4PZPA

Substrate-free structure of d-alanine carrier protein ligase dlta from bacillus cereus
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
501
structure length
464
Chain Sequence
AKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSKAFTMIDGERAYKTGDAGYVENGLLFYNGIEHHLRACSYVEGAVIVPILLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Thiolation-enhanced substrate recognition by D-alanyl carrier protein ligase DltA from Bacillus cereus.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
total genus 148
structure length 464
sequence length 501
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2014-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4pzpA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4pzpA01
5DV9A 4RVNA 1BA3A 1MDFA 2D1TA 3ETCA 1AMUA 2P2MA 2QVZX 3IEPA 4D4IA 2Y4OA 3VNQA 2P2FA 3NYQA 4E5DA 3LGXA 3WVNA 3R44A 4U5YD 3O82A 3VNSA 5BUSA 1T5DX 3IPLA 5GTDA 3NI2A 5BSWA 4M46A 3U17A 3WV4A 4DG8A 3KXWA 4G37A 5D6NA 3T5CA 3G7SA 4D57A 2P2QA 2Y4NA 4D4GA 4R1MA 1T5HX 3ITEA 2QW0X 4RLFA 5E7QA 4G36A 3DLPX 2V7BA 3B7WA 4ISBA 1RY2A 3CW8X 5BSVA 4GR5A 3L8CA 5K85A 1MDBA 5BSUA 5BURA 5BSMA 3QYAA 3E7WA 1PG4A 5BSRA 4ZJZA 4RLQA 5KEIA 4PZPA 4FUQA 4RM3A 2D1SA 2QVXX 2Y27A 2P20A 1V25A 4LGCA 3IERA 3IVRA 3LNVA 3NYRA 3EQ6A 3O83A 3E53A 3LAXA 4D4HA 1YJ7A 4D56A 1V26A 4IZ6A 2P2JA 3DHVA 4W8OA 2P2BA 2D1QA 3C5EA 3WV5A 4OXIA 3FCCA 4OYCA 5DWVA 3RIXA 4RVOA 1MD9A 2WD9A 4R1LA 4RM2A 3CW9A 5K8FA 5BUQA 4GS5A 3E7XA 4GR4A 5IFIA 3RG2A 3T5BA 4EATA 2D1RA 2VZEA 4FUTA 4RMNA 5KYVA 3FCEA 5BSTA 4R0MA 3O84A 2VSQA 1PG3A 3GPCA 3VNRA 4DG9A 3U16A 5JRHA 4GXQA 5KYTA 3IESA 3A9UA 2QVYX 4WV3A 3TSYA 3T5AA 3A9VA 4IR7A 1LCIA 1ULTA 3PBKA 3DAYA 4GXRA
chains in the Genus database with same CATH superfamily
3QVWA 3AEXA 4B3BA 3LMKA 3ETDA 3DVAA 3G0OA 4J16C 5CVDA 4BZXA 5D84A 5EE9A 3ZX5A 4O2BF 3BGOS 4E07A 2J3JA 1NTOA 5DGTA 4AMVA 2P2FA 2ZETA 5DIFA 2FG7C 3VUFA 1IBKC 1WY7A 1N0UA 3IQEA 2AEJA 2FQXA 4UE6A 3D8SA 5F98A 3FLEA 3QLVA 2VQEB 2FJPA 1QOQB 4GE0A 5G4KA 1B3RA 1OZHA 1WDKA 2VXBA 5CT4A 1J42A 3CZMA 2R751 3DNMA 3FLBA 3O9VA 4MR7B 2BLLA 1Z2EA 3MLAA 4ARAA 2XSZD 2YMQA 2Q0SA 3BE6A 3DXFA 3FFTA 3IBFA 3NAQA 1T91A 3UJ8A 5K5EA 2AOTB 4DV0C 5E6UB 4YCJA 2WAYA 1R9JA 1WNFA 2QLBA 3LUGA 1ZOSA 4JVOA 5E7MA 5EWJB 1YU9A 1NQAO 3CZAA 3BMNB 4MW9A 1KYXA 1LTHR 4UCQA 3SMQA 3IEKA 1QDEA 5L3ZA 4LIPD 2IV3A 1BXKA 3RARA 4GPBA 5BPHA 2G1AA 2J0UA 1AKQA 1JZQA 3I9LA 3QFFA 5SV2A 5AW4A 1PN3A 1HDOA 3G82C 4RX1A 1FUEA 1XRLA 2ZUVA 3AF3A 2FDRA 4QSHA 4B85A 2ECKA 4ETMA 1OB2A 4LISA 4L6IA 2EZ8A 1DRVA 2Q99A 3FDZB 5A9SA 4EEZA 5AHWA 1QQBA 1M5RA 2RAUA 3GRYA 2DKFA 1JLSA 2JJQA 2NO9A 3KQSA 4LHYA 4GDMA 4F3CA 1YJAA 1E64A 2E4VA 3L4EA 4JUCA 4KQHA 4C6HA 3AF4A 4MQEB 5E38A 1T6NA 3OFNA 4IEFB 2NUAB 1GNSA 4EFLA 1CETA 5B1DA 4UVIA 4NXNB 4E4TA 3O3CA 1P5FA 2A3NA 1YAHA 3I3OA 4DR5C 1NXXA 2O8VA 2NP7A 1NVFA 3EXHB 5ECWA 1C7JA 3FR7A 1RYBA 1W25A 2QP3A 2DR3A 3ETHA 3EGVA 4M1YA 3K4QA 4O0LA 4O1MA 1RAGA 3JVVA 4N8EA 4UDOA 2BGGA 4IH1A 1Y8QB 2PS3A 4IZHA 5AI9A 3S4YA 1PFKA 1JW9B 3TQOA 2MINB 4BYMA 3TS1A 4NE2A 4NESA 3WKDA 1IZ7A 3EAFA 4XGQA 1Z2OX 2PZ8A 2WSIA 3RS8A 1B8NA 5G0VA 3WYCA 2HO5A 2HMUA 4OBWA 4MS3B 2PK3A 3ZLTA 1UIRA 4ZQFA 3E9NA 1VG1A 3VPSA 2BCJQ 1E9FA 2JLBA 1GFIA 1MP0A 2IEBA 1UZLA 2J1LA 3IP5A 4MVCA 3TUFA 1Y3CE 1YQEA 2CXHA 2PXAA 1SK8A 2Y2VA 2J3HA 2WILA 3L9WA 3OQVA 3P9ZA 3CRQA 1SEVA 4REQB 4HMOA 3WGKA 1FDOA 1PIWA 3A4TA 3EVGA 3IAM6 4EFMA 2BGUA 5JAUA 4XYBA 4H1HA 3SIRA 3OO0A 3I76A 3QIVA 1TT7A 2XUPA 4I6GA 3W0LB 2FRDC 3FB4A 2IHYA 5MGNA 2BR4A 1M2FA 2C5HA 1Y8CA 2QQEA 3IESA 3LUHA 4IW3B 4UXJA 4ZI5A 3G88A 5EWJA 1L5ZA 4R3WA 4N65A 4CKBB 5IG2A 2VRCA 1XCMA 3WGUA 1MO6A 2XRFA 1TUBB 3UXYA 4HZIA 5AO9A 1MC8A 5JS2A 5KYYA 1P3DA 2OB2A 3IPAA 4TV9F 4TLMB 4R51A 1PU1A 1E1CA 2ID8A 3FMVA 3I01M 4M9XA 1UEJA 4EQ6B 4HAIA 1ONOA 2AS0A 3O74A 1Y1LA 2PMFA 4TKUB 2PZEA 1P91A 1UDRA 3GLUA 3AF6A 2D2VA 2O6LA 1NF2A 2EIXA 3DCYA 5EQJB 5LMZA 2GXQA 4IJQA 1PUIA 4PSVA 1KEVA 3I9FA 3WK5A 1C4OA 4HS4A 1QOPB 1JG6A 3R4VA 4KW7A 4U39A 1E5LA 4X6XA 4JM1A 4JH0A 3D3WB 2NCLA 3DBRA 3TLGA 3U4CA 4LMPA 1YRAA 5LOVF 2D27A 2WDPA 5JIBA 4E33A 3P2EA 4FFLA 2DTDA 3RTAA 4LBWA 4AMYA 2YKGA 3L84A 1CRWG 5C81A 2FPUA 5PNTA 2RC5A 3CF0A 3HADA 3RI3A 4CG2A 1L5WA 2DUNA 4MKRA 4DNFA 1EK5A 1AMOA 2PGIA 1EEHA 3T3IA 5K8UA 1EZ4A 1GAQA 4NABA 4TWZA 2BC9A 2FF5A 1YZUA 4RZSA 2WIFA 4FP9A 3WAJA 3GPLA 2JRLA 4I4CA 4DJFC 4Y3UA 3KEMA 4MS3A 3TJMA 1BQ3A 4V0MA 3VU9A 1BZYA 3D4NA 1QTNA 4K9QA 4HQFA 4BOYA 4EA7A 3L41A 3QHPA 4JJZA 1FFYA 2C7PA 3FAKA 2QT0A 3JQFA 2BWJA 4ND4A 5FOTA 1HPLA 2N42A 3BWMA 2HMVA 3C3XA 1RYEA 2DFLA 4HEHA 1A9ZA 4N41A 3O03A 2KE5A 3IT3A 1CY4A 4IS2A 4MEAA 4RETA 2GXAA 3SQXA 2R00C 3ZDBA 2KM1A 4I9GA 2CL0X 2PLAA 3IIKA 4LHEA 4C4XA 3SO4A 3AP3A 2H6EA 4B44A 5CB6A 5I01A 3O6VA 3KOXA 4AS3A 2JNWA 3AETA 3PGLA 1FMCA 4D4JA 4EHIA 4AO6A 1I0ZA 1M76A 4UMDA 2HYIC 2X7JA 3KOOA 2IH2A 2XA2A 1I6MA 3OIYA 5I7OA 2CVOA 5TR9A 1GLGA 2ZK7A 4GPTA 4Q39A 3NW9A 2YV3A 3GRKA 4RVCA 4TLAA 1L5GB 3RM3A 5A6SB 4H1WA 1DO2A 1FP4A 1NUQA 2UUAC 1MTZA 1RWBA 2P90A 3CW2A 1Y89A 4DRXB 2J0QA 4BWGA 1NVUQ 3UNXA 4FILA 4B3TB 3UUEA 2WF6A 5I9IA 1FFDA 2O59A 1WIWA 1SUDA 2VNHA 5B6JA 3LL4A 1J39A 4IDFA 2WRZA 1ANKA 2LP4Y 2IU6A 1VLVA 3G5AA 2ZRFA 1FBTA 3NU1A 2WWGA 3K6JA 2BTOA 4ZQBA 4DDMA 1DFIA 2DCUA 1D04A 1SUCA 2JF0A 2XITA 4CEIA 1DAGA 2O1XA 4LYDA 3TGPA 3WKBA 2G77B 4NZYA 4G0VA 1A2QA 1YXMA 3HEMA 4IIJA 4B0PA 1AQLA 4GD3Q 4ZK6A 5CFRA 4G8CA 5IP5A 2FWBA 2C7VA 4FYPA 3LA6A 4Q7EA 2PU5A 2UU9B 1PA4A 5CXQA 3PZBA 3JQBA 5JPDA 1N2BA 3ASUA 4MRMA 1YVEI 3U7RA 4KUEA 1WVMA 4RBNA 3STVA 1T2VA 2GB4A 2WAAA 4CMIB 3F3KA 1WOMA 3UWOA 2WMNB 1TM3E 4QTTB 3AHGA 2FKNA 2C7OA 4BBZA 2OCLA 2LR0A 4HNAB 4B34A 4XI9A 2OV1A 5F2OA 5FBQB 2J7PA 1YCGA 3HSSA 3DAYA 2XUAA 4PO3X 4WINA 2XHZA 3C15C 1RMTA 1E5DA 4WTOA 6CHYA 5DYTA 4INZA 2IXTA 1BO6A 1ZW1A 2ROQA 1X0VA 1RCUA 2HDOA 4IXDA 2FMFA 3L6EA 3UEBA 1IVYA 1G3IA 1TDJA 3K0HA 3GLFE 2WSBA 5DN6A 2WUVA 3M3DA 2I7TA 2HRBA 1G63A 4M76B 3OCCA 5AVQA 4I1IA 1CLEA 5TNXA 2PTHA 4TXHA 4PYMA 1PFYA 3VMFA 3ZLVA 3Q0TA 2OKGA 1TYZA 4Z1MA 5J4KA 5KTOA 2W2MA 3GGJA 1W8IA 4K2HA 3FYHA 4EWLA 5M3BA 3MGCA 1CW2B 3CQ3A 3VGPA 3T5DA 5EQDA 3B2QA 2DQYA 1MX5A 1WPQA 2GHQA 4HN2A 1R16A 1WW8A 3FTQA 3MQ4A 4BU1A 3IURA 2UYCA 1ZM7A 1F7VA 3JAMA 3PSHA 1G5TA 1SRRA 3BEOA 3HB0A 4IIVA 1P9WA 4MJLA 1DTSA 5GJBA 2X13A 3NRBA 1JR4A 1GG9A 2VF2A 4GG1A 3WISA 2EQAA 3PEVA 5JNTA 3GCGA 1RBQA 2JI4A 3OLXA 5FUWA 1JVSA 3K09C 5EJGA 1PEYA 1XD2B 2FE1A 4JROA 4K86A 3ESQA 2OOKA 3D5EA 4XVRA 5KQGA 3K7EA 3DL7A 3OZWA 2FXVA 3S7ZA 1TF2A 3PC7A 2O2DA 4RFSB 2EDCA 4DC0A 4KBFA 5DLQC 4ZO7A 3F6SA 3MUNA 2EFGA 1YRLA 2OXIA 1HG1A 1QZZA 2VAMA 4I0WB 1MOZA 2F1RA 3KVNA 4DLBA 2F3QA 1UZUA 3K2QA 1XEXB 4PYIA 1U2QA 5AM0A 1P73A 3L4BA 1NIJA 1DIBA 4AKSA 2A67A 2PM8A 1RI4A 1SC3A 2NT3A 5CFPA 3RJZA 1RKXA 1Y1RA 3I8XA 3JYLA 2RH8A 1L3CA 3E18A 4HN4B 1OKKA 2C4KA 4LI3X 1Z37A 3HVIA 4JLUA 1P0CA 2AJ8A 2FN9A 2Q29A 4Z49A 1O1YA 3UBTA 2J9FA 2IZOA 1YE5A 2BI7A 3PXGA 3HVJA 1B3BA 5DOZA 3VJKA 4JGBA 2G88A 5JV5A 2QUAA 1NKSA 4EJ0A 2WU3A 3G7UA 3AO0B 4YYEA 5LXTA 3ZWDA 1M1NB 3LY7A 4YIHA 4OQFA 1BFDA 1TJYA 1X1BA 1X74A 1KMIY 3VR5A 2VBCA 1DRUA 1UC5B 2BOVA 5CA0A 2I29A 3OTQA 2A0XA 3AETB 3IKLA 3KHKA 1H65A 1QIDA 1JXMA 3HKCB 3SS7X 1OQAA 2H63A 1FTSA 2W5UA 3NV9A 3RBZA 1DG1G 3FSGD 3U80A 4JLVA 1P4JA 4HYYA 1GITA 2FEXA 1GDHA 2PGJA 3C1AA 4EPYA 4OH1A 3VYSB 2CMHA 2R87A 5A1JA 4C3ZA 4PS1A 2QG9A 1JYFA 1UBGA 1Z5ZA 3D2CA 4JXKA 1EX6A 2PX2A 3DEIA 3I34X 1V11B 3IQZA 3R9XB 4OJQA 1IM5A 1CHDA 1QO0D 4DAOA 5CBKA 4IINA 4EB0A 2Q3FA 3GNTA 5D6OA 4D98A 4EYKA 1CUVA 3BIOA 3LWDA 2PKXA 2IYAA 4YRLA 4C7JA 4AF6A 4NI5A 3JQRA 1NL3A 5KTMA 2NXCA 3VA7A 4KQWA 1SBQA 2ZJYA 1IJEA 1Y81A 1H6DA 3RK4A 5BQXA 5JVDF 5MN4A 2MJLA 4DSOA 4NHEA 5K8VA 3UWSA 4OYYA 1B8OA 3UVEA 2H0QA 4X1YB 4ER7A 3G0GA 2J9YB 3BTVA 1P9NA 3CPJB 1SWVA 3AKDA 1XLTA 2Q41A 2WWTA 4L6CA 1UF9A 2WM9B 5LZ5A 5JFTA 2ZUWA 5EXPA 4D9NA 3CRMA 1LPAB 4ENUA 3U60B 1A5AB 2BBWA 2IZ0A 1JAXA 4UU1A 1RLIA 3ZKWA 1QHYA 3ZEAA 5J2UF 3S6JA 1IWPB 4LZPA 2IWRA 1RNLA 3JR7A 4F4FA 5BUSA 1U9IA 1YUMA 2GERA 3QMWA 3SJBA 4Q00A 3W79A 1CDDA 4WXMA 2WSMA 2XYQA 5L45A 1DDIA 4KXYA 1ZK2A 1KZYC 5K4AA 2FQYA 3DKRA 2OD2A 1XD8A 2GILA 4PQGA 2JFVA 3UF0A 1MXFA 4N5HX 1UEIA 3EAQA 1DBSA 1PL8A 1NQ5A 1NXSA 1U0NA 2QZJA 3DP7A 4OUKX 4R2IA 4IUDS 4TLLB 3V4VB 4B46A 4BEBA 5FX2A 5JMTA 3TOZA 2NU7B 4WPGA 3P9YA 2ZRIA 1VE9A 1P5JA 1VG0B 3VC7A 4CKYA 2DX7A 1JDBC 4EGSA 1J70A 4J7AA 5AKEA 4ZT6A 4IQ0A 4XX0B 4RH3A 3GLSA 5U9CA 3NATA 2IOFK 1JHQA 1ML3A 4M0PA 4WL0A 1D03A 1VE7A 3OP1A 5IAKA 2HPZA 5EWLA 4MJ7A 2V7EA 2E5LC 5FDFA 4FFNA 3CNOA 1CY2A 2ZSAA 3RAEC 3K70B 4EPVA 3EPLA 2YN2A 3HKEA 1DQRA 4AS2A 2V59A 1ZFNA 4NDNE 1E2GA 1V25A 1YVUA 2GZRA 2HZ7A 2OGTA 3BQNB 3HNRA 1K5DA 3IAM1 3RJ5A 4WCFC 3CVYA 1ESDA 3KELA 3NYRA 3NTRA 2IFTA 3GV0A 3OEHA 4AIIA 2D4HA 1DGQA 3H1FA 5JY1A 3LUKA 4DUGA 3UH1A 5T8SA 2DSTA 2VH1A 4ZZIA 5IAAA 5JJ5A 3OCJA 3R41A 4PCVA 3SHOA 4REOA 1V39A 2YN4A 2FMHA 4QUBA 1Q50A 4K9PA 4Q3AA 2XUIA 4CDMA 3MILA 3W4IA 3LE8A 4HNUA 2G5GX 2OEPA 4INPA 1G0NA 2QDXA 1KI7A 4GOND 1NKTA 1GZVA 4LHXA 4MXDA 2RKBA 1EGMB 3RUPA 4FYHA 2HT1A 5FTJA 3D54D 1X7GA 2ORYA 2NOAA 5CA0B 2A84A 2UVPB 4BLOA 4DNPA 3EDRA 1JKFA 2BMEA 2DY0A 2P4QA 1EM8A 4U9IS 4E2ZA 1YR1A 3Q8LA 3LQFA 1GUBA 4C7OA 3U3XA 3MD9A 5BW8A 4LWZA 2F1IA 2MSNA 5J5VA 2BH1X 3T7IA 3UGKA 4DUYB 1DLIA 3TINA 3VO2A 3KFVA 2IUFA 5IJ9B 3NEPX 4P4GA 2Q5JA 5IHPA 4V0OA 1W4ZA 1EP9A 3B3JA 3G5LA 2J9FB 4TYMA 4WK0B 4WK2B 4Z0PA 3QTBA 4JJ7A 4NV3A 3AXTA 5JR3A 3LBHA 3ZHTA 2DH5A 3RANA 2OORC 2ZM6C 4DNOA 1D2RA 1EFTA 2JGKA 4O0MA 1KQNA 4HBGA 5AP9A 3FHTA 3NHPA 3BXOA 4PX3A 1Z36A 4D9HA 2I7VA 4B81A 1ISPA 1KR5A 3TLXA 5D5HA 2G9UA 2AW5A 2HHLA 1JJVA 3IP3A 1E3TA 1NAIA 3EZ9A 5FUBA 4CQMB 5A2GA 2FUCA 4L5BA 2JIZD 4MR8B 3ZPXA 4IDHA 3IFSA 5TQJA 5DHPA 3QITA 1LY1A 4KTTE 1USPA 5EKDA 4LFAC 4XM2A 3KQOA 1VXRA 1W87A 4LYHA 2PU7A 1FP6A 3N3BC 3CXUA 2BGTA 1UCFA 2P69A 4WIAA 3B6MA 1N4DA 2QR5A 4CL0A 1NT4A 2GK7A 4NYMQ 3RYTC 4DMFA 2Z56A 4UUPA 1PJAA 5JCXA 4ID9A 3CLRC 4LCEA 1S9HA 1A9RA 1LI5A 4MJXA 4GM0A 1UJ4A 3P2JA 4OPMA 1FVOA 5F5NA 4EZBA 5CYGA 3DDUA 2ZWOA 4DR3C 1N8SA 3K0CA 4KSCA 5HE9A 1HWYA 3G1TA 4M1MA 4HYQA 4NV1A 3LDAA 4HH0A 4J3FA 4NHOA 4RV4A 4CEJA 3DCIA 3GK3A 1I3KA 4GC9A 4UE2A 2A8YA 2VTKA 3CZRA 3NOQA 4N7BA 1AQJA 4OHBA 1JIUA 4TTAA 1PZHA 1G4HA 3AQ4A 3B48A 2QMQA 3I4FA 1PK7A 3I1YA 2F4VC 3QPBA 1P44A 2UYHA 2WNIA 3I2FA 3IAAA 3WSVA 1P6UA 3L93A 5IBPA 1MT3A 3VKWA 3WWYA 4V1CI 2W4IA 3EYWA 1QH8B 1K0UA 3A4VA 3WK4A 5MGBA 5K0TA 2P5YA 3GRRA 2FK7A 4G2TA 3JZAA 5IT4A 2OVBA 4BECA 4GYKA 1F8YA 4B4VA 2ZJ4A 4G9GA 2NVUA 3R0QA 1K92A 1PEKE 1TB4A 3REQB 1G60A 4E6EA 3N74A 3O0TA 1EBFA 2QMEA 4MAAA 4D8TA 4JI2C 3RC1A 1XZNA 3RUDA 3EF1A 4P5EA 4A10A 1ZMOA 6ABPA 1AU9A 4Z0TA 5GIOE 3D4OA 4R31A 3A1UA 3AJAA 4IDBA 2CBGA 1OYWA 3RG8A 3TW6A 4DSAA 4CEHB 3DEZA 1XK6A 1XNJA 5JDIA 5DN6D 2Y27A 4F4UA 3COJA 3DOJA 2P27A 3IBCA 1Z0JA 3HFRA 1NFQA 3O8QA 2XHEA 3PXCX 1E8MA 4NS4A 4C5AA 4PPNA 3EVAA 5JCZA 4KFUA 1CRLA 4BQEA 1XLUA 3B2NA 2AZXA 3DUFA 1DWUA 4ZGWA 3U4QB 3MHPA 1MNQA 3QI2A 1DXHA 3IAFA 4WLEA 4F1KA 5L6MB 3X1YA 3VPDA 3EYAA 4HATA 2HQOA 3CNNA 3VOTA 2OBMA 3L8GA 3USZA 2RE8A 3ORRA 3KUKA 5DW3A 5J59A 4IIFA 4MROA 3WJ7A 1R8SA 5C1BA 1NIPA 3DMYA 2LIPA 1TVEA 2WIKA 5A03A 1MJFA 1R4AA 2AFRA 5CCXA 1DKLA 3COZA 1Z5PA 2NPOA 3HN7A 5I3CA 3KL2A 3K6SB 1MJ5A 2B3DA 4L72A 4U3JA 1XKQA 3RG2A 4UTPA 3OFKA 1YDEA 3HDYA 4KO4S 5FHRA 4TMFA 1SVOA 2X9GA 2ZBFA 3VVCA 3OJCA 1J5XA 1AD2A 1NR5A 3ZK7A 4GRAA 2YQ4A 1DWOA 1WSBA 4KMMA 3A3OA 3D6FA 3IP7A 4OGWA 1D6SA 3ZWYA 3AVQA 1XZFA 2UVPA 1IZ8A 1X7HA 2GGSA 1XUOA 2W2QA 4G6ZA 2WJPA 2Y1EA 4ZEWA 1VIAA 3TZLA 4RJTA 1X3LA 3FOZA 3OMXA 1Z5WA 1K7CA 2X8AA 2W22A 5DBEX 2RSLA 3ZX4A 3OEEA 3MUOA 4I66A 2ZM6B 4IRXA 3LLVA 4Z4FA 1B43A 4WS9A 3TSAA 2Q2NA 1GN8A 4O4IB 5CTAA 2AZTA 2H5EA 2KI5A 1PJ4A 3BB1A 4QNMA 4GX1A 4Y6OA 1RPZA 3GDHA 3FUXA 4MAFA 5FO1A 5T4HA 4LRQA 3JW8A 1GA6A 1W6UA 3QBVA 2NV2B 3A6KA 4B7ZA 1D7OA 4G3XA 4Y6QA 5HBRA 2ZXFA 3NQ41 4PV7A 4Y2SA 3K16A 1T43A 3UTDA 5LMCA 4OX9Y 3O8QB 4UPVA 1N2CB 1H6AA 4YUYA 2IA5A 1I3CA 3BGDA 3CRZA 4GF5A 3OZFA 5T4EA 1TKRA 2FN4A 1YKFA 3CSUA 1OZ0A 3FHCB 1ULBA 2DAPA 1VYVA 2H5LA 4RK7A 4B6SA 3CIFA 1HETA 2VTBB 3KV1A 3RS4A 3TR6A 2Z3WA 3UCXA 4CF7A 1BH6A 5ITZB 1PR0A 2ERXA 5KSZA 1RTTA 2VP3A 3VR6A 1U5BB 4YWHA 4CCSA 5AKLA 3GD5A 2YINC 3IDZA 3DXYA 3IXQA 3REQA 4D79A 3MLEA 1ACJA 1CUIA 3B6ZA 1Y3FE 1ADFA 3LT5A 3R6LA 3NEYA 4QYIA 1ODFA 4BQRA 5REQA 1SFRA 3VZBA 4ENWA 1T9ZA 1WB6A 2OBFA 1VSUA 2X22A 3OM1A 3UGTA 3WL3A 1Q0QA 1H3EA 2LCIA 5JROA 4ZOLB 1ELOA 3RVDA 3VSBA 1EUCB 3IAUA 1P7VA 4ARCA 1U5CA 3MRVA 4QQKA 2AF3C 2NXWA 3MTAA 3AZPA 3W7BA 1FTYA 2DULA 4MO2A 2QAIA 5A5VA 2VNKA 1CIJA 4NXMB 3RS3A 1LSSA 3A4NA 3HTXA 1GNRA 3OKAA 3FNBA 3TZCA 1YTLA 1UBJS 3V1MA 3D6HA 4HC4A 2PIAA 3JATA 4WK4B 5COQA 2IIQA 3VNBA 1Z16A 4U63A 3RC3A 1HE3A 4DLSA 4HZUB 1LGYA 2PCLA 1HDCA 3D81A 4WZZA 2ZWVA 2AQIA 2GM3A 5HJEA 4UXHA 4UMFA 1YR9A 1Y7HA 4J91A 1MNAA 1YB6A 4RA6B 2CU6A 4MRMB 5T4FA 4MI1A 3RS9A 4CM6A 5JALA 2OCGA 2FW7A 3LY5A 3EPJA 3R75A 1EHYA 4NF2A 5EMMA 5BVHA 2Z04A 3O2EA 1GSAA 3OZXA 4YI5A 3C24A 4FGKA 3SBOA 3GJ0A 1G7SA 1MKYA 3GGOA 3IHLA 2BEWA 4S1TA 1R1DA 5DTJA 1ORIA 4DR6C 4YDSA 3T99A 4I4TA 4CYMA 2WPDD 4FGWA 4ADSG 3GFOA 4R2HA 2P9ZA 1R10A 1PFGA 1LQLA 4YT5A 1JPVA 4OJNA 4Y2YA 5AM4A 3BFXA 3E7PA 1COWD 2YFKA 1VKOA 2VDWB 4OY3A 1ORVA 3OM9A 2CY1A 5J1TB 1SXJC 3L1VA 3O4VA 2H1HA 2HA7A 3P5SA 2G17A 4TYPA 4JZYA 4GO1A 3JYNA 4KRXA 1SELA 1SUEA 2EKPA 2WTBA 4YJGA 1W5BA 5FBZA 4QHSA 1O9GA 1U5AA 1FLNA 4W9NC 2PNJA 3WBKA 3R0ZA 2NU9B 5AWFC 3QTTA 2C5GA 1JR3A 3M9LA 4RZIA 1RRPA 3PLRA 3M4ZA 1E0SA 3IPCA 4QPZA 4BLWA 3EQZA 5G41A 4Q4AA 2RHWA 3FZQA 4WFIA 1L8OA 4QWMA 3QUBA 5EHQA 5EZ5A 1CQJB 2CL6X 2VT6A 2Q9BA 3GT7A 3LBYA 1C3JA 3FNIA 4DSZA 5AKJA 5DNYB 4I81A 1HURA 2GBLC 4WNYA 4NBRA 4N18A 2E4AA 2CUNA 3ZDZB 1T29A 1E2BA 4GM4A 2CDCA 3DP9A 4CKEB 2R1VB 1N7GA 1AK9A 5A3SA 2PSSA 3R8FA 2X6TA 5DZSA 4EBFA 1GNVA 2K2WA 4NYMR 4TSRA 1Z45A 1R3UA 2XZLA 2AQKA 3AHDA 3PNMA 1LWNA 5FTWA 3VPXA 2JCGA 1UKAA 2NTJA 4PFSA 3L05A 5B58T 3RWOA 3CRVA 5TPWB 4YHHC 3ZR4B 2Q07A 3PR1A 3RFCA 1U11A 2D2FA 3LH5A 4QE3A 4ZI3A 2V0CA 1QPBA 4D8YA 2P9BA 2XZTA 2ET6A 1XF1A 3L7BA 3KOYA 4MHOA 4JX9A 1FJXA 2CVHA 4G8BA 3PWZA 2NU6A 1U7OA 1R6AA 1LUAA 2RGNA 2YXNA 3B5JA 5IAEA 3IKJA 1URPA 4F71A 4W1QA 2B4RO 3DG9A 3PYXA 4IF4A 1MO2A 3NAZA 5GVRA 3VR4D 4FEYA 1B23P 3FF4A 1C9MA 1NN5A 2KB0A 4OSOA 4DYDA 1FB5A 4FZJA 2O2IA 2MCQA 1CRZA 5HJ5A 2PLRA 2C9BA 4LJ4A 5DEOA 1U6KA 3GHYA 1W1WA 5J5CA 4YNBA 3C5CA 3NYWA 3FWNA 3D3JA 4BB0A 4BKPA 2CSUA 4V1CA 3EN0A 1PD1A 4AICA 4X41A 3NKFA 2CVFA 4FI3C 4XAQA 5CMLA 1O6GA 4GX2A 4YRRA 1WXEA 5JCOA 4C0SA 1U2RA 4ENQA 1JQBA 1FSZA 3EQ8A 5EWLB 3ZHVA 2DQ4A 5JASA 4ARUA 1XJWA 2AMYA 2QL5A 1KSHA 1JRLA 5M2QA 1IN1A 3KQMA 1VI6A 2EFCB 4FFSA 4IGAA 2B61A 3HV2A 4R69A 3T61A 4MVJE 4TTRA 4PC3A 3T0GA 3W5DA 3C8ZA 3E05A 2VATA 2X0FA 4UVHA 1ISJA 1AK2A 3OF2A 1CJVC 1CUSA 1KQ3A 4BVEA 2HRZA 2E5FA 1AHHA 3FYUC 3FFXA 4XIYA 3A4MA 3DAPA 3FAZA 2FYTA 4QBKA 1VG8A 4G85A 3V4ZA 3DW3X 4BJHB 2FW9A 4CMBA 3LXMA 5HF5A 2FUKA 5IT5A 2NZXA 3PGMA 1W5FA 3EF3A 1U2EA 1UBRS 2CYBA 2WKWA 1R0CA 3HZZA 4MYSA 5FA8A 3RLIA 4CODB 3I5XA 5EUMA 1POXA 3TJZA 4FK8A 1VGVA 1XZMA 2HNAA 3K20A 3NTXA 2W0MA 1ECFA 5AHXA 1P9LA 4DLZA 1MX3A 4ZRDA 5CH3A 3KOMA 2XX3A 4ASUD 1TZMA 2PWZA 1XRJA 2SBTA 1CIPA 3NONA 4RVGA 4OUDB 2PUBA 1R9NA 4GL2A 3DEFA 1NV9A 3O4RA 4DLVA 3ESXA 1E6KA 1J2JA 1C9EA 1VLJA 4M89A 5CDFE 3DR5A 5A0VA 2VDUE 4Y0AA 1VC2A 3LCRA 4Y8VA 3QU4A 4G0UA 5L51A 1J6UA 2P9QA 2GSDA 2QVCA 1O9HA 1SC9A 1IB8A 3ANTA 2HXGA 3F1KA 3Q9SA 2FSIA 1IY1A 3QHAA 3ZZNA 3GEEA 2IODA 4MDHA 2LDXA 1NHGA 2AKAB 4FU0A 3AR9A 2ZR0A 3DVQX 3PJDA 3QELA 2GJAA 3UJNA 2R6DA 1LPNA 4B3GA 3H2KA 5CB8A 1QC5B 2Z8ZA 3V7WA 1DMRA 4GLOA 4RSMA 2ZB7A 1EWTA 1G2PA 2K6GA 3IKMB 4HZUA 3VPAA 3PGKA 2UUCC 4IJWA 2QYTA 4HQRA 5C37A 1JHDA 3SBEA 5KNDA 2CLKB 3K70D 5DI3B 4ID3A 2ZBQA 3WA7A 1CBUA 2P40A 1YHZA 4ZVVA 4AJEA 1JL3A 4DCVA 3EZLA 5H8WA 2Z6QA 1V48A 3GVPA 3M5DA 2Q3DA 1JSLA 4D0GA 2BJWA 3ND5A 1A5SB 3P9XA 1SMKA 2F17A 2FPSA 4JBIA 4QDTA 2DU8A 4UJ3A 3HJFA 4QYWA 5GIPE 4M8LA 5DLDA 4CGZA 4M3NA 3W1WA 2ZIGA 3DOHA 1XU9A 4GI1A 1PR9A 1DI0A 4LJLA 2HA2A 1PS8A 2JDID 5E2IA 2RAVA 1NQWA 2SICE 5F33A 2B2CA 1W0KD 1C2YA 2HBRA 4PTYA 3UJHA 1I6LA 1OFTA 2ID7A 1GL3A 2H9AA 2JI8A 5BURA 1NF9A 3VYUB 3ZEIA 1NW3A 4KWHA 5FULA 1MOSA 1YQDA 1EWVA 4OQQA 4L15A 2NU9A 3AWIA 1BEZA 3L0BA 5K20A 1NMYA 1WH9A 3INYA 1DBWA 5K3BA 4X1OA 5JYDA 3LF1A 1UM8A 4MV9A 4BLUA 4S35A 4LXXA 1T4GA 2A7QA 1M8KA 3BOSA 1NBIA 1M2HA 4JI5C 5F9HA 1JQAA 4QULA 4XWAA 1PBTA 1T2FA 3MCUA 1LS6A 3DTTA 2ZXEA 4JI7B 3FD8A 1M2KA 3ZG6A 1OGYA 3MWEB 4XCVA 4I9UA 1VCMA 1PT8A 3DBLB 3KXIA 1C8VB 2GNOA 4CQMA 3ESRA 3ZS8A 4KIWA 3KAQA 5IC6A 2DUJA 1U3FA 3FPHA 4HDRB 4B4KA 3QKSB 3H83A 4N3CA 4MYRA 5CLFA 3OX3A 5JH7B 2FP4A 4PLZA 1G5HA 2QORA 3JQQA 4YJ2A 2C61A 4G1CA 3C3MA 5CIWA 3MYYA 4PCUA 1MMFB 2VHQA 4H17A 3AGPA 5KJEA 1FNBA 3KQWA 5G3YA 5I9NA 2QRLA 1U9ZA 2RHCA 4FT2A 4RQAA 4DADA 1IXRC 1F2UA 1XLTC 4LF7B 3F8WA 5LB4A 4FUTA 2UYYA 1WXFA 1XOIA 3LKVA 1RBYA 4L76A 2AEFA 2PUHA 2A3RA 3I9JA 2GO1A 3TMAA 5JMOA 1KAGA 2ERYA 4RLHA 2WM3A 4XWGA 1NE7A 1TVKB 5CP8A 1QLJA 4D7AA 1B8UA 2FSVC 1JWLA 2OAP1 2E0IA 3CJRA 1MPXA 3O8OA 3QU2A 4NNPA 1VSQA 2Z1DA 4MYTA 5LQMA 3AVXA 5I7HA 3Q8MA 4MA4A 5HE8A 2PBFA 1YC5A 4H7FA 4J6EA 4X93A 3WRWA 2PX4A 3GBPA 4IFIA 3F4BA 1CE8A 1R4MB 1SQ5A 4XDHA 5ADVA 1Y7LA 5AUNB 3RYIB 2G3YA 2XMGA 3OQMA 2IEGA 1YZNA 1H2XA 2IPLA 3ORYA 4ZC8A 4DQVA 2C4MA 1CS0A 1TT5B 3PF8A 4OJTA 5HF9A 3SFZA 4BN4A 1OPRA 3MS2A 1U2TA 3SQNA 4CFSA 1AH2A 3VSAA 1Z47A 5KTTA 3ML1A 1LVGA 3HRHA 3DD5A 3HCNA 3LBFA 3D8RA 5JEEA 2RCNA 4BNKA 1TJ4A 3HLKA 2AFIA 2G28A 3ETGA 4TVKA 3R44A 3LBIA 3OUUA 1H0KA 1UOPA 3PV0A 1JVBA 1BTOA 1OXKB 4XQEA 4CHGA 4IV5A 3LRXA 4M0EA 3FWHA 3U2QA 3ZD7A 1GPAA 1IM2A 2W00A 4H77A 4M1EA 4X1KA 4EDHA 5FTNA 5L8VA 2G4LA 2P0EA 3R0JA 3F90A 3U4AA 1F48A 4X8HA 3RPEA 4OJKA 2E4YA 2XMBA 2GNPA 2R79A 3BFPA 1Z0IA 2FEPA 3CYFA 3KYIB 4HMPA 3KSDO 4P7BA 5DSZA 3TX2A 3KQLA 3R6WA 4WCFA 3AHIA 3T95A 2FZEA 4LZOA 4ZAFA 4RD4A 3AMVA 1K3FA 4B45A 4PYLA 3ONWA 2ZIFA 4ZDKA 3CG4A 4TYYA 3OCUA 2JH8A 1TIPA 1US8A 3DOFA 4TS1A 3OA0A 4B82A 3FJ1A 4F2DA 4ZQCB 4F5ZA 2KQUA 4QVKA 4MUHA 2XTAA 4I5DA 4EM6A 2X3UA 1HQCA 3TI7A 5L3QA 1CC1S 3FYCA 3RREA 5F64A 4UHDA 5DF1A 1LJLA 4U7FA 3TPZA 3ODPA 4XYGA 4CDGA 3X1JA 4NE9A 4GMDA 4BXOB 2ODNA 1PG4A 2DMRA 2GN8A 4LXTA 2GPAA 3GEGA 4F93B 1TAHA 2PY6A 3MMZA 2HA4A 5JYBA 2P9JA 3BN3A 3R3ZA 1II8A 4R16A 4HGNA 5DBIA 4QOSA 4NBTA 4CIYA 2WTMA 4QOGA 3BSSA 4N3NA 2FW1A 4CXMA 5GJVC 2FH5B 1UK8A 1AUXA 2H07A 1PI3A 1EVQA 1E6LA 4RCZA 3W6NA 4LF6B 3TL3A 2HTFA 4UE3S 4O2AF 4XGIA 4MKIA 1Z06A 3CJTA 3LFTA 1PJSA 1RLOA 4R2XA 2SECE 4TKVB 5I45A 5IVKA 3IHWA 1Q1QA 4KR2A 3ICEA 5T67A 5T6BA 4AL4A 4CTNA 2W6ID 2IF2A 1WEHA 1HE4A 5T7BA 1MAHA 1T2AA 3IUSA 2Z8YM 1X8KA 1XA0A 3A1VA 2WUEA 1P5HA 1PJLA 3D4IA 4MI9A 3KSBC 2BUCA 2NZUG 4CU2A 3B9PA 4DR1B 2WJAA 2G08A 3EC7A 3Q40A 1XNHA 4K6OA 4WDRA 4MGIR 2MSWA 2O8BB 4HQNA 3AEQB 2EWVA 4O1HA 2X8LA 4GOXA 1RP7A 1TAQA 3QPWA 3P9RA 4K88A 1CDZA 5SYMA 3WNVA 1E9EA 3E27A 2VSNA 1PS0A 5JSZA 3ESZA 1S2OA 2MYTA 4C0LA 4EJ2A 2IQ5A 3DGFC 3OPQA 4UHCA 2C5EA 5HUHA 2QPTA 4RVDA 4WHMA 2R8RA 2O0JA 3ORQA 2RG1A 1MGOA 2AN3A 4LRWA 3RS7A 5K0LA 5ICEA 4R1SA 4YCDA 4J6FA 2PT5A 3WLQA 2J5RA 2X4GA 4AZ3B 2IE0A 1IXYA 3CH6A 5EYPB 3CEHA 5IZ4A 4RKQA 2ZEJA 4CIBA 4O59O 5A1GA 2REXB 3RVRA 1NX9A 2JIZA 1M8FA 4UQOA 1BXGB 4ESVA 5BPFA 1Y63A 1YB5A 1IY9A 2IEYA 4B75A 2Q45A 2JFYA 1WCJA 2RHMA 2F64A 1SXHA 2ZUBA 3O95A 2YTZA 5BSHA 1IEVA 1C3OA 1FXWF 1J9EA 3IJ5A 4ZK2A 3TFOA 1CNMA 1JDTA 1EGHA 3QFCA 4PG5A 3CMMA 1J5EC 4WNAB 3FPJA 2G70A 1CTQA 3A36A 3JWHA 4I08A 4A0SA 4JY7A 3QK7A 3DT6A 1J1IA 1CX9B 3H04A 1YJCA 4PXSA 3HFJA 3T7AA 5LU9A 3MPOA 4Z9YA 4WACA 5BQ5A 3INGA 5E9QA 1WMSA 4J03A 4Z3DA 1A97A 1HKUA 1WJGA 3L6UA 2GLUA 2YJTD 2JHAA 3T1OA 2C07A 3PFIA 3VTKA 3H86A 2RH5A 3AYZB 4YMLA 1LNQA 1NBHA 2Q46A 3KLNA 1O95A 5CB0A 3VPFA 4NFSA 4CM7A 4MW5A 4TRRA 3ANNA 1WUHS 1BKYA 4RPLA 4BVHA 1QX4A 2QU7A 4KNYA 3JX9A 4JI8C 5ERGB 3U5TA 3SXPA 1PQWA 1IG3A 2Z9CA 2ZE7A 4UEQA 4MUEA 1EJ6A 3NWPA 1EWQA 1AGNA 1V7QA 3B1XA 3TG8A 3TO5A 5FTKA 2G1PA 2HK6A 3RSSA 2DCMA 3OICA 3C6ZA 2FX3A 3VR6H 4L4ZA 1WSDA 4LF7C 2CFTA 4OHVA 4TYQA 3F5FA 4X1KB 1A76A 3DS8A 4Z4IA 3GJSA 4V0ME 4P5DA 5AI8A 3ZI0A 3R20A 4HR7A 2CNWA 2AG0A 4MGZR 4CLHA 3HDJA 3X1MA 2V9PA 2JGJA 2XNJA 2Z83A 4RKEA 2HQ1A 2M98A 5IDVA 3GP5A 4DJTA 3VOAA 1X2EA 4DW8A 2V9ZA 2NO5A 3LZ6A 1P5ZB 3SKYA 1XVTA 2CY0A 3F73A 1Z0DA 4AVYA 2ESRA 3VR3A 3NR2A 4EJFA 4CIAA 2OSVA 3TB6A 5AVWA 1SBNE 1GVHA 4L75A 5ALLA 4YJFB 3B12A 3DE5X 5EHNA 5K3EA 3CR3C 2I2WA 4QHYA 3WV5A 2VDMB 1NXQA 4KVGA 4KAXA 4YRQA 3R0VA 4RU1A 3RVMA 5GMOA 1YOVA 2QXUA 4IICA 5FL7D 1R88A 3A0RB 1T25A 4RTMA 1NG9A 3R23A 4L8GA 4RACA 1DTWB 5LJIA 2I3BA 5ERXA 1Y7PA 3RVSA 3TE7A 4DUZC 4KBYA 3U6KA 1N7IA 2FPIB 4GZ5A 1XJ0A 3PFBA 3TXYA 5FWNA 1UXJA 2FVXA 1MXBA 3QPAA 4QYTA 5D51S 3RODA 2P7HA 3Q3VA 2E2WA 3UA3A 4EI2A 1ZN7A 4Q12A 6YASA 5LWQA 1VSVA 2VYND 2DHDA 3K9HA 3MERA 3E0XA 1GSHA 3A28A 5JNVA 2PUFA 3GDFA 3IDQA 5M34A 1W4LA 1NY8A 1R0WA 2XMPA 1QUFA 5DMXA 4K0KB 3C3DA 3R4CA 2V6FA 5DGCA 1XVUA 1MXCA 3BBPA 3SXUA 2IEDA 2VJQA 3VI4B 4CMEA 2H06A 3CX3A 1N8TA 4U5XA 2VJOA 2KWIA 3AEUA 1FQKA 3PWTA 1QJ4A 1ULTA 1G55A 2IUEA 4PQYA 4RV5A 3FVWA 4Y6LA 5EZYF 8ABPA 5HK9A 1TEHA 2XOKA 3EUEA 3TQCA 2YMMA 4ZEXA 1TK2A 3G0DA 2PL5A 3PHJA 3R5FA 5C52B 3EW9A 1W85B 4JYBA 2XODA 2I65A 1S3SA 1LQTA 3OIGA 4MV8A 1W1UA 3OQIA 3HXQA 5J2TB 4LOAA 1W76A 1VLQA 2F1JA 2F7SA 4XTRA 3W04A 3VNSA 1CY8A 2ZBVA 2HHCA 1Z3CA 4RIFA 3WBJA 4GI2A 4FJ2A 4BX2A 1AUOA 5A6SA 2MHCA 2ZSBA 3SS9X 4MW0A 2JCSA 3EC2A 1TX4B 3B89A 3I1FA 2B5WA 1Z5VA 4U2KA 3A70A 4UASA 5CK5A 3RFVA 3G5TA 1YJ5A 1SD5A 2H2WA 1DPGA 3HBAA 3JZDA 3OLVA 2N1MA 4OOEA 2VPTA 3SF8B 3SJ7A 2XBMA 2PKYX 3PUIA 4FCTA 5AHOA 1XB2A 4OLJA 4KQJA 2DFPA 2JD1A 3DGEC 4O5OA 1DIGA 1NYTA 3E1KA 5HPYB 4OQLA 1F9AA 1NW6A 4OXNA 5DI3A 4OAOA 4FNAA 1MFZA 2YN0A 3TLBA 4QGGA 3W2IA 4HJXA 1MO3A 3OUTA 3GH1A 4FXPA 3BXHA 4JVMA 4ZOLF 5F7JA 3OZSA 3E3LA 3IUJA 4E5NA 2CD7A 2B37A 4QXPA 3GJ3A 4BMYA 1XU4A 5DHQA 4TXMA 4ZA2A 5K85A 4AY5A 3FUCA 2GF0A 5D00A 5F9FA 4LSMA 3RRNA 1P4HA 3KKKA 2FGJA 4R9RA 2FPIA 3RRZA 3ZBUA 1WXXA 4QUEA 2AFVA 5AM3A 3QEMA 5AESA 5FOSA 1IHDA 1C2TA 3CLHA 2QVXX 1NLFA 3CA8A 3V1YA 3U1BA 3G2QA 1HYHA 3TQQA 1JJFA 1REQA 1WE2A 4Q1EA 16PKA 2H08A 5E3JA 3GFSA 1L5HA 3D0RA 1P0IA 1ZX1A 4E08A 3PNSA 2O0HA 1HTTA 2HSZA 2CD9A 3ULKA 2Q3CA 3PFGA 4A8HA 2CXTA 2OCDA 1WKVA 2R6GA 3PPYA 2WBLC 1IBMC 2C2GA 1Q5PA 4OXQA 4V2UA 5D2CA 1WLYA 4IF6A 3UOWA 4NBVA 3U3ZA 1ZGBA 3UMGA 2ZSKA 4W9NA 4YXWD 4OX9B 3JQAA 2MMCA 3FCCA 3RUCA 5BWBA 2E4UA 3N86A 4P35A 4YUXA 2XPCA 2ZU0C 4KXLA 3E2IA 4IIGA 1PW5A 1QMGA 4PW0A 1GLNA 4B7XA 1SUWA 4TS4A 3SQDA 5ES4B 4HDMB 2VZLA 2H2GA 5BUQA 2WG1A 4Z54A 3TDEA 3N7AA 4HSEA 4YIKA 2ZJAA 4RVFA 4RH1A 2HV9A 3EMVA 3MWJA 3T38A 1W581 2XB4A 2NAPA 2OO7A 1ULZA 4OD0A 2IV7A 4UTRA 3INTA 3I05A 2AL7A 4PAOA 4ZRMA 2ZYIA 1V1JA 2PRZA 2H2DA 4JENA 4I3FA 3PRYA 3ROMA 4DCJA 3IMEA 2XYGA 3KWLA 4LQDA 4PCLA 5FADA 1QS0B 1YBHA 1S1CA 1CYEA 1MEOA 5AIAA 4R4JA 2FLKA 4CMGA 3NTUA 3LAWA 2VJDA 3S55A 4F6RB 2M5OA 2B83A 2EKDA 3P96A 1E3EA 3PR3A 4FX5A 4FYMA 4Q66C 4RHTA 4A8PA 3CX6A 2JLSA 3MA0A 3NTQA 1ECLA 2JI7A 1DBRA 2O48X 2HYDA 3CVJA 2PZJA 1CY7A 1PR4A 2GZ1A 3GAZA 1IQ0A 1PV2A 1W35A 1W96A 3FOFC 4BN0A 1N1EA 1E3WA 2RJOA 3LECA 3L4JA 2HJSA 4OQPA 1UMBA 5JSFA 4P3OA 4Y2PA 1WQ3A 1NFFA 3ZCSA 1IBKB 4YYZA 3W2TA 2IU0A 2GKSA 1KI9A 4FMDF 3KTDA 4CLEA 1U2ZA 4EIWA 2IYWA 4KYTA 4W9RA 4DIBA 1N8NA 4DKXA 2C99A 3CJQA 5G0UA 3TCNA 1VIDA 2ZQ5A 2OMEA 3W9SA 5FNVF 3CE9A 3DKKA 1FEZA 1LDYA 4HB4A 4MVJF 5A1IA 5DMHA 4D46A 2W2VA 4ON9A 2CE7A 3GDWA 1GZ4A 4LRSB 2XUHA 2YQ5A 4JX8A 3Q15C 1ODTC 3IELA 4FI3F 4X85A 2EKQA 4D99A 3TUZC 4XKJA 9GPBA 5ALZA 2QJRA 3IP1A 5I7SA 5FCDA 5GOZA 3D6MA 1PNQA 5JCOC 3TBHA 1NUUA 1KFCB 1PKXA 2E18A 2QIPA 2WYWA 4DNQA 4KR7A 2JLUA 1PJBA 2WC1A 4YAEA 4LUCA 3TI9A 3PSAA 5FPKA 2JATA 3LX6A 4L9RA 3WLSA 1LK0A 5AI4A 2UXBC 3ZWAA 1H1TA 1LRKA 1NVXQ 3ZCPA 4BZQA 2NTNA 2PD6A 1WX1A 1FFBA 1BDHA 3M5WA 3VU3A 4QJ3A 3QRWA 4QJ5A 1OXXK 3NCTA 1XDSA 5CZXA 5EJ4A 1C9KA 1ENYA 1XZAA 3WLPA 4UVEA 3W5CA 3HN2A 4DANA 1GKKA 1EFVA 5F77A 4ZI7F 2BGJA 4L4QA 1EUCA 1T35A 1TM7E 2D62A 1QS0A 2BISA 2HJRA 3KEQA 3O47A 4U1RA 4K0KC 4AJLA 4FWTA 1IY8A 3T5GA 1YS6A 2JIDA 2LD4A 3AFMA 4KTVE 1W0JD 3C3JA 3ZQUA 1VMEA 4E7OA 5CXUA 3O73A 4QBHA 2RG7A 1E77A 1BU5A 1KIAA 1L5OA 2NUPB 2I4RA 2QR3A 3RDPA 4AF7A 1RKVA 3GJ7A 4KK4A 4KO8A 2OENG 3F4LA 5KTNA 4KUGA 5D1HA 4BKOA 2GN1A 3E3OA 5AVSA 1M6NA 4JI3B 1PR2A 4HTAA 4PG6A 3OOWA 3WYBA 4AXXA 3W8FA 2QV7A 1B1CA 3CUKA 4JMPA 4K6FA 1LZLA 5BV8A 2Y0BA 1PE0A 2YY6A 4HCJA 1L9KA 2YJ6A 2X8JA 4IHJA 4KQKA 2GAJA 3N8IA 1AKRA 5K09A 1L7DA 2ODQA 2DFVA 1E3DA 3KB1A 4RF5A 5FNVB 3Q8KA 2J4CA 4KQCA 3EH2A 1P61B 4TKUA 2PYDA 1SVLA 5AVKA 1EWYA 4DBLE 1S02A 1KO4A 2C3MA 2RHDA 2XMQA 4K9LA 4KSYA 2OPHA 1QHNA 4LMRA 2WNHA 4GVLA 4MMYB 1NKVA 2QDKA 3RVNA 2COUA 2XZDA 5HKBA 4U7GA 1KU0A 4WKNA 4W9MC 5HG0A 1ZOOA 1X39A 4I55F 1A9OA 5DU2A 4P58A 2ZDGA 2VRCD 3CB4A 4ZU1X 2QPAA 1TA4A 5DGIA 1ZSNA 4J0DA 1FXUA 3WGQA 1XYVA 4G24A 3D0OA 2QMHA 5CPFA 4QPNA 1RHMA 2HMYB 3EVBA 4M0KA 5E1OA 5BYBA 5T64A 1E0AA 1ZS9A 3M9WA 1BH2A 2WT4A 5HQ3B 1G64A 4E15A 5JJBA 4LNUB 4GOMD 5WRFA 1KK2A 1BXGA 1WD5A 1EDEA 2H85A 3C6YA 4QQ8A 4RH0A 3TUJC 4DA6A 2IS6A 2PV0A 1GP2A 4HS9A 3EOAI 2RIRA 3F47A 2ZLBA 3VZRA 2P3OA 3BTUA 4REQA 5DK6A 2Y71A 5DKFA 2F9MA 2LWIA 2E48A 2IKQA 3NI2A 1GQOA 2W2NA 1HNXC 3PUYA 2PWPA 4WERA 4Z99A 3COVA 3LL7A 4DG5A 1Z17A 1V71A 2NO1A 2HXYA 1J8DA 3L4BC 2UAGA 1RPTA 4BCAA 2AN4A 4LC1A 5LCIA 3ZK8A 1OVMA 3AHHA 2O3TA 3KYDA 1P31A 1U04A 2MM9A 1R4ZA 1N0VC 1VLAA 1X7WB 2GZ3A 4IOKA 3K15A 1YB4A 1BKDR 1PKEA 1N9GA 1PJ8A 2ZBRA 2ZIEA 3Q87B 4UEKA 1E1CB 4B9EA 1QDLB 4DQKA 3D31A 1SCIA 1ODJA 2Q5FA 4GMFA 1XHEA 3EIUA 4MW6A 2A9JA 4A23A 3CURA 3NPAA 3CSDA 4WJZA 1DZ3A 1HF3A 1OX5A 1E4VA 2F1KA 3V8EA 4UPEA 3GRPA 2D0OB 1C8BA 2A9VA 1G8HA 2QZPA 1DEAA 4MS1B 4XQ0A 3U49A 3OJEA 1C41A 1NXOA 1YT5A 5CT5A 3NJRA 2C2MA 1PJZA 2R8EA 4C7VA 5LZ9A 1DC3A 1F5SA 4L50A 2RJNA 4MZXA 4R8MA 1JA9A 2V8OA 3HBLA 4J29A 1LD3A 1Z5OA 1RFLA 1Y9DA 2Z5FA 1CY0A 2ZJFA 4JP3A 3B52X 3A3NA 2IU3A 4O2AA 4TQAA 1Q7BA 1RRVA 1EHCA 3B6JA 3F67A 4NDZA 3SC3A 4DHEA 4D25A 4IQ8A 3THYB 4I1SA 1XI2A 1E3JA 4WY8A 1N5DA 1T9GR 2BPOA 1PTKA 1FFXA 2FSVA 1E2MA 1FU7A 1UXIA 3G8BA 3DWGA 3MB8A 4J0EA 3VSEA 5ER9A 5ESDA 1ID8A 2AFIE 2SHKA 1EB9A 1Y37A 1W75A 3NALA 2XOEA 5KNCA 1FZTA 1U0TA 3YASA 1DP4A 4WXHA 2PJUA 4L7QA 4FXOA 2W9XA 2QMUA 4FE3A 3WSWA 4E94A 5JSQA 4R0VA 3T7JA 3UANA 1WZUA 4AP5A 4AXBA 3IDFA 4Y2QA 3EIQA 4YJFA 1OH6A 2H4WA 1XP5A 2UZ0A 1C3VA 4WNAA 1H9AA 5JQGB 3PC4A 4H7IA 3ZIAA 4TGLA 4XVQA 5ALQA 1F17A 5ER6A 2OFXA 2PT9A 3KNZA 3VSDA 3EIFA 3KWFA 1R9MA 3NT4A 3DZDA 4AKTA 1ZQ1A 3W7AA 2Q0XA 3T0IA 3DONA 4BNMA 1AS2A 1RBZA 4HI0E 4WZAE 3KSAC 4RD0A 3FBTA 4U7DA 2RI0A 3PCRB 2BUBA 1W36C 2ZRLA 3P1JA 2OPLB 1BYUA 4ZAGA 4IDDA 3BE4A 4UQPA 4DJJA 1IWOA 3AFHA 2NWQA 3KYJB 1NUSA 1JPNA 4PICA 2VA8A 1K3TA 1VCHA 3L7NA 2B20A 3AUYA 2D1FA 3KE8A 4KVFA 4RXTA 4B2YA 3AI1A 4DLXA 3GNLA 4LECA 7MHTA 3BTSA 4XOIA 5ALMA 4EB6A 2QGFA 1XCPA 3KYBA 2NZYA 4GKKC 2C4VA 2DE0X 2VXYA 5KVCA 2VT3A 2ODAA 2F8MA 4K9NA 5ITVA 3BRCA 3P0EA 2A7XA 2GTPA 2W0SA 4I19A 4YLEA 1L7QA 4YBZA 3KXKA 5EFZA 2XUJA 3UC5A 4H9GA 2HFKA 4NNJA 3SYTA 4AX8A 5EE5B 5AVUA 4V0KA 4DB2A 3MCZA 2O8CA 1MCZA 1Y6ZA 4MB2A 2I2CA 3L0PA 1EDDA 2NUPA 4YR7A 4BATA 1B8VA 1QTRA 2AOTA 1DEHA 3CZPA 3QV1A 4RS4A 5EPEA 3SSNA 2PUAA 1DJNA 2GWRA 3R5KA 4W1SA 1XMSA 3CZCA 5JZ9A 1A5ZA 4TYNA 1I80A 1EYZA 4X6YA 4BGUA 1H1DA 3UJ7A 1SCDA 3AUTA 1MUUA 3EISA 4D4GA 4DE5A 2Q1SA 3GVXA 2XUFA 2RHOA 4ZYXA 2B4KA 2UZ1A 5JWHA 4K8OA 2G0TA 2O8NA 1N3IA 4IDGA 3C3AA 3N0VA 4C4SA 2GO7A 3DZKA 4DARA 1HDYA 4NAVA 3NH6A 5FNVA 1SHKA 4M9SA 2QL6A 3HN6A 1XTJA 3DTNA 5DJ5A 5BQOA 3B1KA 3UZUA 1NUTA 4BDSA 3A4IA 3CZQA 3CHYA 1P0FA 2B4QA 2BKVA 4GPIB 3L7DA 5COAA 2ZI3A 1QYVA 4FQ5A 1GA4A 5JQGA 4E5MA 1KHTA 1FYVA 1U7TA 3HA3A 1BRMA 3G8DA 1DELA 3ISJA 5AKIA 1MOQA 2VO1A 4ALIA 1T5OA 3BWBA 1WXQA 1GU1A 4L1KA 3SZUA 1AVTA 1KWGA 4DIKA 1T4MA 2A6PA 3WB1A 5LLDA 1PEAA 4IBOA 3RHTA 4YPOA 2LDBA 2Q6KA 4D4HA 3LPLA 4WH0A 3KUUA 3ZNOA 1N6PA 8AT1A 4D56A 2IL1A 3QWAA 5ALFA 4FIDA 3BDAA 3O3MB 2OORA 1W47A 5FBWB 3QEMB 1PR5A 1I7NA 2PWBA 3A1FA 1SOWA 1UP4A 1RI2A 2DH6A 4RL6A 4LHVA 1SQ0A 4BLQA 1O6CA 2HZBA 3T15A 3RC8A 4P54A 5A4IS 4P1ZA 5CDUA 1WP4A 3UJCA 1Z2CA 4YP6A 1A9TA 4N0QA 5EY5B 4DF3A 5KQSA 4Y0VA 1MAVA 1DC4A 3NPDA 1N32C 4IL5A 3RVBA 4G0NA 3DFIA 5EE0A 2P5UA 3KZOA 2OK8A 2AGVA 2VZ0A 1HDXA 3MJFA 3WB9A 2O5CA 4FTFA 1NVEA 2RHHA 3TQHA 4K9MA 1ISMA 2DHRA 3V55A 2WT9A 4Q4HA 5B3AA 4D81A 3J81A 1T36A 2BH9A 4F5DA 2YZGA 5F2EA 1A4IA 3QLUA 3GPCA 4CL8A 1J90A 2HW8A 1U7DA 1LH0A 1FRZA 1X7WA 5JRHA 1X9GA 3BMQA 1N36C 3NHMA 3QF4B 5HOQA 4YCNA 1SJ9A 3CVXA 5L7WA 1RRKA 2RGBA 1Y1TA 5BN3A 1ODKA 2EJTA 4FYVA 3EG9A 1W36B 5K3CA 4YFVA 1DCFA 1NSTA 1J8QA 1E6CA 3WZ2A 2B9VA 1R8YA 3IEIA 3IIMA 3AL3A 4X00A 4X7BA 4ZOLA 1LBEA 4AB1A 1OKKD 1HL7A 1KDOA 1M0WA 3FIUA 3W9UA 2CHGA 3L46A 3FROA 3O1IC 3V7FA 1DG9A 3DAHA 4ZT4A 4EPXA 2H2FA 2Q9UA 121PA 1J9GA 3N2GB 3K0SA 4PLTA 1I7PA 4DIOA 3D0QA 1NJ5A 4H2DA 1ID1A 2YHIA 1C9JA 3EGIA 2IEIA 2WSSA 3J7TA 2IYUA 3MBIA 2P9FA 4PZAA 4BWVA 5FTLA 3LX4A 3LGXA 2XNDA 4TMKA 3S68A 1L1EA 1MB4A 2P11A 4XX0A 3VR5D 4Z86A 2X2EA 1DZIA 1FX0A 1VE6A 1P8JA 2ALJA 1CUXA 4XPIA 3WI7A 1YS1X 3KPUA 2IYYA 1L7VC 1P33A 5JDIC 1UMBB 2Z6UA 3OAAA 3UG7A 3CH5A 3KEGA 3OU7A 4O33A 4O29A 4AWAA 4W5TA 1A50B 5JAHA 1ISSA 1KSFX 1G21A 3DLCA 3LGSA 3V8VA 3C7DB 1OWLA 2JGFA 1LPOA 1KFJB 3GVIA 4RC9A 3ZBPA 4CM4B 4U7WA 3IXMA 1TYDE 2JFFA 4OMFG 3DFZA 2O2SA 2JDIA 4G36A 2OAQ1 2OQRA 4FZ3A 2R1ZA 4G97A 3UJAA 1U8TA 1VDZA 4CW7A 3E9QA 1ZINA 1ZMXA 3I01A 3O5AA 4U00A 5HHTA 1DAPA 3PUZA 3UWDA 1WXHA 3KR1A 3AR5A 4P08A 4REMA 2QRUA 1MDBA 2JGMA 4ZPXA 5J43A 2QTMA 1JP7A 4ATNA 3RBAA 5KC8A 1FTNA 2E21A 3MOSA 5BSRA 3AZOA 1WEKA 4WZBB 1QQAA 3VR1A 3E61A 2OAGA 3ETEA 4NCAA 4GWLA 4ANFA 3C74A 1KRWA 3VNUA 4XH9B 4TRNA 2EBUA 1NU8A 2CC2A 1XCGB 4BMVA 4QQRA 3OM0A 4KC0A 1NJ2A 1GNQA 4XIGS 3EUAA 3D7SA 2CF6A 4CM5A 3DULA 2VHTA 1ATIA 1HZZA 4OB8A 2BGRA 2P2BA 1Y7TA 1VYUA 1ILWA 2A4MA 2ZWMA 3CUWA 3IPXA 1L1FA 5K03A 2QRQA 1JFRA 5HNKA 4B6FA 1WCV1 3M2PA 1GT91 4UAJA 4WCDA 2ZOSA 2O8CB 5DRTA 1XEWY 1KOJA 4A73A 3B9BA 3QNWA 4DT1B 4TMZA 1D1TA 5DTQA 4F4DA 3ROTA 5BYJA 3L0ZA 1RACA 1ZD2P 4LRTB 4CV0A 5B58C 5JXIA 2VI5A 4WKBA 3L6DA 5EHZA 3IL2A 1AURA 3ZZMA 1JYSA 3UOAB 3PKIA 4JJIA 1R0SA 1HFEL 1NF8A 3LHKA 2IY9A 1KYVA 1UBSB 5A0TA 3NGLA 2VP0A 3ON5A 1DCMA 1F4VA 1RQXA 1WHSA 2VZ9A 2GPTA 3PQCA 4LJAA 1E3WB 1CZLA 1A8QA 1M6WA 2ZPUA 3TF5A 1KZ1A 2O8BA 2AD5A 2R8ZA 2PROA 1QFJA 2A78A 1JEAA 3HO8A 4JLBA 2I03A 4RMHA 2UZ1B 2OBLA 3SR4A 2I4OA 3FM9A 4Z8YA 1FVFA 1TK3A 2Q2QA 3QOYA 4PEVA 1NSFA 1GL7A 4CUKA 1C4KA 2N9UA 1RG9A 4Z4GA 4GXQA 2QX9A 4G07A 2FK8A 3ONNA 4HH4A 2Z30A 2XVMA 4MARA 1UMDB 4LYFA 1UM9B 4UQLA 5JATA 5LA6B 4LZWA 2PT7G 4C43A 1EDZA 3STXA 4YV7A 1IUKA 3BH7A 2ZRCA 2DLCX 1IUNA 1SG0A 1BOFA 1N0HA 1NOJA 2IZ7A 5ESWA 3BZBA 1C7IA 3M1LA 4EW6A 5LMUC 3DM9B 3CO5A 3QYFA 3EXEA 2HMTA 3S27A 4G5HA 4BTEA 2YC2C 4M8NE 3B9RA 4R1UA 5KYKA 2GEFA 3T5PA 5KX5F 1ZUIA 4R6XA 1DWQA 2WUGA 1M34B 3OQBA 3U5ZB 3LCUA 4HWPA 4N3GA 3HP4A 3BWCA 3V1TC 1FFAA 1C0IA 2OBNA 3MMNA 1YS9A 4JQZA 3W2GA 1GOTA 1HT2E 1USKA 3Q5DA 1SCJA 3KLPX 4F1WA 2QY6A 3PFFA 4U7JA 4POAA 1WMBA 1JYEA 2HWUA 4MH0R 4D3YA 1ZIDA 2BM1A 1N57A 4ZMSA 4NICA 4NIMA 3E84A 4KDCA 1UT6A 3EBLA 3E4CA 4RAOA 5HFNA 4M38A 5IUJC 1RIFA 1VMAA 5C8VA 1GAXA 2PQ2A 2ZULA 2GRUA 1Q19A 2AMJA 2NV6A 2ZJ8A 4DAEA 1VJ0A 4I4IA 4GM1A 1G3QA 2CDAA 1E7WA 2PS0A 4MUIA 1K89A 4ITVA 2P7IA 4XDGA 2IP1A 3KYDB 1L7NA 2GCPA 3DL2A 2D1SA 2A14A 1JDPA 3G2PA 4IM7A 3D6TB 1E58A 1E1LA 2CXOA 5KUTA 4HNAA 3C87A 4CEJB 3M9XA 1C9YA 3E22B 2DR0A 3WGVA 3EARA 1M0SA 2J6BA 3ETNA 3F6RA 1Z0UA 3D2BA 3RNLA 4YRGA 1QP4A 2Q4RA 4KUHA 4YAIA 3UM9A 2VPWA 4OOFA 1T1SA 3Q85A 3IOEA 4PG4A 2O2YA 4H1UA 1FMFA 1HG0A 1YONA 5MHTA 3ICOA 3G5UA 4JB8A 3H3XA 4XWTA 3EXG2 1XKTA 3N0XA 4NAUA 5CVCA 1QH8A 2L19A 3WLRA 3FCUB 4YAFA 4ESEA 2PRJA 5LQAA 5EMLA 2I6GA 4QBGB 1RJ9B 5AJTA 4DA7A 1SD2A 2VJMA 2L42A 2DM6A 3M33A 3WWDA 4QGAA 4AKEA 5A02A 2AKEA 1P9RA 1K9VF 4YV0A 1IULA 3BWDD 3P20A 5GV7A 4EY7A 1XHJA 4AJ1A 4S05A 3WKCA 1HLDA 4S1PA 3KB8A 3GUZA 5DASA 3C7CB 3DMHA 5IKXA 5LQRA 5KX5A 4DMGA 4JITA 2DQZA 1G7RA 3D59A 4KN5A 4JI5B 4EKGA 4JEIA 5I3ZA 4YGXB 2I5PO 3K5HA 1QIMA 1QIFA 4DFDA 4X6UA 2D8MA 1W49A 1X7ZA 1ZH8A 3WLEA 2BDEA 2XMCA 5BV1A 2UYGA 8GPBA 3F3YA 2AMVA 3II6X 3MGGA 1VZ3A 2IZZA 3I04A 2WJVA 2JZCA 2Z1NA 1BKSB 1LPMA 3C5HA 4LCBA 3V34A 3CF2A 4IXNA 2AYZA 1GPUA 4FN5A 2REQA 2V7QA 1QFXA 1WZIA 2I80A 3L8YA 3H1GA 2RB4A 1UQRA 1DXOA 2UXCC 2C2KA 1JJ7A 2W90A 3EIEA 4GPD1 1R0YA 1L4EA 2A5GA 3OC6A 2E6UX 2P5SA 3N8KA 3JTEA 1V1RA 5JNLA 3VPBA 1M1YE 4U9HS 1MDFA 1BD3A 1ZG3A 4N4AA 4DTIA 3NHZA 4A6DA 5A9SB 2X5JO 4Z4EA 2BVNA 2QJFA 2RGNC 3MBOA 1JDNA 5CZVA 1XRQA 2QVLA 3G2OA 3QTLA 2RH4A 4KLCA 4YRIA 3LOPA 2VNJA 5ES3A 5DNWA 3FB1A 3HNPA 1OBCA 1UZMA 3GPIA 2TMGA 3TN7A 1NR1A 4L7VA 4OQNA 4G0XA 3T6KA 5GONA 3WLNA 1UFQA 1BX3A 3IMFA 1MXAA 1ZGGA 2EWWA 5IYZA 4P3NA 4UBNA 3N2IA 5E0OA 3UFXA 3ZJ5A 2DJ5A 1HOXA 1K4KA 4LG1A 3KSRA 3G7SA 2VT7A 4HPJB 2JGDA 4RY8A 3AF5A 2ZAMA 5E9JA 5K0EA 4ODIA 1AE1A 4N5NA 4LYGA 4XD2A 1WCWA 2CJXA 3M6MD 1DX4A 3EK2A 3L0IB 1LKZA 4IHKA 2PLNA 1PSWA 4XZ3A 3JRWA 4Y2TA 4KNVA 4WFQA 1X0XA 5E4JA 1AUQA 2R2AA 1J21A 4FE7A 4CKCA 2P2YA 4YCMA 4HAUA 4LYYA 3QVSA 2XF2A 1R6BX 4WLUA 2B69A 3H2SA 4RJ2A 1EVYA 1GKYA 1SB9A 1M34A 4MVJA 3UBMA 1HLPA 1NOIA 1TU0A 3LCJA 4V03A 2P9EA 4RD3A 1I30A 3CF6R 5B4TA 1TUIA 2WD8A 3OUZA 4MCHA 5L4NA 3VC1A 1YCHA 1ZA1A 5J2UA 4R71A 3EDOA 2ZTHA 4RD1A 1ZC4A 5HIIA 4OHRA 5IJWA 1GXSB 3KT3A 5CX1B 2V7PA 3GEBA 3LU1A 5KWIA 2R4TA 4F8EA 2VK2A 5H0IA 1MAWA 4XLZA 1NYLA 1YA8A 2VDWA 1P1JA 4P32A 2AN1A 4AD8A 3PX7A 4YLYA 3QEOA 3WP0A 1C29B 2BMAA 3TKYA 4D4KA 1TYEB 1DTEA 4INAA 1QHSA 3MLBA 2WINI 3QG1A 2GWHA 2XCUA 4PX9A 3MBKA 3HGTA 2AQHA 4HDKA 4ZEOA 1E3SA 1P60A 5HFAA 2I6XA 3LC1O 4LBYA 2NPFA 1EBUA 3BUSA 4YRPA 4CT0A 1KI6B 3PDIA 4CTOA 2E8CA 2G1JA 2OG2A 5IJ9A 4ZOBA 1RRCA 4JI0C 4FYIA 1LRLA 1U0SY 2I34A 1EIZA 5KNBH 4YCBA 3NNSA 4BAZA 3ORHA 4FZVA 5IFIA 1L4FA 1EKXA 2GESA 1G8FA 1Z6XA 2XLBA 2YWHA 3M82A 4WVLA 5I48A 1W9MA 3MG9A 1JQKA 3C1UA 4GP7A 4ZRNA 1WCXA 4A5OA 1WQ1R 2J3LA 4ZJPA 3I52A 2BBTA 3N2KA 5TJHA 2Q4EA 1ZGJA 4MV4A 3H6HA 4RAQA 4JJKA 1TXGA 3N70A 3OE7D 3ISVA 2JLQA 3FYTA 2WTUA 3LGAA 5JJLA 3D5QA 2IYNA 1F7UA 3ZVNA 2E1PA 4K5QA 1RYZA 4ZIRA 2TMKA 3BTOA 3CH4B 2CJWA 4YRKA 1CZOA 3C1OA 3BHNA 3JYOA 3LHDA 5AHRA 2B1QA 2ZROA 2XIQA 3EZNA 4QFBA 3T06B 3W9YA 4EZEA 3C8HA 1HDRA 1B26A 1UK7A 5B1SA 2J46A 1W93A 4B7UA 2ZJ5A 2C9DA 1BA3A 1K5PA 2W2TA 5DO9A 4CQNA 1AMUA 1UIMA 5JNRA 1WBDA 1T2UA 5H80A 3WWOA 4RF3A 3CUSA 5LC1A 1ATZA 3QVVA 4TTQA 5CH8A 1YBMA 7ABPA 4URXR 2GXSA 2QN6A 4U6QA 1H2WA 2F8LA 4E12A 1PQUA 4W5OA 4RZXA 4DR4B 2NYAA 1UOQA 5H5JA 2ZIUB 1NP6A 3ZWQA 4Z4QA 1KR2A 2O57A 2WM8A 1LB1B 1FJHA 3MNFA 3OX2A 4FTWA 1RQRA 1A4UA 1ZHFA 1NXVA 3AI2A 4JGIA 4JQSA 4PC1A 3DM5A 3NIFB 1H4QA 3CLVA 3ZU2A 4EI7A 2JGDB 5DN9A 1N0WA 3PPXA 4I5IA 1U0EA 1YR6A 2G04A 2YZNA 3LW7A 4MV6A 4C0XA 1KQGA 3EOBI 3P2OA 2C31A 3CLTC 1A0OA 4J0QA 4WKGA 1N2EA 1I5OA 5EIWA 2Q6TA 4I6EA 1OV4A 4ZCLA 5J5AA 3TIIA 4LF4C 1WY5A 1GEEA 3TECE 4DKJA 4MMXB 4RE6A 2V97A 4GWKA 4CIXA 2VOEA 1XHLA 3WIDA 5ALSA 3DOEA 2BEVB 2VYCA 1DXYA 5IEBA 4KH0A 5GPBA 3HR7A 2YOGA 4R1NA 2FEOA 2G71A 2NG1A 1QDUA 1XDGA 4TL8A 3JASB 1JFFB 4GSYA 2W58A 3TIVA 3CCFA 5EZ6B 2HO4A 2F43A 1QYWA 2Q2WA 4NZOA 2R68A 4BMPB 3T3PB 1BOOA 5HGXA 3LFHA 5DLEA 4UHBA 3RQIA 3ZLBA 5DT9A 3T7EA 2I33A 3D7RA 1E7YA 2GN9A 3OBIA 1S2LA 4UTXA 3GW8A 3H7AA 2BFFA 1L9XA 3Q5EA 3ND6A 1A4RA 3GHHA 5U4XA 5LBIA 3H2TA 5BW6B 1PUJA 2EZ4A 3QKWA 3KUDA 5CG2A 1G20B 4C87A 4FZRA 4ECAA 1AKYA 3N2NA 3R09A 3T1YB 5D3KA 4RLSA 1JAYA 3AESB 5IDYA 2QXTA 1H4TA 5E4YA 4ACAA 1II0A 3C7TA 3NHKA 3EG9B 1FNDA 5ECYA 1JWAB 1M8JA 3I6ZA 1Z6PA 1UWDA 3SHQA 1NVVR 4BWYA 3EIOA 2EKBA 3SQMA 4BNZA 3LLCA 1JG7A 3HO1A 4JL5A 2DT8A 1YZHA 2AA3A 4RHEA 2NQ8A 1V8PA 2ASVA 1OBFO 1G9XA 1ZISA 2FWRA 1UODA 4UM5A 3TBFA 4PC7A 3HLYA 4D3DA 5AKYA 1CWUA 1Y6FA 1PU2A 2V7GA 3P4YA 2OY0A 3AYXB 2UXDC 2VKTA 2XAUA 3ZBQA 4B7CA 3CEMA 1J4AA 4LXQA 1BDMA 1T1IA 3SE7A 2XEDA 1CKEA 3CT4A 4FR0A 3TZQA 1NFRA 4ZT7A 4QVIA 5K6RA 1KAEA 1E63A 1X14A 1I8TA 5A5EA 2I99A 1KMNA 1T6YA 8LDHA 1NW7A 5IJXA 3RO7A 2KZFA 4Z7JA 2VBIA 1E2PA 1XCJA 2Z57A 4N03A 2X1LA 4JUDX 1U6IA 2XMDA 3JU3A 4I9FA 4TQGA 1IHUA 4I50B 5AUPB 3IALA 3M1AA 2XH8A 4XD7A 3ZQ6A 1IJBA 2KSQA 2VLBA 2R7KA 1TLTA 1TTQB 5IVPA 1DTWA 3DH0A 3LK6A 3C3EA 4BNGA 4O25A 3W5JA 3I61A 1BGVA 4AUKA 3QPVA 4YRBA 4M36A 1VKHA 1SWWA 4EAAA 2YXLA 3PI7A 3QELB 1K6EA 2QSYA 4MUGA 3HL4A 2VF4X 5GQSA 1FFWA 3ROFA 4YRMA 2GPJA 1Y5LA 1FSFA 3R0IA 5TVKA 4K0RA 3S2SA 4TTVA 1NI5A 4E5KA 5IF3A 2DP4E 1IQPA 2R3SA 4ZZ3A 1IUPA 1HOTA 3IIEA 2HA5A 4EUKA 1HBJA 2FKAA 4KHPB 3K5PA 4DCCA 5GY7A 4BE4A 4I4NA 4BLPA 1ZJJA 1AQYA 1E7QA 1BDJA 5ETJA 4PHFA 1QWOA 2A9OA 2VKQA 4FFWA 5FFFA 1D0VA 3TE6A 3V8RA 5BNIA 5DNUA 4UKDA 2C97A 4RTPA 1Y9AA 2RFLA 4WY5A 5B3KA 2BFNA 1RYFA 5SY9A 4WECA 5J1SB 1BS1A 1NJFA 2E4ZA 2O7RA 2FPRA 1OXTA 4ZREA 1X9IA 1IEXA 3CTMA 2H51A 3ETOA 4FHZA 4PZZA 2QG6A 3IAS6 4IKOA 2VLIA 2MMGA 3BJMA 1KSJA 2IELA 3BAFA 4HRAA 4M1QA 3O8RA 1ADBA 4IJVA 3RSLA 1YS7A 5IFKA 5IWCA 3VDNB 2ZRKA 4OSEA 1QQTA 1UINA 4FOTA 2AYAA 2QAGB 4R68A 3HJTA 2Z9DA 2I7DA 4JU8A 2Q5HA 5HOEA 3K2IA 2NM0A 1E6WA 3LXXA 4BBAA 2FEMA 3QEAZ 1XCLA 4OLFA 2RGRA 4MVJG 4QT4A 5LLSA 1KZ6A 3K0BA 2R1TB 4JOSA 4IGKA 1ULHA 1NC3A 2WJYA 2I4LA 4PVDA 3HC7A 2I7CA 3IH5A 1S4MA 3KSUA 3RTEA 2DYJA 3W8RA 2CCGA 4GPZA 2G6BA 3IT2A 2Q6VA 3LK7A 4OH7A 4PFJA 1D8TA 2YR0A 1ZRSA 4P2GA 2QSJA 1WMDA 4TKZA 2JJ1A 1E6EA 2XT0A 5JXHA 2V0GA 1J49A 1ZH0A 4WDQA 2TSYB 5E1MA 4CQMD 4ZO4A 2W48A 4ED9A 3GRUA 2TRSB 3W05A 1YIOA 1EFRA 1OXVA 1E2QA 2RK6A 3ITDA 3K31A 1P9OA 3C6MA 1TEZA 4II2A 1Z5UA 2NP6A 1P3Y1 1IN4A 1I94B 4L6AA 3RB8A 1ZWKA 3AK4A 1W7AA 3R8XA 1GL6A 2V5AA 3ZE6A 2PNFA 1BGWA 1XE3A 1FXWA 1NSYA 5DM60 3I39X 4MRNA 2GDJA 3QFTA 5J63A 1WG8A 3FMFA 2IHUA 3HY3A 1DXQA 1TQDA 3K32A 3R3HA 4CVNA 5HIAA 1ZRMA 3A9WA 2X1HA 5TC4A 1NNLA 4NQRA 1HX7A 3KPJA 2WWVD 1BS2A 3TVTA 3RK0A 3NWBA 2BDTA 1X8JA 1FS6A 3L79A 4LN1A 1PP4A 1Y8ZA 1A7JA 1E1KA 3S2UA 2FNAA 2FMXA 4EHKA 1OVGA 4Z3KA 4IX1A 4CMKA 1RYYA 1O95C 5L6LB 2X5KO 4QASA 3ZU4A 1UP7A 4QA9A 4EG4A 1JB1A 3KDPA 1EINA 4TM8A 4Y9RA 2CSXA 1C7FA 3WS7A 1WKCA 4RANA 3RUHA 5EJ2A 2HUNA 4BP3A 2FQ1A 3IUMA 5CDTA 1XPOA 1PX2A 2XYVA 3DC2A 3DPSA 4AF8A 5EP2A 1PTJA 4BGIA 8ATCA 1GQ2A 4XDZA 4ER0A 1SQFA 2EXXA 4YAKA 4NZZA 2ZJ1A 5BRNA 4C4ZA 3BORA 1FDRA 3QYJA 1K8YB 4FHCA 4WNCA 1UL1X 5AW8A 2FPPA 2XNDD 2DVMA 4FHGA 3Q3EA 1OIVA 2WHRA 3OMLA 4D5EA 4I1PA 1FQWA 1SULA 1W4CA 3TW8A 4C5CA 5AVVA 5JOQA 2JMPA 4NU5A 5HA5A 3T1YC 2CDNA 2UUOA 1RCTE 3PGA1 4LA4A 5DCUA 4EITA 1Z4NA 1QVVA 1JDSA 2ECPA 3JQAB 1KAQA 3Q10A 2M1XA 4KLZA 4OMUA 4W82A 1FDIA 2HMWA 2E7GA 2DF8A 3GT4A 3PC8A 4II7A 4L2ZA 1OLUB 4NV0A 4PZLA 3V8BA 5CA1F 4KPYA 4XLLA 1SURA 2NO4A 4V24A 4QBIA 4Z0HO 1FVHA 1GTL1 3GD7A 5FL7A 5HTOA 2IYLD 3DDHA 2IT1A 3MIZA 5CGQB 4DCMA 2NADA 3IE0A 4JYPA 2VHVA 2CNDA 1KHHA 3P2IA 1ZIOA 2WD7A 4NPCA 4B35A 3A3KA 3WO0A 4JC5A 2B7BA 3IVGA 3OOEA 4N5IX 1UBMS 4DVGA 3D6AA 5IVHA 5FR2A 3U7QA 3HHPA 3GYGA 1IOVA 1IEWA 4OP2A 1JAZA 3QNMA 1YJBA 1N7JA 3WGIA 4AAYA 3UV7A 1H8EA 3QVOA 1OB5A 3LNVA 4EFKA 2GD1O 4Q1FA 1ZU5A 1SR8A 1LV8A 3SIXA 1OYYA 2DTXA 1UDWA 4JLJA 5CJ2A 1TMYA 1VJ5A 2OO5A 3RBVA 5DHUA 2LTAA 3TSOA 2QQFA 3C6KA 1BHSA 3OJLA 4LBZA 4W6ZA 4QODA 2JJ1D 2KHZA 1OLSB 1KXJA 1X3SA 1E60A 1EFCA 2PL9A 2TMDA 2C5FA 4WSOA 2OCPA 1KH3A 3W8DA 1YA4A 3DZBA 2FRVA 3NPMA 4A2PA 3LZDA 2VP6A 1FDSA 1V7PC 2QE6A 2R8PA 2WP0A 2ZR9A 5TGZA 2O07A 4XFKA 3VAAA 3JAMD 2GLXA 3EA4A 4BNLA 3GMSA 3C70A 3K9BA 1M2VB 2RGGA 1G8SA 3AFIA 3G68A 1H1LB 3H5WA 3MWDA 4RPGA 5DSTA 4NCBA 3A4YA 2R7AA 1YZFA 1I5EA 1UKBA 4U7TB 3KJXA 1EK6A 2GAFA 1PDWA 1ZLXA 1WMFA 1II8B 3O38A 1O93A 2XF8A 2X0IA 3JWPA 4RKYA 4NMHA 3IVCA 5BN3B 5FIUA 2FY8A 3MT7A 1N5KA 2QPLA 4KI0A 1XMPA 1JHPA 8MHTA 1WHTA 3NOOA 4TRJA 4J7UA 4G1FA 1MPTA 1KEZA 3ICPA 1TKAA 2XVZA 4YXFA 1G6HA 1ORTA 2XCRB 2AFHB 4IG9A 3GZTB 1CB7A 5F4ZA 5CVTA 2VTDA 1R8JA 2WTXA 3KCQA 3VDXA 2A5FA 4DJEC 4UU0A 1QMPA 3U4MA 1JIIA 1ZKDA 1F2DA 5KINB 1Z7YA 3R3WA 4L4RA 5TMPA 1E9CA 2ETVA 4A2QA 4DOMA 4Y7CA 1SVKA 5T3UA 4OI4A 1TVMA 1NNI1 1GL9B 2XAAA 3MINA 4PBRA 4AJ2A 4QDKA 1WWKA 4H3HB 1TMKA 4ZVLA 3M6IA 5KOHB 1JILA 4XLTA 5IT9D 2ZVJA 3CN9A 4PUHA 3ADDA 2CCKA 4PX5A 5JJCA 3HWSA 4JLMA 3A6ZA 3OPNA 4CLOA 4JJ6A 1Y34E 1N2XA 3ASZA 5BW4A 2B94A 2HCJB 3BQMB 2X15A 2HBZA 1CIVA 3UK2A 1IH8A 3R77A 3TW0A 5BSWA 1RLTA 5AXDA 1XMQC 2QTTA 1ZCZA 3N3AC 3QW2A 3V8MA 2WWXA 1C1DB 3CCBA 3HWX1 3EODA 2GCOB 1XN1A 3RAGA 3F2VA 1EA7A 3AY3A 3PD1A 4UU8A 4GGPA 4S12A 2YJ3A 3N05A 3OJ0A 4L9WA 3A6EA 2Q3BA 4F97A 5BMOA 4BFCA 1EWKA 4LJ5A 4FD2A 4OFWA 3PPVA 4I4TF 5EJMA 5H02A 1JR6A 1PZFA 1K8QA 1YBFA 1WB5A 1WU7A 4F11A 2XDQB 1EXDA 2B92A 3JZMA 1P0QA 2PO7A 5JAZA 2CT8A 4LF5C 1RWQA 2C78A 3VRHA 3B7WA 3SZ3A 1YH3A 3FVQA 1KEEB 1RY2A 4J76A 3T7RA 4CMAA 7REQB 2V45A 4FHEA 1CUAA 1PW7A 1TZKA 3A2MA 2QTGA 4M1ZA 3W90A 4YRNA 5ITZA 1KVRA 4DYVA 5BSFA 3HDHA 3SJAA 4KAJA 2F1HA 2A9RA 3WHIA 3EZ2A 4BMNA 4F5EA 4YMTA 3E7FA 2LZ0A 4B74A 1T9DA 3C3WA 4G4SO 1CR4A 1NM5C 4V39A 4C0AC 3E3AA 1TFUA 4M1WA 4LGYA 3C14C 3FHJA 5AM2A 1WPXA 4AUMA 3NHAA 1RR6A 3OHPA 3F7OA 2R11A 1CZRA 3NBFA 3HSYA 2I6TA 2YH2A 2DPYA 2Q9CA 2N1BA 4UATA 421PA 5JXWA 4MZDA 3HU3A 3UXHA 2BAGA