCA 3NU1A 3CX7A 4HH1A 2R85A 2VN8A 1QK5A 4FMDB 3WWCA 3ND7A 4ZRNA 5FNVF 2QK4A 3QV2A 3HHPA 3IUYA 1JQAA 5ULLA 1BVHA 4OLJA 1PIWA 4UBIA 5AHXA 2W6ZA 1UQRA 4WVLA 3KKOA 5KMGA 2HNBA 4OUDA 4HNGA 1Q21A 3D64A 1EWVA 4FWTA 3U48A 3FGPA 3E82A 4S1OA 5F78A 1JTVA 4ITUA 5SY4A 3JPYA 4I9FA 3CPSA 4UTPA 4IVPA 5JDCA 3QJ5A 3OHPA 1T6YA 1WDLA 4PPNA 2FP3A 3H3JA 1MC1A 1BD3A 5FHRA 2ZWVA 4PG5A 4OQLA 4G9GA 5FBQB 1QR6A 3I53A 4P4SB 1QJCA 1QKJA 3GDGA 5LNK1 5IBPA 3N9IA 2XNDD 3MERA 2ONKA 3Q10A 4I66A 4RJKA 3U4HA 1E4OA 1THTA 4OB7A 1NY8A 3H3XA 4E1BA 3GGPA 4LJ5A 3QXSA 5ITWA 1HL7A 4D25A 3RRZA 2FOIA 3EZLA 3VR6H 4P81A 4BC7A 1UDCA 4DAOA 4DA9A 4B0PA 4UHBA 4LPSA 4N5HX 2VFAA 5T6BA 5KHOC 4TWJA 4C4OA 1S7CA 3GVIA 1H94A 3KT6A 4MJLA 3GWZA 1WXEA 4Y1GA 1YBHA 2MHCA 1VLMA 4OATA 1JQ3A 4N9WA 5EJGA 2DCUA 3RVSA 3IXQA 1VIMA 1NVFA 3UIEA 4CJXA 4CTOA 1M72A 4L72A 3RABA 4BV8A 3PT5A 2GD1O 5IH3A 2ZXEA 1RADA 2VAVA 1YE5A 2QJOA 2ZVQX 1CETA 1Q7CA 3NDJA 1V35A 4KQ9A 1OREA 4QWWA 1P62B 4RNDB 2ACWA 4W5HA 5FR2A 3ROTA 2D1RA 4EABA 4DLLA 4KOAA 4JUAA 4WECA 1IQ0A 3JQ9C 1ZFNA 3GLQA 3X43A 2QROA 3QF4A 2AI1A 4HI0E 1UOOA 2ZR9A 1XZMA 5FWDA 3D1VA 1CY7A 3L0OA 3N7UA 2QA5A 2ZBQA 4LCJA 4WI1A 4MVYA 4P36A 1T0JB 3VR2D 3ZEAA 2R8EA 1VBKA 1L4NA 1HNXB 4YCLA 2VDNB 4ZVLA 2CXUA 2F1JA 4M1TA 1E9CA 3KR9A 2X1HA 5KJFA 5CTAA 3A0RB 5KTPA 3B38A 2R62A 3ONEA 3RDPA 3MB8A 1OI3A 1RJ9A 4GICA 2OUIA 4XSVA 3P0EA 4FJ1A 1YJ5A 1NFFA 1QYXA 3GPCA 4CV2A 4E3WA 2GD2A 5AK5A 4DNFA 2BFDB 2F3QA 3I0NA 1MB0A 5AM3A 3FWHA 2H1HA 3BTVA 1WW3A 2D8AA 4X63A 2XXAA 5B3JA 3LWNA 1E8DA 2CK3A 3B6MA 3GEHA 5IHXA 1IXKA 2E5WA 4KQJA 4MV0A 3DKVA 5EQJB 4DHWA 4UD6A 4QICA 3HL4A 1W29A 3QI2A 3K1AA 1Z0JA 3SJBA 3ESRA 2UU9C 1EGMB 1YONA 4XIFA 3T41A 2Y1LA 2VLBA 2VDJA 1GGJA 5JDIC 1VPLA 2FMUA 4CVNA 4QJBA 1OU4A 1SJ9A 4N6OA 2BM1A 1CFJA 3G9UA 5CIQA 4G9BA 3CUEF 1T0PA 1CBUA 1UKBA 5B7GA 1XEWX 3PGKA 4JV5C 4FEYA 2ZIXA 1C3XA 1KU6A 1F60A 4RFVA 1XF9A 3QOFA 1WF3A 2QZJA 2R4QA 4R2JA 2W6QA 3AIOA 3EPLA 1HRDA 4Q82A 5BR8C 4MVWA 1K8XB 1Y33E 4LXGA 4X7MA 3HB4X 5BVGA 5GOZA 4GE0A 4NZNA 2C2KA 2HY7A 2WD8A 1ZGJA 3M4XA 4E03A 1KVSA 1R4ZA 1FDIA 1R4AA 1JG7A 2D4HA 1ZBDA 4IVRA 4UVIA 1Y4UA 1TFRA 4HS9A 1C14A 4M1MA 3UMYA 4MTLA 5I7AA 2ZETA 4FEGA 4UTOA 3ETHA 1RAEA 3UGTA 2PKQO 5LMZA 4MAAA 1LRJA 5HTKA 4D97A 1T9DA 1Z6TA 4UAJA 3RUDA 3GL9A 4QSMA 4PLZA 5KINB 2BE7A 4ND8A 3SNHA 3TIVA 1U3GA 4WK0B 3LUFA 5F21A 2PFKA 3LDHA 3PXDA 1OAOA 1NN0A 4UD2A 4DLNA 3S2GA 3HXQA 2QQGA 3K0CA 1VPEA 2RGAA 1GOTA 4QTUB 4EKDA 3D6JA 3A3OA 2YJ4A 3F49S 4A6XA 1A96A 1RIFA 1U8TA 4IKEA 2FZCA 4MWTA 4REQA 4TMKA 2FV8A 2F64A 4MGYR 4JXZA 3DOCA 3QX9A 4D0GA 3PCXA 1M5RA 2E87A 1LPSA 3GT7A 3CN7A 1CIJA 3PHHA 2WJHA 4MPRA 1SIBE 2MSEB 4D9GA 2C5GA 2VJCA 5BW6B 1YUBA 4F7DA 5K3EA 4RESA 3BFJA 4F85A 3SHFA 2OL4A 3L8YA 4BNWA 4TTIA 2DERA 1O57A 1ULAA 2HREA 3ZGVA 1ZCBA 2NUAB 3WGKA 2JVIA 5KWIA 5HUJA 3RRYA 1XPOA 4P31A 1VSQA 2E4XA 3N74A 3R3SA 4OGFA 3DVRX 3L1IA 2I33A 5CGQB 3FDZB 2FPIB 1PEYA 3ZNOA 4P32A 1P60A 1QVWA 2VLIA 3QSYA 3WSWA 3A3KA 5FL7D 1UINA 5DT2A 2VG8A 5IH7A 4DR7B 4FMPA 1DKNA 5EWMB 1A97A 1GL6A 3K1YA 4HLDA 1DDGA 2Q5EA 3LCJA 4MVJA 5D86A 1WVGA 2P65A 3D8HA 2X58A 3AESA 1RS0A 3H5NA 4GRDA 4L8YA 4PQEA 5JWHA 1K0UA 2D54A 3T34A 5ICGA 1C5KA 2HO5A 2XJ9A 1HZZC 1Y9JA 2HT6A 3A1EA 3EWAA 4PQRA 5UKDA 2JAPA 3SE7A 5K4HA 2GAFA 4FKZA 3LX5A 4MINA 2MINB 4ZCIA 2QMOA 1IUPA 3BIOA 4QRDA 5IKXA 2E55A 3FTDA 2IOQA 1SQSA 4JBLA 4P4TA 4LQLA 4K28A 1JEYB 3MJ4A 1CB0A 2H7XA 1Z5GA 2BFBA 5CDFA 4LKOA 2YZKA 2H8GA 4Q7LA 4ZCMA 4NKRA 1UM8A 1UPCA 2MYTA 4XYEA 4YFYA 2BCGY 1VMKA 3GW8A 3JV7A 4X8MA 1HYBA 5TVKA 4NECA 1E4EB 4Y2SA 1MAWA 5F3WB 4GVPA 3AEUA 4US0R 3KSUA 4DV0B 3EPPA 2YWGA 4FP9A 1ZKMA 3IT1A 5KQGA 2EGUA 1VYVA 1UKVY 3AVUA 1ZB8A 3KPJA 4R40A 5TY0A 3PDIB 3C3AA 5KCZA 4RTOA 2F43A 1XCGB 1JEEA 1FTQA 1OD6A 2MR5A 2NT3A 3FYUC 3H5LA 4RENA 3T1VA 1ISGA 2VF2A 4EUSA 5CD1A 2C9DA 3QSGA 1OA0A 2FUNB 4J49A 4QFBA 1WHSA 5AI6A 3VR4A 1ESCA 2C5LA 3GO4A 5EXTA 5BN1A 5JHGB 1GVHA 5KVQA 4E5MA 1GNRA 1KJWA 3AEXA 4XEHA 3A58B 3H18A 4LMPA 4KTTA 2BKLA 3LW8A 1DX4A 5IKPA 2NTVA 3EC7A 3A6FA 1E2LA 4HX9A 2I34A 1A9SA 5L3QB 3KPUA 3K8YA 3V4VB 1KP9A 2GPAA 3UJPA 5GONB 1WDTA 1YVRA 3EUEA 1E3QA 5I7VA 4Q6BA 2VQEB 5FF9A 4DR3C 2CU6A 2CZCA 2P30A 3IXMA 4DIOA 5JW6A 2C99A 3AJAA 1NTOA 1F3OA 4JELA 3T99A 3LLSA 4MCAA 3VJRA 2X7XA 2IS6A 3T94A 3CNNA 1KZ4A 4MVJE 4NK5A 4AROA 4DLTA 1W8IA 1TQ4A 3BB3A 5E9QA 5AJHA 5A4MS 3EXHB 4Q3KA 2BKXA 5TQJA 3FOEC 3KB2A 4CLDA 3K5WA 4EYSA 1PL8A 1BW9A 3AXSA 3NC1C 3A3PA 3QA9A 3GK3A 3WFIA 3A6PC 3OZWA 1TOAA 4MKZA 3DZ8A 3ANMA 4BRSA 4G0VA 4M1SA 2KQUA 4YRIA 5CB4A 1FUKA 1PJ3A 2AXQA 1DXHA 2QV7A 3L5OA 2QY9A 1V9LA 4D9NA 2FR0A 1X7YB 5CDFE 3KKMA 2XYGA 1C4WA 2J30A 1A72A 3I6QA 4JI4C 4RKQA 1A4XA 1TUBA 2UDPA 4XDZA 2IV3A 3RU7A 3WNVA 4DZRA 3F6PA 4ENRA 1Q1ZA 2L0XA 5EQTA 5DTRA 4YGYA 5ELLA 2LV8A 1PV4A 1AIPA 2D0IA 2IYRA 3GRFA 3KSRA 4LDQA 4CLOA 1KY2A 4Z3DA 3RANA 3D6UA 3LUAA 4REOA 1GNLA 3RBXA 2JI7A 2QIPA 2FXIA 1GEGA 3WLRA 3KKLA 2AMFA 4G6ZA 1YR1A 2FDXA 3VJMA 4C0HA 3SSNA 5JNUA 2Q5JA 3UYKA 1QWOA 2UXDC 1EGQA 1NBHA 3H2IA 2EWWA 5GADl 3DAFA 3FROA 3PUWA 1M0SA 1LLDA 1UPBA 1U0FA 3ORRA 2OHIA 1L5NA 2H0AA 3TLGB 2JCSA 4DUGA 4ZZ3A 1GAQA 3IUMA 1HH2P 4N5IX 4JL6A 1JJAA 2TMKA 2AIRA 2GJ8A 4KQ6A 1CEQA 3VR3D 3NI2A 2V7UA 1BC5A 2O59A 1JJBA 1G0OA 4KTTE 1G2PA 5F2KA 1AF7A 4JYZA 3ZHRA 1JTEA 2CY0A 3A27A 2A1UA 1DC8A 1N5IA 2I0FA 2OWEA 1BS1A 1AKRA 1E1CB 4ZLPA 1PNOA 4RXMA 3EPKA 1KAGA 3YASA 1PO7A 2C5SA 5LU8A 3F3YA 4X9XA 2QN7A 4Z9YA 3WYBA 1IOZA 3HKEB 1QGUB 4R2KA 1UT5A 4K6GA 1PR3A 2H59A 2YR0A 5SV2A 1JA1A 4DADA 5ENZA 4Q24A 3C3YA 4GPTA 3AQ4A 1TUGA 3GJ3A 3JD3A 1MB3A 2SECE 5FBHA 5HZHA 4YUVA 4J4HA 4CN9A 2X6TA 5ALZA 4WNCA 3BORA 1ND5A 2DZDA 4LEIA 3CRZA 4ZV7A 4YV0A 4JBGA 5AVTA 3WKEA 4GECA 3VSDA 2D8MA 3K9WA 3NAZA 4DZTA 4IJQA 1PKXA 1WB9A 3OEHA 2OXCA 2YYZA 2R79A 2X42A 1J24A 1Y5LA 2VL7A 4ND5A 4XJVA 4IH1A 2YCBA 4S0ZA 3WQBA 1BS2A 3RAFC 1PWHA 3Q9LA 2J9FB 3OZVA 1V9CA 2A1TS 4L8VA 2M6LA 3OTGA 1Z68A 2OPBA 1E92A 1Y3AA 4JLOA 5FFFA 5JNTA 2HWYA 5JS7A 1QANA 3KJXA 1M1UA 3TVDA 3TUZC 3TI7A 5DASA 1E98A 3FA2A 1OW3B 3LHFA 5IJ9B 4QNNA 4EVRA 2CFIA 1NI3A 2O3QA 3JD0A 4JI3B 1FW6A 2IEIA 2X8BA 4LJ6A 4UDXX 2DBZA 1IC6A 1YQEA 3AUTA 1BKDR 5CNIA 4B33A 3I12A 4MI6A 2QVYX 1BE1A 1LJUA 2EJCA 2RJOA 3ZQUA 1E96A 5JVDF 1RFGE 2JFPA 5AKLA 4CFSA 4XD2A 1CR1A 3AVQA 5EGNA 2BFNA 4PG7A 3I6ZA 5HGJA 5JZ9A 3ZDYB 3T3HA 3LK6A 5EXSA 5HOEA 3KX2A 4N49A 4CPDA 1IY0A 1NJ5A 5DIFA 2MSNA 1PT8A 1BO6A 1GV0A 1WEHA 5EJIA 4D9KA 4GPEA 4A23A 4BPRA 2FZLA 3GLGA 4L22A 3UMVA 1NP6A 2P3QA 1S8NA 2C92A 4Q7MB 1XNQB 1FK8A 3DE3X 5T3UA 9ATCA 5L95A 4JOCA 1ZCAA 2ZB2A 5FCDA 3D3JA 4E07A 1QLHA 1DV1A 1MA3A 3AM5A 1SG6A 3I23A 1DDIA 4U7JA 3BOSA 2QENA 3GFRA 3HKBB 2Y76A 3QLJA 4JB3A 5CJ2A 2CYCA 1LK0A 3ETNA 1CCWA 1IXRC 1H6AA 1N7IA 5B12A 4E14A 2PT5A 1VSBA 1RCFA 4XFKA 4GQAA 3DL2A 2VC2B 4G24A 4BMYA 1OILA 3GWGA 1Z7GA 3MMSA 2VA8A 3VJKA 3K96A 1J8QA 1M73E 4J1TC 3MTDA 4O4LA 1UMBA 3FETA 3PA6A 1ZJZA 1LBSA 1IVNA 4QVKA 5K3DA 1U7TA 3OA0A 5AVQA 3HCCA 4IEFB 1XLUA 3GVXA 2DFPA 3PNBA 1V11A 1I7SB 1GSHA 2C9OA 2P9TA 1IB8A 1IJFA 2WE7A 3OI7A 1NW4A 2CSXA 1IJBA 1AQNA 5HBRA 2E48A 2Y4NA 3ZX5A 2YINC 5KVCA 3MT9A 1G0NA 1GKLA 4R2WA 5I4KA 3AM3A 4N1AA 4AY4A 2CNDA 3H9QA 1AKYA 3CSUA 3RAEC 3S70A 4ACAA 1VC2A 1YVPA 2JKVA 3G9QA 4II3A 5H9UA 5AVVA 2FE1A 5HCUA 2HCTA 3E5MA 3GZNB 4EMUA 1FQKA 3V2GA 1DQSA 2IGTA 1ZWKA 1XCLA 5JO9A 2J0QA 1E2NA 2CFTA 2Y8EA 4W6ZA 3PT9A 3E6AA 1E6MA 1Z6XA 3OLVA 4IOKA 4LCBA 3HR8A 5D3QA 1X7WA 3D59A 4G9EA 5EIFA 4CUJA 1FSSA 1ML4A 1ZUWA 2F1IA 1GGHA 4G0NA 5F1YA 3PSHA 1PW5A 3VJLA 2HHHB 3FI9A 3WGYA 2QU8A 3UWSA 2B4KA 2L17A 2XE6A 1SQ0A 5LP6C 2C2YA 3VGJA 4QT4A 3H8VA 4QUJA 4Q3BA 5LSAA 1TUIA 2FPKA 2UUBC 3JYNA 5K05A 4C43A 4X95A 1RTTA 4LVCA 4DLVA 4JKOA 3WOVA 2YY5A 2FZ5A 1NVEA 3HYRA 3Q8WA 3GJ5A 1NR5A 3DZBA 4ZJPA 1OBCA 4HN9A 3C70A 2YNMA 1D4FA 1DJLA 2XUHA 5LBUA 3FWZA 1JBKA 2V74B 4X24A 3K0FB 4RHFA 4YJGB 4IINA 4NJMB 3SQWA 1M0TA 13PKA 2HPHA 3IBGA 2P0YA 4P4LA 4P7JA 4AYTA 1P80A 4XWWA 1JU4A 1MD9A 5LQNA 2A0WA 1IIBA 3TTWA 1XRCA 3O91A 3B82A 3HEAA 3SBDA 5DM60 3PZBA 4YDHB 5BWLA 1F7UA 1YT5A 1L7RA 4O2AA 2GRUA 1G5PA 2A9PA 4Q3NA 3LVQE 4KVZA 5B4UA 1TTQB 1IM8A 2PYZA 4RKYA 1AS0A 3U1TA 4EHKA 3O7WA 1XEFA 2YDXA 4PZZA 5EE1A 4DGSA 4CYMA 4FCTA 2ZWIA 3WLIA 3RYCB 1YD7A 4MDEA 3U4MA 2RONA 3CV3A 3ZH9B 5FB3A 1Y82A 2PUCA 3Q12A 2VT6A 3TEMA 2XNSA 3M6UA 2ZRJA 1EFTA 3GUYA 1KVRA 2OK7A 3K9CA 3WLSA 5DYTA 1ZD2P 3JZMA 2H57A 4BAZA 3PK0A 2MCFA 4URHA 1HNZB 1U0NA 1A8IA 5CBPB 1E2DA 4WDQA 4DA0A 1KSFX 2IU0A 4LC0A 2B5WA 2VWQA 2BDTA 1MNAA 3UEBA 3M4NA 2EKZA 3HH8A 3IBSA 4RIEA 4UVHA 4G36A 1X7XB 1IFXA 1MG0A 4D45A 3AF4A 2ZG6A 5KSOA 4KC0A 3PLAE 3F74A 4DRXB 2EATA 1KYYA 3C87A 4K9SA 2O8DA 3B70A 2JKZA 2XR1A 4UEOA 3L9WA 1JG4A 5HQ3B 1E4VA 2WHRA 5E6UB 4EG0A 2XB9A 3UT5B 3UUEA 4IY1A 1NSYA 4PQFA 1ZG3A 4Q16A 3TAHA 2HXYA 1HMYA 2WKPA 3SXJA 1L4GA 1WD5A 3AR7A 1HH4A 5TQ0A 1VE5A 2P5YA 3SGLA 2H7YA 1P5RA 3B2QA 4F45A 4ZVPA 4TVKA 3VH2A 1MAUA 1G4UR 2V54A 4FHEA 3U3ZA 3U7GA 1XLVA 5B3JC 1CLEA 1T26A 1SC3A 1UH5A 2OBBA 2ZE8A 4G4GA 2HK9A 3D7MA 4Q12A 1JG6A 1YCDA 1NUQA 1HR0C 2OO4A 1VMDA 2VZ0A 1DQYA 2Y1DA 4DMLA 2ACVA 3VR5H 5B3KA 3J7TA 1DCKA 5F3DA 1UBSB 4DXAA 3SR4A 4BLOA 2QB5A 2QT9A 1V95A 2WD7B 4RTNA 2QDXA 4GI5A 3CLKA 5JS6A 1B0AA 1EA5A 5DYNA 4RCVA 1OHHD 4L16A 4PYOA 1G9SA 4N76A 2XADA 3TD2A 3ETDA 3WNBA 2VDPB 5D6NA 1KE2A 2ABWA 4HNTA 1R66A 2Y6UA 3TFWA 1QYVA 3M3PA 2E4AA 2CHFA 5LB2A 1CDDA 3K8QA 2YY6A 2FTKE 3N7TA 3KSBC 2JGAA 2X77A 3KJNA 1YWGO 1RWWA 2PSHA 5ERXA 5C32A 4LUCA 1GL3A 4RVFA 4DMKA 3B13B 2RMKA 3LQ2A 4KIFA 3WSVA 2ZE5A 1M1ZA 3PIDA 3BT7A 3EGXA 3NBKA 1YQXA 5CB6A 3V7YA 1GA6A 1P1RA 3AQIA 1MJHA 3J80A 1KDZA 5TT1A 1AHHA 4G89A 2AK2A 1YQDA 4RX1A 4ZT3A 3ICQB 4KYTA 1GTL1 3HRIA 4FMDF 1XP8A 1VMAA 2HV9A 3DPIA 3U2QA 2C20A 1FP4A 1XD2A 4IDOA 3ZBPA 3K0CC 5LXTA 2ZT8A 2O7QA 2ATVA 2PKWA 3R8FA 4YI5A 3SVTA 1G8SA 3W1VA 4TRRA 3BD7A 5B2EA 3I2IA 3H2TA 2MMGA 2PJDA 3C41J 3PXAA 4Y1RB 3M7IA 1YRQA 1CUBA 1J5PA 3OTWA 3HYSA 3DSRA 8AT1A 3VAAA 3S2FA 2LCIA 2I78A 2ZKIA 5LOVB 3A7DA 4Q4HB 5EUQB 1DEXA 1P7CA 4MCIA 4AJJA 4IIUA 5JRZA 1XAHA 2JIQA 1RT9A 1YJ8A 2DY1A 2HPAA 4TYWA 3WDSA 3UENA 2R96A 1C0LA 1PRYA 4DIUA 4X62B 1YZ3A 1RAHA 2XNHA 3F5SA 1CZKA 2ZM5A 4BP1A 2R8YA 2BZ0A 3JCZA 4JT9A 5C80A 1ZLXA 3HRKA 5E0KB 4JBHA 2FEKA 2ZATA 4KK3A 3CH5A 2EZTA 5JSUA 1IK4A 2FF5A 5C52B 5ALMA 2WV7A 1L5RA 5HCNA 1O9TA 2YWJA 3PRYA 1V2HE 2PV7A 2W48A 3EXEA 2AEMA 3TNDA 5A6SA 2ZDQA 1YZFA 1EUDA 5IJ0A 2OYCA 1WLYA 4OQMA 4KR7A 3V1LA 2EEPA 5DO9A 3DONA 4PZPA 1Q19A 1R8YA 1T6NA 1UKYA 3LIIA 4B34A 3PJRA 4DFDA 2E85A 4BP3A 1HDIA 4JROA 3GDHA 1N0IA 1VHJA 3E3MA 4K88A 2YBEA 3VBEA 3NASA 5HZMA 4NCBA 2GHQA 3QKSA 1FA9A 1HDCA 2RGEA 3W4IA 5HZKA 5G02A 2EFYA 3G02A 5JBQA 1N2CB 2PAAA 2X8WA 1NVBA 1IHXA 2RAPA 3TRKA 4UUQA 3G2LA 1PU2A 1UK9A 1D0SA 1NF9A 4MUYA 3WKAA 4O4HB 3S8EA 3HDYA 2F55A 1NG1A 5IK2D 1FUEA 1KC3A 3NPMA 3PUKA 1FFWA 2G28A 2PL3A 4X45A 5DOVA 3ZE6A 4DNPA 5HGXA 5EYPB 3TOSA 4ZO4A 4GI1A 1OFVA 4ZDJA 2D74A 2IXDA 4F8EA 4QDKA 3UWKA 4Q7KA 3X1MA 4X64B 1V2GA 1QIIA 3EAGA 3KOUA 4FKMA 5DHQA 2UU9B 3TM4A 5JMTA 1I80A 1U90A 1AN9A 2YV5A 4DV2C 1TVCA 3KO8A 3PR3A 3SZLA 3TE6A 3TL2A 2VT7A 3CEPB 3OP4A 4GZMA 1XZBA 4N6NA 1AB6A 4Y6LA 5JC1A 4O4JB 4NXMB 4MUGA 3GX1A 4L8LA 4WKOA 1I4WA 3W7AA 3WGJA 2ZIAA 2VEOA 4ZMSA 5C4MA 4QYTA 1U8EA 4P86A 5CK5A 4TV9A 1VP9A 5FTKA 5LFAA 1WG8A 2XRMA 3KD2A 1FZTA 3MOSA 1N36B 2IXBA 1LVGA 1VJGA 2ASEA 4XYMA 4BXOA 1LJ8A 1Q6ZA 1DXOA 1QAMA 2HU8A 4U7DA 3E7FA 4CV1A 1TQDA 4IYRA 4X1YB 1O5OA 1TGYA 2GS9A 1Z7BA 2LIVA 4MJ7A 2JIRA 2ZRKA 4ZEXA 2Z2XA 1H4VB 1XN1A 1E5DA 2YUTA 1TVKB 3UV7A 1JXQA 5B5SA 2HA5A 4C21A 1JMYA 1TPZA 3OE7A 5K5EA 5HKOA 1QPGA 4CF3A 4KUHA 5E4TA 1KFJB 3KEGA 3L0CA 1SPXA 4R0MA 3T7JA 1E69A 1II9A 1J49A 1VB3A 3A1DA 3Q87B 1T10A 5E6RB 1KKMA 2AW5A 1FFGA 4M0DA 3SU8A 2G09A 5T57A 3C7DB 2NSLA 4EZIA 1MN6A 1KL7A 4G0UA 2PZJA 4K81B 2PKXA 4GPBA 1LFDB 1JHZA 1K92A 1VHQA 1GZ4A 5ENVA 1KTIA 5HIIA 1TI7A 2H2GA 1CEYA 1TMKA 2PSJA 3K2EA 2WP0A 4FGKA 3RUIA 4G07A 2ZAGA 3UX2A 1V1RB 3KBOA 4R5HA 2BGLA 3RWMB 2N0SA 5DM70 1ZWLA 1CZLA 4C4SA 2J6BA 5K09A 3WLOA 4KQWA 3C8ZA 4DKJA 1TH5A 3QJGA 1THZA 1QG4A 3EBLA 3MNFA 4DCSA 1I0ZA 4RO0A 4V0KA 1PJAA 1SAYA 4JWTA 3QRWA 3ZS8A 4G8CA 4N48A 1PTKA 1U81A 3F67A 4HFJA 2NPFA 3N2YA 3R0QA 1TYAE 4YPFA 4FUTA 2A86A 1TYZA 4LRWA 5ESXA 3FSGA 1ODTC 2GM9A 1EFAA 3L3BA 4OKNA 1QZTA 1BFUA 1NYTA 2ZRMA 3EXAA 3SLRA 4PO9A 3GJXC 5FLXD 2WJ4A 1C3VA 4WBNB 1YNOA 6REQA 2P2SA 1S3FA 5AHOA 2PIDA 1W88A 2FOLA 2QRLA 1ESMA 3L0DA 4N0QA 4EG5A 4ZMRA 1EBFA 4B9AA 3OHMA 4JHXA 2PZBA 3RROA 3IAUA 2A78A 4IJKA 2XGMA 3CR8A 5HP4A 4BUCA 2MYPA 2WLTA 2Z5GA 4UW9A 2E3JA 1JL3A 1YTLA 2Q5IA 2GO1A 3VR6A 1LQUA 3D6NB 2VBGA 3GRKA 1UBOS 1TZCA 2C9BA 1CZOA 1QO7A 1W76A 1N8SA 2WOJA 4WACA 4AJ1A 1Z3CA 2FI1A 3MJCA 3UW1A 3K6SA 3UXMA 2WSYB 1BGWA 3K0KA 2A0UA 2BY4A 1JEQA 5AW1A 4JUIA 5BQPA 2R6JA 3DWEX 4Z6KA 2CLDX 2C7GA 1JS1X 3HVUA 4UEWA 1ZC4A 2VK8A 1WHTB 4BY9E 1QQ7A 4IAOA 2XF8A 1JG3A 3JQPA 4EOGA 3WAJA 1E99A 3KLPX 5ALXA 1WF6A 1AS3A 5D3ZA 5DN9A 3NORA 2HDOA 5J1SB 4U2FA 3HP7A 1QBKC 3QEAZ 3GR1A 4V0RA 4DQVA 1U4NA 1IY8A 3FB4A 3G23A 3BHJA 3FPSA 2G4LA 1WZIA 4GNKA 4QYIA 2XZTA 1HNWB 5JSFA 1WDMA 1XDUA 2BH9A 4EPRA 3S8YA 3G7UA 3UMMA 4Y2JA 5EZ5A 1E89A 3FW1A 4DSOA 3KPWA 2VI5A 1DAMA 5EXXA 1QIEA 3O1JC 4IFIA 3L9XA 4KQHA 2R1VB 1UC5B 2ETXA 4LHSA 3CQ2A 2GEFA 1B73A 2APJA 1FMTA 4LPKA 2I1QA 5LQSA 4IDDA 2QUIA 4KFUA 5E7MA 1AKMA 3DL0A 1NJ6A 4URZR 3TZHA 2A5DA 3SO4A 1ZH4A 2XMSA 3K6RA 1H8EA 1UL1X 1WXIA 1ZNZA 1NQWA 3EJWA 1YH3A 3HJHA 3HVKA 3MCVA 4G0PA 4YASA 3T52A 3WP0A 4C6SA 4YPVA 2OBNA 2REBA 1ILWA 3LLMA 2HJ9A 1U5AA 4MQLA 2OV3A 5GONF 2IA5A 4ALLA 4BBJA 4K7JA 1B7GO 3Q1LA 1I32A 1E1NA 2R00A 3SZGA 4BVGA 4DS3A 3KQKA 1CUVA 3RIHA 4FGLA 3KYDA 1UDRA 4H27A 3OG9A 4H3KB 1BCRA 1DL5A 1T6ZA 3OQPA 4ATNA 1C4OA 1I6LA 4L27A 5JBIA 4JLAA 4EZBA 1YZUA 1NLUA 4DQ0A 3A4IA 4X3CA 2VP0A 1G7SA 5AE1A 2SBTA 4XD7D 5C1PA 1EWYA 2XTNA 5J3JA 1L5OA 3B51X 4IO1A 3ZDDA 3KM0A 1F48A 1J2YA 4M1ZA 2GYVA 3PRHA 4GL4A 5EG5A 1JKFA 4EF6A 2YXLA 4RJJA 4CIAA 3O4RA 1ENYA 4MVJI 3GCGA 3AJ8A 4URXR 2PG3A 1OLSB 1VGRA 3OQVA 2X1VA 4J2TA 3AB8A 1JOSA 2BBTA 3FIUA 1AF4A 1BYIA 1T1RA 3K72B 1SKYE 3VVBA 3GPLA 4YGXB 3AP3A 3C6MA 4AJLA 2J3EA 4WNAB 4AM8A 3RRMA 4M8KA 3QXGA 3UT6A 2E2WA 1HDXA 3OMWA 4Q1CA 4FN4A 2B3TA 1CF4A 1FVHA 5DI9A 2EG9A 3OQBA 1VLZA 3EIWA 1SULA 1YFKA 1G3IA 1IN5A 1CKEA 3IOMA 4OBEA 4OOEA 4OQEA 3EHDA 4R8MA 4D79A 1RR6A 2ICAA 4PC3A 1U5BA 4KQEA 3WK6A 1V5EA 4B81A 3ZDBA 2ZUTA 5ETJA 1AGNA 1UJ2A 3P9RA 2WTMA 1ZQ9A 4X20A 5C1DA 3WQRA 3C48A 4FC6A 4EKEA 2BMFA 1PVOA 1YHNA 1P77A 1WDKA 4R9RA 4IF6A 2AG5A 2HSJA 2D2FA 2GCEA 3PR2B 1PT5A 4LF9C 2JIZA 3ZY2A 3GEDA 3EGDB 5F7XA 1E0SA 3VNUA 4PSUA 2GXQA 5FI0B 2Q29A 1B6TA 2ZQ5A 3EVAA 3F78A 3I09A 4TV8A 3QA3E 5LBIA 1WCWA 3UTCA 2UUPA 3P4UA 1WUJS 2X2PA 4CTMA 4UPEA 2Q0SA 3LX8A 4XUDA 2EARA 4DV1C 1VHTA 4RGYA 1G20A 3N3BC 2W93A 1JLLB 1RYMA 3A6GA 4I1YA 3TWOA 4UQLA 5ECYA 4L4SA 1Z63A 3W7BA 4BBAA 2OLKA 1Y6ZA 1ZM9A 4JS0A 2AN3A 1C41A 3KP1A 2F6RA 2CDRA 4DLXA 1PK7A 1GCUA 2GOYA 1E8MA 3KUUA 3QEMA 4YO7A 5HX7A 4KLCA 1XZ8A 4MQFB 2B6HA 1D2RA 4QU0A 5AOAA 1WCIB 3RYFA 1BHO1 2WYOA 3CIOA 1P2VA 2GCGA 3K09A 4I99A 3P9YA 5JQGA 1MC4A 1P0CA 3ROMA 3B3AA 3LUPA 4OOFA 4B47A 4Q7JB 4HV4A 3NOQA 4YUYA 3ZY4A 4NWIA 2XD9A 1JT9A 1SZPA 2FB9A 1FX0B 2D2VA 3EWIA 5HG0A 1DCFA 3RFCA 1JMVA 1WU7A 4AJ9A 1B8VA 3PFFA 3OEWA 3T38A 1P2UA 1L8XA 2QUJA 2GJSA 3WGUA 1GPWB 1QM5A 2OXRA 2VAMA 1IJKA 1OZGA 3V2UA 3BRSA 3GP5A 3K9HA 2JHAA 4G5RA 2VP3A 3GLHE 3IQHX 3QFSA 3RSGA 5AK3A 4MKFA 4ACBA 1DCMA 2RDMA 4B3BA 4AX4A 4Z1OA 4ZZ0A 3HDHA 5DW0A 3T3IA 4OV6B 1ECPA 1PK9A 1IBLB 3I52A 1P4RA 3MTEA 3EXG1 1MTZA 3GN1A 4G09A 4AZWA 1ZM4A 3RADC 1JB1A 5FIUA 1AQLA 4AJEA 2CXCA 5JZMA 4QZVA 1F5SA 1X7ZA 4ASUA 1LLCA 3H42B 3ZE8A 1W4LA 4NG4A 4NHOA 3SY8A 2DUUA 3GQBB 3R3VA 1Z6AA 3TLYA 2X5OA 4F3NA 2RC6A 3EG9A 4LGCA 3AZOA 2Z4SA 3DFZA 1GUBA 1N3LA 3GPIA 3RJTA 4LGVA 3SICE 4X54A 1NM5A 3U80A 4DRZA 5J4HA 2H9YA 2XDQA 1A9RA 4LHXA 5ALJA 4CEIA 1C81A 1NTRA 3LRXA 3O9VA 2XYRA 1XZCA 3AXTA 1IWPB 2FEWB 3D1LA 5BURA 3MTAA 4L5AA 4M0KA 5D00A 4B7XA 5LP1A 3IKLA 2FWAA 1FLNA 1FQOA 1A95A 1PNQA 5LN1A 1IOVA 2I3DA 2XBMA 1OIWA 1PBNA 1G20E 1BXGB 1T13A 2WTBA 4FX5A 4WZAB 1JQJC 5C8VA 3RC8A 1M2HA 1GNPA 2C29D 5ERYA 3CEJA 4KQCA 3QX8A 4NENB 4LYJA 2QNRA 3K0AA 2AFIE 1BEUB 2IOFA 3FVTA 4FCWA 4FZJA 3R0VA 4YLEA 3THRA 1P3Y1 2CYAA 2PKQP 4F4CA 4D46A 3LY9A 4HAYA 1D04A 3BDAA 1VYHA 4AP5A 1NP7A 3B1WA 3MT8A 1ZD1A 2OA0A 1XTUA 2DCMA 5BYJA 2I4OA 1NOJA 1HE2A 1N2BA 4NR0A 4WESB 1F8YA 3UFBA 4MVJG 5FWXB 3HYTA 2VH2A 4ISCA 4PLFA 1JPUA 3PWTA 3DMTC 4DV5B 4ZO9A 1TECE 2FN3A 4RKEA 4WXHA 3MJVA 4ARBA 4HL6A 2H5LA 3NXSA 1NLFA 3NIBA 1SKAA 3Q3JB 4K1XA 5GY7A 4JUDX 4AQDA 3I5UA 2CVHA 2V65A 1T5DX 2OB2A 1T36A 3BIWA 3M70A 3CB2A 4PYMA 2CSUA 5CMLA 3SZRA 4ZVVA 3LYLA 3PP8A 1EIZA 4PWYA 1XRSB 2JEZA 4MKHA 5DDIP 1Y9ZA 1TO6A 3C5WP 5HRAA 4YMIA 4J0IA 4E51A 1CZHA 1KR5A 2C4TA 2VHTA 3X1JA 1EQ2A 1LPAB 3R9KA 1QHFA 1UJ6A 2B1RA 5GVSA 2QN9A 3U44B 2KW5A 3UB2A 1SBIA 4K0KB 3NGLA 4QQKA 2HA6A 3HK2A 5KS2A 3TXXA 5FPYA 4WXPA 4Q4DA 4ZEMA 2VXBA 2F8LA 3WMRA 2FRVA 5IPFA 4B7ZA 1RLJA 1KI3A 2VP6A 3BFXA 3VMFA 3H5RA 3KAPA 5BSMA 2DUJA 2PYDA 4R1OA 4BO6A 3JAMA 2G04A 3DOHA 1KNQA 1KOJA 4BL5A 3PQEA 1JAHA 1E6EA 221PA 2P3OA 3DZKA 2JLSA 3JQ8A 1RQ7A 1ZLYA 1Y6GA 3E15A 3PRKE 1O58A 3DFKA 1KI4A 3GHHA 1A1SA 1VLQA 3M5PA 4OU5A 1Y8RB 3WLLA 3BSWA 5B3AA 2UUAB 1M6VB 3DZGA 3TTTA 2XMPA 1L5HB 4JI6C 5IRCD 1F2UB 2ACKA 2HK8A 2JFGA 5K2OA 4AKHA 5EJMA 4XX0B 3QX7A 4B79A 1UBCA 1B6SA 1SXJA 1SBNE 2QUHA 2ZP1A 3DCIA 3OLWA 3AIIA 4KAAA 4Q15A 4QG7A 4Z8YA 4IUYA 1PN3A 2ARKA 4MX8A 1JNXX 2VDRB 4AMVA 1Q3HA 3DXYA 2A9FA 4MPJA 4D3XA 1IBKB 2IQ5A 5LUAA 2IUTA 2WWVD 4CXMA 4EK9A 3PHJA 4LXTA 3AY0A 1Y7TA 1P7WA 4L95C 4RACA 4ARUA 2HBRA 2YY7A 1SVKA 5ALOA 4K9DA 1NSTA 4ROTA 2XVAA 2RJ3A 1SBQA 1GPYA 3DGEC 2ZZKA 4HYTA 2CZQA 3C7TA 4QPPA 2QZZA 2QOEA 2OSVA 2RJNA 3DE0X 5KAMA 4IIVA 3AI1A 4LDPA 4A0SA 4MW2A 1IULA 4BV9A 3FYHA 4Z1MA 2Q6OA 3V8NA 1ZX1A 2AMJA 4IRMA 1AKQA 1ZGAA 3TW4A 1T3TA 1YJCA 2NO1A 3ZJ4A 5EEGA 3TVYA 1LI5A 2VO1A 3R5SA 4UHJA 2MIIA 2WHXA 1BG6A 4MYCA 4ZU1X 1R9NA 3WG9A 4PHCA 3ZVKA 1EDZA 3CLSC 1ZIXA 3FNBA 3R6WA 4J0CA 4YJHB 4D8WA 4NBVA 2LTAA 3QU4A 3DH0A 3ZDQA 1JKIA 1NGSA 2W2LA 4RZ3A 2JI8A 4N8EA 4BHTA 4PSKA 4CKBA 5CA0B 4UCXA 4HMOA 1WMDA 4HQRA 3WNZA 1R0LA 1YOVB 2N9UA 1OI7A 1TT5A 4E31A 1QF7A 1MQ9A 4KLNA 2YMMA 2BTOA 3FHOA 1QP4A 3ENVA 4IIBA 2BKUA 5CW2A 2JGDA 3L46A 1L7EA 2Z9BA 1HT2E 1FTSA 2PBRA 1JH8A 3E5RA 3H9UA 5LB4A 4UASA 2OXTA 3M5DA 2HMSA 1YZLA 3HZHA 2QVLA 1RZUA 3IVMA 4PBSA 3RHFA 3IAEA 1Q83A 1OA1A 3EFHA 4ROSA 4WEOA 1R16A 4YECA 3RSLA 3ZWOA 4EJ0A 1RWNA 4M9XA 3DLHA 1BWRA 1Q11A 3RS8A 1WEKA 4PX2A 3S0JA 1Y8AA 1EFDN 5I4IA 2J31A 3AHFA 3I34X 5DU2A 5CDHA 1HDOA 3KVOA 4IXWA 4C78A 1BHSA 4AXXA 5H3LA 1XK6A 4NBNA 3EPJA 1WH9A 1KK3A 4IQ0A 2IOHA 1X9IA 3L01A 1YMQA 1E66A 1Z0SA 3PUHA 4RK0A 2G07A 4OFWA 3MCWA 2R60A 1X19A 2IC5A 3I2YX 3ZI7A 2X2FA 1CT9A 4B1FA 1MBZA 3TL3A 1DRVA 3FX2A 3ZGLA 4U6SA 4EY6A 2PZGA 3F90A 1OWNA 2CBGA 1E32A 4GPIB 4M9CA 5IJXA 1UBTS 3E4DA 4WLEA 3SFTA 3SJAA 1UWKA 5AM5A 4ZANA 4FSXA 3WV5A 2OPLA 2BJOA 4C2BA 1MRSA 2I87A 4FYKA 2FQQA 1JKXA 1M1NA 1SKQA 3BGSA 3FWKA 4XFJA 4DV7C 2FY8A 3NFRA 3REQA 4BO9A 3TLXA 4H3HB 1E2BA 2XNCA 3CPJB 1X77A 1YRYE 2P2GA 2P4UA 1VCIA 3UH1A 4OXIA 5A4AA 2GGSA 1LSUA 3NW9A 4D4IA 1GZDA 4Q05A 1VE9A 3AYXB 3VTFA 1IWOA 5AH0A 1GKUB 4JVNA 4N54A 1CY6A 3ROPA 5B1YA 4PLTA 9ABPA 3T4UA 2GEJA 2NV0A 3N8DA 3SPXA 4W5RA 1I4TD 4GOND 2XQGA 3HVHA 4TKUB 6ABPA 3R9XA 4G25A 5BQ5A 3ZGNA 1D0IA 1Q2XA 2RGDA 3OF3A 1F20A 1J06A 3L7MA 1GJRA 5TQ2A 4F6CA 3EEOA 3KVVA 2Q6TA 3HKCA 1XTRA 2QP3A 4D5EA 4WY8A 2GZ3A 4EMBA 2A7XA 4HX2A 5DYIA 1W7AA 5J43A 4FOSA 1OZHA 5MFZA 4UHHA 2EX1A 2V6MA 4GT1A 3W9YA 2BEWA 2ZUWA 1Z3IX 2GHTA 4AJHA 2E8FA 2GUGA 2W2QA 3E53A 2OZEA 3IIIA 3IPCA 3MTQA 4A8TA 4BQSA 4D2IA 1OC4A 5FWYA 3CTPA 4O1HA 5HW0A 5ICSA 3GROA 2BR5A 4WN3A 2HUPA 3EWSA 1HGXA 4C3ZA 1GAXA 1X92A 4AO6A 2FG6C 4H1VA 4AF6A 2VNSA 2RKBA 5JYDA 3NVDA 3DE4X 4OBWA 2DFDA 3SZOA 3JRNA 2PV0A 5A3VA 1F2TA 1JHMA 3AF0A 3DVAB 3PUXA 1PQWA 1C50A 3R74A 1JE0A 2BF4A 1BD4A 2ZRGA 3A3NA 4AWAA 2H1FA 3LFHA 3P9CA 2O50A 5C7IO 1GLNA 3ZW8A 1KQPA 1YBFA 2VPIA 1GPBA 3E0XA 4FYVA 2RFLA 4NZ9A 1YCGA 2P4EA 1RQPA 1II8A 3VDRA 2CLKB 3D6HA 1X94A 4F0JA 4ZI7F 4CTKA 2CJFA 4MR7A 2G88A 3DAHA 1ZBQA 1V8PA 2GZDA 1Z83A 2Y2VA 3HBNA 3K94A 3UGKA 1CDEA 3X1KA 5KYXB 1CJUC 4DOMA 1BYUA 4O4HF 4YRMA 5FLKA 3N8NA 1X38A 4IV8A 1Z47A 4L4YA 4QFDA 4I4TB 4RY0A 3QIVA 4XLTA 1M2VA 1XN4A 1Y5RA 2HWKA 4OH7A 3RUEA 4B32A 4TYPA 4QLBA 2ZAMA 1P0IA 3GJ8A 1BDBA 1XEXB 3FYSA 1O6ZA 4H60A 4J07A 4Q47A 5J4YA 1GV1A 1V8BA 3QW4B 5TC4A 3CO0S 2H5EA 3L82B 4PQYA 1CUFA 2ZE7A 4UM8B 4GU5A 5G3ZA 5SICE 3THYB 2O0JA 2Z5FA 1R5OA 2HU5A 1B14A 2AX3A 4BJ1A 1SGWA 4GI7A 1PBTA 2GAJA 1NF8A 2P2LA 2HZ7A 1COZA 5DSZA 4L8GA 3DLCA 2ZYTX 3RSZA 4O4JF 5CT6A 2FEAA 4X8HA 4BGUA 7REQB 3DBOB 3U7QB 1YIDA 2UVPB 1U0RA 1CTQA 1RI1A 4OAQA 4CMKA 1SU4A 3CZ9A 5FORA 5KTRA 3R1IA 1EGAA 1UAGA 2QVBA 3NBQA 5G0WA 2J0UB 4MLDA 2IHJA 2Q45A 3M6WA 4M1YA 1A4RA 1U2SA 3GMDA 1XIVA 5T8KC 3TTUA 3VR5A 5AKHA 3T5BA 2R00C 3C85A 5CJPA 2GZRA 2QX7A 1WUKS 2BEKA 2OFOA 2ZBVA 2G9ZA 5REQB 2AEFA 1FRVA 4IDBA 1YGPA 5THQA 3VDXA 3FNRA 4MB6A 3E3LA 1IDN1 2XEXA 3N70A 1DRKA 1HY3A 4MW5A 1NV8A 4FT4A 1RQLA 4TS3A 4UJ3A 2P9HA 1KXJA 3OU6A 1Y5NA 1N2XA 4QDTA 5IMSA 4BVKA 1AOXA 3ITDA 3ERCA 1PJ8A 1KVQA 3A4NA 3LT4A 3OY2A 4RK1A 4ANFA 3AIMA 4KXLA 4W9RA 1N7HA 2PMFA 1ML3A 1EZ1A 4IIJA 2COEA 3INRA 4Y9DA 3BGDA 1DFHA 4KX5A 2Z98A 4L5BA 1M1YA 2X1LA 3OM8A 1Q7EA 1CYEA 1T8UA 4FTWA 4EUNA 1RE1A 2BHRA 3GBVA 2C03A 3DZDA 1CP3A 3CUWA 4MW0A 1NXVA 1OPXA 2A9JA 2WAOA 1M6XA 1I2DA 2ZCUA 2CNOA 3B6IA 3GLVA 3QU2A 3NBUA 4IZ6A 5HWSA 4BMSA 2PWBA 2EF0A 5LQMA 2Z2KA 3O2JA 2FFJA 2QLLA 4IGIA 4EHNA 1GQ2A 3WTCA 2WHPB 1XB2A 2YIVX 2B98A 1RE0A 4OXNA 2EU8A 3PNSA 2WM3A 5JEDA 5GINE 4P98A 1U7UA 5YASA 4BN5A 3MT7A 3Q40A 1KI9A 2PJRA 2X9QA 4YALA 1KAHA 1NPTO 5TT0A 3LOQA 1T8RA 4HEA1 5KSYA 2AYZA 3BZBA 1S89A 2ZJ6A 1UBLS 3L43A 3DLIA 3NB0A 2HSEA 4FYMA 1G6KA 1DKPA 1TJ4A 1VKOA 3D3NA 4WBNF 4FTFA 1DKLA 3INYA 5DXFA 5FOVA 3RSHA 4KHPC 2ZJ7A 3FI0A 4H6WA 3CVJA 2J08A 4LXYA 3W2GA 1MW8X 2FK7A 2Q2WA 2QD5A 1KZHA 3GFPA 3F9RA 4GMGA 2SKCA 3GB9A 3T3EA 4BKQA 2Y0PA 2PJUA 5WRFA 1NBOA 3OZXA 3D4IA 4PV7A 3W5UA 2XZOA 4RE5A 4ZOEA 5TARA 4Q6WA 1AGRA 4EG1A 4PX3A 4F38A 4TRNA 4L78A 5LC1A 3W06A 4GLJA 4LK3A 1ZINA 2OD2A 1OSNA 3KJIA 1U7ZA 1KIAA 4D02A 1JLRA 2FMKA 2PRYA 3DO5A 2NV6A 3E8SA 4MS3B 2HO4A 2AC2A 3H2BA 2BTEA 1XDZA 3ED5A 2ZRLA 3FLMA 4QXQA 1OXTA 4TSFD 1E2JA 1PR5A 3H2KA 3W9BA 4PUHA 4L5JA 3TEFA 1NN3A 2W2TA 5EIHA 1BOFA 2GZ2A 1SZJG 3DMYA 1P4EA 3OJEA 4TT3D 4WN9A 1TJNA 3K09C 3VKWA 3O8LA 2BL4A 3CYFA 1ZM2A 4DN6A 3G68A 1Q6YA 1ATZA 2OR3A 4HAIA 1FC0A 5LZ2A 2OWDA 2QM0A 1L1RA 5BUQA 1CS0B 2BHLA 2VWGA 1N6OA 1OYWA 1ST2A 1CJTC 1P2BA 2PEZA 4Y7DA 5DGIA 4CMCA 3C7CB 1IEWA 1EI9A 1RD4A 4JJ8A 1WTCA 1B16A 1I3CA 1NRXA 3KJGA 4P7GA 1Q12A 3N87A 2IPOA 2RH4A 3QQPA 4ZQEA 3AF2A 3H87A 3OTQA 1POXA 4LDRA 3IIEA 4AUNA 5ITSA 2C84A 1XXHA 1IM5A 1VTKA 3KYIB 5A2QD 2RBEA 1E62A 3B1XA 2WF5A 3SDSA 4B3XA 3IILA 3DBLB 3RHZA 2J67A 1T4CB 4YUZA 1MOZA 3AB7A 4BO5A 2ZZNA 3HBJA 1B6GA 1M83A 3D7KA 1O94A 1DBPA 4N7BA 3WGOA 2P4QA 3GLFE 3B12A 4PXYA 1X15A 1I1HA 1Y6RA 4C4AA 1PJSA 3AW8A 3O73A 4TKLA 1J39A 1XVVA 4DA4A 2CV2A 2IY7A 1GN9A 2CHVA 5HKBA 1Q0SA 4FE4A 4IOJA 3WE7A 4YYZA 1B0ZA 2ZUUA 3G0CA 3MCZA 3PQ6A 1XTPA 2P2MA 2GWHA 1NM5C 2ES4A 3TD9A 3TCNA 3ACDA 4FJ0A 1ADBA 5DNWA 4R8SA 5T41A 4DRYA 4ZHQF 4WL0A 5FPTA 4LRUA 4MJXA 1Z0ZA 3P9IA 1KYTA 2YN2A 4Y1FA 3G7SA 4Q9KA 1MHPA 3DOUA 4DA6A 4II2A 3G3EA 5JPDA 3AW9A 1GIAA 1UADA 5KOHB 4JLNA 4HEA6 3G6WA 4KGXA 2D0OB 3HEBA 1J7KA 4RELA 5EESA 1KPIA 3TECE 2PGLA 2Q62A 3BGVA 3ABRB 4GOJA 3NTXA 4L50A 1JHOA 3P19A 4PCAA 4QUHA 3IQZA 1IXYA 3FDIA 4JI8B 5BR1A 4U3JB 2BP7A 1L5SA 2Q2NA 3HKDB 3VUEA 2BV3A 4R81A 1Y4SA 4AULA 4CKEB 1JILA 4K5QA 4UMFA 3QFRA 4LYFA 4F2GA 3I3SR 3PWKA 4MRMB 4IHJB 3PTAA 3DOOA 2ZPAA 3DA8A 2ZR8A 4RDIA 1NN5A 1QGYA 1ZCZA 4RQUA 1OKKA 2LUOA 3KAQA 5CT5A 1V5IA 3TF5A 2PD4A 3KE9A 4YP1A 4HNVA 1JJ7A 4PC6A 4CBVA 1NPDA 1U7DA 3HDJA 4U00A 2FWMX 4HXYA 3KXDA 5JCZA 3JASA 2HXSA 3HUDA 4F84A 4LOJA 2HOQA 2HU7A 3L79A 2XB8A 3FZQA 3R4CA 4PGGA 3ZX4A 1ZNWA 2FRXA 2BLNA 1DGQA 5DNEA 4BVLA 2BHNA 4F4DA 3SAJA 4E22A 2I2FA 5TMPA 2XE7A 1XXHE 2I4LA 5B6PA 1PZFA 4Y9SA 1XTVA 1E6LA 1ONPA 3H97A 3NV7A 1EK1A 1ZAYA 1TU0A 5KHLB 1XTTA 1YB5A 2W6IA 3IDFA 3P1JA 4B6SA 3NGXA 1M66A 2CL5A 3O75A 4YUAA 4CCSA 3ZD6A 3WYNA 1Q16A 1BDHA 3ZGZA 1NHWA 1DU4A 5FPKA 2Q3LA 4HGQA 1FFAA 4KDFA 1ZJWA 1G2OA 1LZLA 1PYOA 4JR1A 2I7TA 3EQZA 4JFAA 2BEUB 2H9IA 1A9OA 2NV2B 3OZRA 1OT5A 3VC2A 4B8ZA 2E0IA 4HQKA 3MTJA 1SZCA 1XZQA 1BE0A 1XMJA 3ETJA 1O08A 5H4GA 2J48A 4QUKA 4EY7A 4RTSA 4GX1A 1I4EB 3ESYA 5IW8A 1XA3A 4K05A 4BP8A 3VC7A 3Q0IA 1CXZA 4I4NA 3KS9A 3WRXA 3ZWPA 3LQ1A 1HEYA 4I19A 4E30A 4CF5A 3ECCA 1UODA 3BE4A 2NUTA 1V4VA 4MRNA 1RPTA 3SM3A 3LSYA 1EFLA 3GVPA 3RRFA 1JQEA 1QH8A 2F9LA 3L6DA 1LI4A 2QD1A 4MQ6A 4EG8A 4C6TA 4IG9A 2O1SA 1W36C 2R6CA 2D1FA 1K8QA 2CE2X 1I24A 1SEVA 1DKRA 1SXJC 1CQIA 1JQDA 2AOUB 4KNWA 2F4VC 2D59A 2HIAA 2X14A 5JNLA 2GAIA 3GG9A 5K3FA 1RMYA 4E2FA 3IEVA 4EJSB 2IYEA 1UFOA 4E2ZA 4M0LA 1YGYA 4PHGA 4DDMA 3LPCA 2ZDGA 4MA0A 2XMQA 1ENPA 1U1GA 1JHQA 3NTVA 5BQFA 4BWFB 5FUQA 4JJ4A 4C07A 4CG2A 1QIHA 3KNZA 1U7OA 1DT5A 4BO8A 1BMFA 1U7WA 4V1CB 3MBKA 3TM5A 1TEXA 1QUFA 3G2PA 4RSHA 1QYRA 1YJXA 1VB5A 4CMBA 3IV7A 5H02A 4H0NA 3KCNA 4UTZA 2W83A 2WWFA 1JR2A 4ZARA 1RC1A 5A1TA 2OQIA 3BPSA 1P7YA 3PA8A 2YJTD 5A7GA 3FOFC 1NJGA 2H4XA 4F2HA 2QXTA 4ECAA 2NO4A 3BM5A 3C8DA 2O5EA 1J8VA 3FRHA 2HLHA 3UJBA 2CVZA 4ZKDA 3HB0A 1P9LA 5L7TA 1CY2A 2PL9A 1H2WA 4PYJA 2HPZA 5G1PA 1RG9A 3MTGA 4OHXA 3KB6A 3K8ZA 4KPFC 1A77A 1JPVA 2ZSBA 1JDNA 3OX3A 4LOHA 5C8ZA 1M2JA 3QFCA 4CU5A 3J81A 1KDVA 4R2HA 5KWJA 2WDZA 5DBIA 4JI7B 2F59A 2V7QD 3IPRA 2EJUA 4QC2A 3UXEA 4Q4JA 5JO0A 1Z4LA 1E0DA 2XYQA 2VBCA 3LCVB 3EF0A 4Z2AA 2WYUA 1JDBC 1QCZA 3IIMA 1TX4B 5FBZA 3P4XA 1UJ4A 5AXCA 4J0FA 3EUAA 4K9LA 1NBWB 4AZ0A 2GBIA 5ARCA 4C4RA 4R6XA 4EVQA 1EE1A 1UFKA 4HS4A 3ASZA 4J3FA 2HDNB 3QVJA 4U7WA 3AL0C