1MXCA

S-adenosylmethionine synthetase with 8-br-adp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
total genus 129
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA01
1MXBA 3SO4A 2YWCA 4LE5A 4ODJA 3UOWA 4L2ZA 1MXAA 4NDNA 4K0BA 1XRBA 3TDEA 1O90A 1XRAA 2P02A 5H9UA 4L7IA 3RV2A 1O93A 1P7LA 3A4IA 4L4QA 4KTTA 5A1IA 2OBVA 1O9TA 1GPMA 5T8SA 1O92A 4HPVA 5T8TA 1FUGA 2DPLA 1QM4A 3S82A 1RG9A 1XRCA 5A1GA 4KTVA 1MXCA 3TQIA 3IMLA 2YWBA 4WS9A 5A19A
chains in the Genus database with same CATH superfamily
4NDNA 1O90A 1HR0C 2CU6A 1UKKA 1RY2A 5BURA 4BC9A 2HHHC 4MH4A 1M6XC 4R1MA 4GXQA 3J80D 3G7SA 3GKUA 2ZM6C 5CZXA 3VNRA 2D7VA 2YX1A 3CQ2A 3GR1A 1XRCA 1WH9A 3TQIA 4NOZA 1XNQC 1ZB8A 4XX2A 4LFAC 3SO4A 2WP0C 4WV3A 3R9WA 1P4EA 1HNXC 5K8FA 1XRAA 2P2MA 2VQEC 5FLXD 1J5EC 4L4QA 4DV4C 4JI8C 2PROA 1GPMA 4ZJZA 4AQYC 2KZFA 2YCBA 5T8SA 4JI0C 2ONFA 5JRHA 2HJGA 1PG4A 4DV2C 2UUAC 1NYEA 2P20A 3R9XA 1N2FA 4X66C 1ML8A 5IWAC 3DAYA 1N32C 1MKYA 4RLQA 3TUFA 2EGTA 1NY8A 3E7WA 3EQ6A 3KXWA 3TR3A 4X62C 1HNZC 4B3SC 2V7BA 5DV9A 4JI6C 4IR7A 2VZEA 4DR2C 5IT9D 1EGAA 1LQLA 4DR6C 3ETCA 2D28C 4L2ZA 4PUIA 4DUYC 4OX9C 3JAMD 1P7LA 1USPB 4KTTA 3ETOA 2KZ0A 3A9VA 3CW8X 2PT7G 4JM1A 1XNRC 5T8TA 5KYTA 4PHTA 5E7QA 2Z51A 2E8EA 2WD9A 2F4VC 2DYJA 5ADZA 4DCUA 4LFBC 4DV7C 2D1QA 5CZVA 3I07A 1HH2P 2VQFC 2M5HA 4PUGA 4DG9A 2D27A 4HPVA 4D4IA 2CY1A 4DV6C 4GKKC 5BSUA 4D4GA 3PROC 4WS9A 5KEIA 5A19A 3DHVA 2YWCA 2ASBA 3UEBA 1XRBA 4FUQA 2P02A 5H9UA 2OPLB 4ZLPA 5A2QD 4K0KC 2KDNA 1BA3A 1PG3A 3LUSA 4JI5C 5A1GA 1P4EC 3N2QA 2JMPA 2D1TA 5BR8C 1MXBA 4LF4C 3LNOA 1ULTA 4RVNA 4EATA 5BUQA 2QW0X 5A1IA 4BC7A 4JI1C 1XS3A 2UXDC 3LAXA 4DR4C 1M6XA 1QM4A 3DLPX 1VLAA 5LCIA 4PZPA 3O2EA 1IB8A 2BH1X 5BSTA 4DCTA 1V25A 3B7WA 4DR5C 3K6RA 3T1YC 1O93A 4B3TC 4LF5C 2P2JA 2P2BA 3A25A 3AF6A 4JI3C 4U5YD 1MD9A 1N33C 1K0RA 3H2TA 4DR7C 2MMAB 2VSQA 2NCLA 3EERA 1FJGC 3CQ1A 4RM2A 3L8CA 4DCSA 4ODJA 1I94C 4YHHC 2Y4NA 1KKGA 4BBYA 3A9UA 4RM3A 3GPCA 3N54B 3PBKA 2E7GA 5KYVA 2QL8A 4DV0C 4BSZA 1HNWC 3GR0A 5IFIA 1RG9A 3PESA 1TH5A 3C5EA 5K85A 2PN2A 2P2FA 3CJEA 3OTOC 3L95X 4L7IA 4JI2C 3IEVA 4LFCC 4JV5C 4DR1C 4ISBA 2ATWA 2QVZX 1QWIA 3IPLA 2D1SA 4KHPC 3TDEA 1PA4A 4TPSB 5BSRA 3UOWA 4GXRA 4DUZC 4K0BA 1V26A 4OXIA 1N36C 4MTNA 2UU9C 1AMUA 1MDBA 4DG8A 2ZZMA 1FUGA 4DV1C 1LCIA 2AYAA 4PROC 1UWDA 4X65C 2Y27A 5AE3A 4LF9C 1WCJA 4R1LA 1XMOC 4B3MC 2JNVA 4LF8C 2OBVA 4RLFA 1IBMC 1XHJA 4DV5C 4G36A 5AE2A 2DPLA 4NXMC 3NYQA 1IBKC 3FCCA 1USPA 5BSWA 3IEUA 2E8CA 1JOSA 3J81D 4LE5A 3RG2A 1T5HX 4G37A 3RV2A 1V60A 4YY3C 2D1RA 4I9GA 4LF7C 1YJ7A 1L2FA 4FUTA 3VNSA 3S82A 3NI2A 2CXCA 5BSVA 1N34C 4OYCA 5LMNC 2P2QA 4GKJC 1PU1A 2E5LC 3I08A 1XMQC 4R0MA 4PUHA 1MDFA 3E7XA 5AE1A 4B3RC 4NXNC 3AY0A 4JI4C 2OPLA 5BSMA 3UZ0A 2M5OA 2UUBC 3AF5A 4JI7C 1VEHA 2BJOA 4DR3C 2QVYX 2E0GA 2XR1A 1IBLC 3NPDA 1O9TA 3CW9A 4D57A 4DCVA 2OO4A 1O92A 3UX2A 4G1IA 4D56A 4JYAC 3UX3A 4RMNA 2DHMA 3A26A 4RVOA 3NYRA 2UXCC 3CQ3A 1ZB9A 3IMLA 4BCAA 1WF3A 2YWBA 3LNVA 4DV3C 2ZZNA 3VNQA 2QVXX 1MXAA 3R44A 1FLOA 4FTFA 2MM9A 4X64C 4I9FA 3A4IA 3FCEA 2MCQA 4LF6C 5GTDA 3LGXA 5BUSA 2E8FA 3T1HC 5LMUC 2UXBC 4IZ6A 2Y4OA 1T5DX 4KTVA 1MXCA 2UUCC 4GS5A
chains in the Genus database with same CATH topology
4NDNA 1O90A 1HR0C 1UKKA 1RY2A 5BURA 4BC9A 2HHHC 4MH4A 4R1MA 4GXQA 3J80D 3G7SA 3GKUA 2ZM6C 5CZXA 3VNRA 2D7VA 3GR1A 1XRCA 1WH9A 3TQIA 4NOZA 1XNQC 1ZB8A 4XX2A 4LFAC 3SO4A 2WP0C 4WV3A 3R9WA 1HNXC 5K8FA 1XRAA 2P2MA 2VQEC 5FLXD 1J5EC 4L4QA 4DV4C 4JI8C 2PROA 1GPMA 4ZJZA 4AQYC 2KZFA 2YCBA 5T8SA 4JI0C 2ONFA 5JRHA 2HJGA 1PG4A 4DV2C 2UUAC 1NYEA 2P20A 3R9XA 1N2FA 4X66C 1ML8A 5IWAC 3DAYA 1N32C 1MKYA 4RLQA 3TUFA 2EGTA 3E7WA 3EQ6A 3KXWA 4X62C 1HNZC 4B3SC 2V7BA 5DV9A 4JI6C 4IR7A 2VZEA 4DR2C 5IT9D 1EGAA 1LQLA 4DR6C 3ETCA 2D28C 4L2ZA 4DUYC 4OX9C 3JAMD 1P7LA 1USPB 4KTTA 3ETOA 3A9VA 3CW8X 4JM1A 2PT7G 1XNRC 5T8TA 5KYTA 4PHTA 5E7QA 2E8EA 2WD9A 2F4VC 2DYJA 5ADZA 4DCUA 4LFBC 4DV7C 2D1QA 5CZVA 3I07A 1HH2P 2VQFC 4DG9A 2D27A 4HPVA 4D4IA 2CY1A 4DV6C 4GKKC 5BSUA 4D4GA 3PROC 4WS9A 5KEIA 5A19A 3DHVA 2YWCA 2ASBA 1XRBA 4FUQA 2P02A 5H9UA 2OPLB 4ZLPA 5A2QD 4K0KC 1BA3A 1PG3A 3LUSA 4JI5C 5A1GA 3N2QA 2JMPA 2D1TA 5BR8C 1MXBA 4LF4C 1ULTA 4RVNA 4EATA 5BUQA 2QW0X 5A1IA 4BC7A 4JI1C 2UXDC 3LAXA 4DR4C 1QM4A 3DLPX 1VLAA 4PZPA 2BH1X 5BSTA 4DCTA 1V25A 3B7WA 4DR5C 3T1YC 1O93A 4B3TC 4LF5C 2P2JA 2P2BA 3AF6A 4JI3C 4U5YD 1MD9A 1N33C 1K0RA 3H2TA 4DR7C 2VSQA 3EERA 1FJGC 4RM2A 3L8CA 4DCSA 4ODJA 1I94C 4YHHC 2Y4NA 1KKGA 4BBYA 3A9UA 4RM3A 3GPCA 3N54B 3PBKA 2E7GA 5KYVA 2QL8A 4DV0C 4BSZA 1HNWC 3GR0A 5IFIA 1RG9A 3PESA 3C5EA 5K85A 2PN2A 2P2FA 3CJEA 3OTOC 3L95X 4L7IA 4JI2C 3IEVA 4LFCC 4JV5C 4DR1C 4ISBA 2ATWA 2QVZX 1QWIA 3IPLA 2D1SA 4KHPC 3TDEA 1PA4A 4TPSB 5BSRA 3UOWA 4GXRA 4DUZC 4K0BA 1V26A 4OXIA 1N36C 4MTNA 2UU9C 1AMUA 1MDBA 4DG8A 1FUGA 4DV1C 1LCIA 2AYAA 4PROC 4X65C 2Y27A 5AE3A 4LF9C 4R1LA 1XMOC 4B3MC 4LF8C 2OBVA 4RLFA 1IBMC 4DV5C 4G36A 5AE2A 2DPLA 4NXMC 3NYQA 1IBKC 3FCCA 1USPA 5BSWA 3IEUA 2E8CA 1JOSA 3J81D 4LE5A 3RG2A 1T5HX 4G37A 3RV2A 4YY3C 2D1RA 4I9GA 4LF7C 1YJ7A 1L2FA 4FUTA 3VNSA 3S82A 3NI2A 2CXCA 5BSVA 1N34C 4OYCA 5LMNC 2P2QA 4GKJC 2E5LC 3I08A 1XMQC 4R0MA 1MDFA 3E7XA 5AE1A 4B3RC 4NXNC 4JI4C 2OPLA 5BSMA 3UZ0A 2UUBC 3AF5A 4JI7C 4DR3C 2BJOA 2QVYX 2E0GA 2XR1A 1IBLC 3NPDA 1O9TA 3CW9A 4D57A 2OO4A 4DCVA 1O92A 4G1IA 4D56A 4JYAC 4RMNA 4RVOA 3NYRA 2UXCC 1ZB9A 3IMLA 4BCAA 1WF3A 2YWBA 3LNVA 4DV3C 3VNQA 2QVXX 1MXAA 3R44A 4FTFA 4X64C 4I9FA 3A4IA 3FCEA 4LF6C 5GTDA 3LGXA 5BUSA 2E8FA 3T1HC 5LMUC 2UXBC 4IZ6A 2Y4OA 1T5DX 4KTVA 1MXCA 2UUCC 4GS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXB A;  3SO4 A;  2YWC A;  4LE5 A;  4ODJ A;  3UOW A;  4L2Z A;  1MXA A;  4NDN A;  4K0B A;  1XRB A;  3TDE A;  1O90 A;  1XRA A;  2P02 A;  5H9U A;  4L7I A;  3RV2 A;  1O93 A;  1P7L A;  3A4I A;  4L4Q A;  4KTT A;  5A1I A;  2OBV A;  1O9T A;  1GPM A;  5T8S A;  1O92 A;  4HPV A;  5T8T A;  1FUG A;  2DPL A;  1QM4 A;  3S82 A;  1RG9 A;  1XRC A;  5A1G A;  4KTV A;  1MXC A;  3TQI A;  3IML A;  2YWB A;  4WS9 A;  5A19 A; 
#chains in the Genus database with same CATH topology
 4NDN A;  1O90 A;  1HR0 C;  2CU6 A;  1UKK A;  1RY2 A;  5BUR A;  4BC9 A;  2HHH C;  4MH4 A;  1M6X C;  4R1M A;  4GXQ A;  3J80 D;  3G7S A;  3GKU A;  2ZM6 C;  5CZX A;  3VNR A;  2D7V A;  2YX1 A;  3CQ2 A;  3GR1 A;  1XRC A;  1WH9 A;  3TQI A;  4NOZ A;  1XNQ C;  1ZB8 A;  4XX2 A;  4LFA C;  3SO4 A;  2WP0 C;  4WV3 A;  3R9W A;  1P4E A;  1HNX C;  5K8F A;  1XRA A;  2P2M A;  2VQE C;  5FLX D;  1J5E C;  4L4Q A;  4DV4 C;  4JI8 C;  2PRO A;  1GPM A;  4ZJZ A;  4AQY C;  2KZF A;  2YCB A;  5T8S A;  4JI0 C;  2ONF A;  5JRH A;  2HJG A;  1PG4 A;  4DV2 C;  2UUA C;  1NYE A;  2P20 A;  3R9X A;  1N2F A;  4X66 C;  1ML8 A;  5IWA C;  3DAY A;  1N32 C;  1MKY A;  4RLQ A;  3TUF A;  2EGT A;  1NY8 A;  3E7W A;  3EQ6 A;  3KXW A;  3TR3 A;  4X62 C;  1HNZ C;  4B3S C;  2V7B A;  5DV9 A;  4JI6 C;  4IR7 A;  2VZE A;  4DR2 C;  5IT9 D;  1EGA A;  1LQL A;  4DR6 C;  3ETC A;  2D28 C;  4L2Z A;  4PUI A;  4DUY C;  4OX9 C;  3JAM D;  1P7L A;  1USP B;  4KTT A;  3ETO A;  2KZ0 A;  3A9V A;  3CW8 X;  2PT7 G;  4JM1 A;  1XNR C;  5T8T A;  5KYT A;  4PHT A;  5E7Q A;  2Z51 A;  2E8E A;  2WD9 A;  2F4V C;  2DYJ A;  5ADZ A;  4DCU A;  4LFB C;  4DV7 C;  2D1Q A;  5CZV A;  3I07 A;  1HH2 P;  2VQF C;  2M5H A;  4PUG A;  4DG9 A;  2D27 A;  4HPV A;  4D4I A;  2CY1 A;  4DV6 C;  4GKK C;  5BSU A;  4D4G A;  3PRO C;  4WS9 A;  5KEI A;  5A19 A;  3DHV A;  2YWC A;  2ASB A;  3UEB A;  1XRB A;  4FUQ A;  2P02 A;  5H9U A;  2OPL B;  4ZLP A;  5A2Q D;  4K0K C;  2KDN A;  1BA3 A;  1PG3 A;  3LUS A;  4JI5 C;  5A1G A;  1P4E C;  3N2Q A;  2JMP A;  2D1T A;  5BR8 C;  1MXB A;  4LF4 C;  3LNO A;  1ULT A;  4RVN A;  4EAT A;  5BUQ A;  2QW0 X;  5A1I A;  4BC7 A;  4JI1 C;  1XS3 A;  2UXD C;  3LAX A;  4DR4 C;  1M6X A;  1QM4 A;  3DLP X;  1VLA A;  5LCI A;  4PZP A;  3O2E A;  1IB8 A;  2BH1 X;  5BST A;  4DCT A;  1V25 A;  3B7W A;  4DR5 C;  3K6R A;  3T1Y C;  1O93 A;  4B3T C;  4LF5 C;  2P2J A;  2P2B A;  3A25 A;  3AF6 A;  4JI3 C;  4U5Y D;  1MD9 A;  1N33 C;  1K0R A;  3H2T A;  4DR7 C;  2MMA B;  2VSQ A;  2NCL A;  3EER A;  1FJG C;  3CQ1 A;  4RM2 A;  3L8C A;  4DCS A;  4ODJ A;  1I94 C;  4YHH C;  2Y4N A;  1KKG A;  4BBY A;  3A9U A;  4RM3 A;  3GPC A;  3N54 B;  3PBK A;  2E7G A;  5KYV A;  2QL8 A;  4DV0 C;  4BSZ A;  1HNW C;  3GR0 A;  5IFI A;  1RG9 A;  3PES A;  1TH5 A;  3C5E A;  5K85 A;  2PN2 A;  2P2F A;  3CJE A;  3OTO C;  3L95 X;  4L7I A;  4JI2 C;  3IEV A;  4LFC C;  4JV5 C;  4DR1 C;  4ISB A;  2ATW A;  2QVZ X;  1QWI A;  3IPL A;  2D1S A;  4KHP C;  3TDE A;  1PA4 A;  4TPS B;  5BSR A;  3UOW A;  4GXR A;  4DUZ C;  4K0B A;  1V26 A;  4OXI A;  1N36 C;  4MTN A;  2UU9 C;  1AMU A;  1MDB A;  4DG8 A;  2ZZM A;  1FUG A;  4DV1 C;  1LCI A;  2AYA A;  4PRO C;  1UWD A;  4X65 C;  2Y27 A;  5AE3 A;  4LF9 C;  1WCJ A;  4R1L A;  1XMO C;  4B3M C;  2JNV A;  4LF8 C;  2OBV A;  4RLF A;  1IBM C;  1XHJ A;  4DV5 C;  4G36 A;  5AE2 A;  2DPL A;  4NXM C;  3NYQ A;  1IBK C;  3FCC A;  1USP A;  5BSW A;  3IEU A;  2E8C A;  1JOS A;  3J81 D;  4LE5 A;  3RG2 A;  1T5H X;  4G37 A;  3RV2 A;  1V60 A;  4YY3 C;  2D1R A;  4I9G A;  4LF7 C;  1YJ7 A;  1L2F A;  4FUT A;  3VNS A;  3S82 A;  3NI2 A;  2CXC A;  5BSV A;  1N34 C;  4OYC A;  5LMN C;  2P2Q A;  4GKJ C;  1PU1 A;  2E5L C;  3I08 A;  1XMQ C;  4R0M A;  4PUH A;  1MDF A;  3E7X A;  5AE1 A;  4B3R C;  4NXN C;  3AY0 A;  4JI4 C;  2OPL A;  5BSM A;  3UZ0 A;  2M5O A;  2UUB C;  3AF5 A;  4JI7 C;  1VEH A;  2BJO A;  4DR3 C;  2QVY X;  2E0G A;  2XR1 A;  1IBL C;  3NPD A;  1O9T A;  3CW9 A;  4D57 A;  4DCV A;  2OO4 A;  1O92 A;  3UX2 A;  4G1I A;  4D56 A;  4JYA C;  3UX3 A;  4RMN A;  2DHM A;  3A26 A;  4RVO A;  3NYR A;  2UXC C;  3CQ3 A;  1ZB9 A;  3IML A;  4BCA A;  1WF3 A;  2YWB A;  3LNV A;  4DV3 C;  2ZZN A;  3VNQ A;  2QVX X;  1MXA A;  3R44 A;  1FLO A;  4FTF A;  2MM9 A;  4X64 C;  4I9F A;  3A4I A;  3FCE A;  2MCQ A;  4LF6 C;  5GTD A;  3LGX A;  5BUS A;  2E8F A;  3T1H C;  5LMU C;  2UXB C;  4IZ6 A;  2Y4O A;  1T5D X;  4KTV A;  1MXC A;  2UUC C;  4GS5 A; 
#chains in the Genus database with same CATH homology
 4NDN A;  1O90 A;  1HR0 C;  1UKK A;  1RY2 A;  5BUR A;  4BC9 A;  2HHH C;  4MH4 A;  4R1M A;  4GXQ A;  3J80 D;  3G7S A;  3GKU A;  2ZM6 C;  5CZX A;  3VNR A;  2D7V A;  3GR1 A;  1XRC A;  1WH9 A;  3TQI A;  4NOZ A;  1XNQ C;  1ZB8 A;  4XX2 A;  4LFA C;  3SO4 A;  2WP0 C;  4WV3 A;  3R9W A;  1HNX C;  5K8F A;  1XRA A;  2P2M A;  2VQE C;  5FLX D;  1J5E C;  4L4Q A;  4DV4 C;  4JI8 C;  2PRO A;  1GPM A;  4ZJZ A;  4AQY C;  2KZF A;  2YCB A;  5T8S A;  4JI0 C;  2ONF A;  5JRH A;  2HJG A;  1PG4 A;  4DV2 C;  2UUA C;  1NYE A;  2P20 A;  3R9X A;  1N2F A;  4X66 C;  1ML8 A;  5IWA C;  3DAY A;  1N32 C;  1MKY A;  4RLQ A;  3TUF A;  2EGT A;  3E7W A;  3EQ6 A;  3KXW A;  4X62 C;  1HNZ C;  4B3S C;  2V7B A;  5DV9 A;  4JI6 C;  4IR7 A;  2VZE A;  4DR2 C;  5IT9 D;  1EGA A;  1LQL A;  4DR6 C;  3ETC A;  2D28 C;  4L2Z A;  4DUY C;  4OX9 C;  3JAM D;  1P7L A;  1USP B;  4KTT A;  3ETO A;  3A9V A;  3CW8 X;  4JM1 A;  2PT7 G;  1XNR C;  5T8T A;  5KYT A;  4PHT A;  5E7Q A;  2E8E A;  2WD9 A;  2F4V C;  2DYJ A;  5ADZ A;  4DCU A;  4LFB C;  4DV7 C;  2D1Q A;  5CZV A;  3I07 A;  1HH2 P;  2VQF C;  4DG9 A;  2D27 A;  4HPV A;  4D4I A;  2CY1 A;  4DV6 C;  4GKK C;  5BSU A;  4D4G A;  3PRO C;  4WS9 A;  5KEI A;  5A19 A;  3DHV A;  2YWC A;  2ASB A;  1XRB A;  4FUQ A;  2P02 A;  5H9U A;  2OPL B;  4ZLP A;  5A2Q D;  4K0K C;  1BA3 A;  1PG3 A;  3LUS A;  4JI5 C;  5A1G A;  3N2Q A;  2JMP A;  2D1T A;  5BR8 C;  1MXB A;  4LF4 C;  1ULT A;  4RVN A;  4EAT A;  5BUQ A;  2QW0 X;  5A1I A;  4BC7 A;  4JI1 C;  2UXD C;  3LAX A;  4DR4 C;  1QM4 A;  3DLP X;  1VLA A;  4PZP A;  2BH1 X;  5BST A;  4DCT A;  1V25 A;  3B7W A;  4DR5 C;  3T1Y C;  1O93 A;  4B3T C;  4LF5 C;  2P2J A;  2P2B A;  3AF6 A;  4JI3 C;  4U5Y D;  1MD9 A;  1N33 C;  1K0R A;  3H2T A;  4DR7 C;  2VSQ A;  3EER A;  1FJG C;  4RM2 A;  3L8C A;  4DCS A;  4ODJ A;  1I94 C;  4YHH C;  2Y4N A;  1KKG A;  4BBY A;  3A9U A;  4RM3 A;  3GPC A;  3N54 B;  3PBK A;  2E7G A;  5KYV A;  2QL8 A;  4DV0 C;  4BSZ A;  1HNW C;  3GR0 A;  5IFI A;  1RG9 A;  3PES A;  3C5E A;  5K85 A;  2PN2 A;  2P2F A;  3CJE A;  3OTO C;  3L95 X;  4L7I A;  4JI2 C;  3IEV A;  4LFC C;  4JV5 C;  4DR1 C;  4ISB A;  2ATW A;  2QVZ X;  1QWI A;  3IPL A;  2D1S A;  4KHP C;  3TDE A;  1PA4 A;  4TPS B;  5BSR A;  3UOW A;  4GXR A;  4DUZ C;  4K0B A;  1V26 A;  4OXI A;  1N36 C;  4MTN A;  2UU9 C;  1AMU A;  1MDB A;  4DG8 A;  1FUG A;  4DV1 C;  1LCI A;  2AYA A;  4PRO C;  4X65 C;  2Y27 A;  5AE3 A;  4LF9 C;  4R1L A;  1XMO C;  4B3M C;  4LF8 C;  2OBV A;  4RLF A;  1IBM C;  4DV5 C;  4G36 A;  5AE2 A;  2DPL A;  4NXM C;  3NYQ A;  1IBK C;  3FCC A;  1USP A;  5BSW A;  3IEU A;  2E8C A;  1JOS A;  3J81 D;  4LE5 A;  3RG2 A;  1T5H X;  4G37 A;  3RV2 A;  4YY3 C;  2D1R A;  4I9G A;  4LF7 C;  1YJ7 A;  1L2F A;  4FUT A;  3VNS A;  3S82 A;  3NI2 A;  2CXC A;  5BSV A;  1N34 C;  4OYC A;  5LMN C;  2P2Q A;  4GKJ C;  2E5L C;  3I08 A;  1XMQ C;  4R0M A;  1MDF A;  3E7X A;  5AE1 A;  4B3R C;  4NXN C;  4JI4 C;  2OPL A;  5BSM A;  3UZ0 A;  2UUB C;  3AF5 A;  4JI7 C;  4DR3 C;  2BJO A;  2QVY X;  2E0G A;  2XR1 A;  1IBL C;  3NPD A;  1O9T A;  3CW9 A;  4D57 A;  2OO4 A;  4DCV A;  1O92 A;  4G1I A;  4D56 A;  4JYA C;  4RMN A;  4RVO A;  3NYR A;  2UXC C;  1ZB9 A;  3IML A;  4BCA A;  1WF3 A;  2YWB A;  3LNV A;  4DV3 C;  3VNQ A;  2QVX X;  1MXA A;  3R44 A;  4FTF A;  4X64 C;  4I9F A;  3A4I A;  3FCE A;  4LF6 C;  5GTD A;  3LGX A;  5BUS A;  2E8F A;  3T1H C;  5LMU C;  2UXB C;  4IZ6 A;  2Y4O A;  1T5D X;  4KTV A;  1MXC A;  2UUC C;  4GS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...