1MXCA

S-adenosylmethionine synthetase with 8-br-adp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
total genus 129
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA01
3UOWA 1XRAA 3TQIA 4KTVA 4L4QA 1O93A 3S82A 3SO4A 1P7LA 4HPVA 2YWCA 1MXCA 1XRCA 5H9UA 1QM4A 2DPLA 1RG9A 1MXBA 1MXAA 3RV2A 1GPMA 4NDNA 3A4IA 5T8SA 4L2ZA 5A19A 4KTTA 5A1IA 1FUGA 4K0BA 5T8TA 3TDEA 5A1GA 2P02A 1O92A 2OBVA 1O9TA 4WS9A 3IMLA 4ODJA 1O90A 2YWBA 4LE5A 4L7IA 1XRBA
chains in the Genus database with same CATH superfamily
2P2FA 5BSVA 3EQ6A 1UWDA 2QL8A 4PROC 4LF7C 3E7WA 4I9FA 4DG9A 4BCAA 3ETOA 1AMUA 4IZ6A 4X65C 3J81D 4RLQA 1T5HX 3CW9A 3AY0A 3UX2A 4PZPA 3AF6A 1IBLC 1NYEA 5IT9D 1XMQC 4I9GA 4B3RC 3LNVA 4DR6C 3CQ3A 4DR1C 2JMPA 1XHJA 4LFAC 4JI7C 1P7LA 5BSRA 2AYAA 3AF5A 4BSZA 3VNQA 1QM4A 1MXBA 1GPMA 4PUGA 4FUTA 5KEIA 2D1TA 4B3MC 5E7QA 2OPLA 4JI5C 4JI2C 1K0RA 1N33C 4ODJA 4JI3C 3N54B 1XRAA 1HNZC 5AE1A 1FJGC 4U5YD 2D1RA 3KXWA 2WD9A 2VSQA 3E7XA 5H9UA 1MXAA 3CJEA 5BSUA 1KKGA 4D57A 2ONFA 2MCQA 1TH5A 4ISBA 4LFCC 4YY3C 2KZ0A 1HNXC 2M5OA 1USPB 2JNVA 4R1LA 2PT7G 4JV5C 3VNSA 4ZLPA 4JI6C 2DPLA 3R44A 3DAYA 2E8EA 4NXMC 1HNWC 4BBYA 2D27A 4D4GA 3VNRA 2UUAC 2Y4OA 2KZFA 3R9WA 5BR8C 1EGAA 2HHHC 4ZJZA 4LF8C 4DUYC 4DCVA 3CW8X 4X64C 3LUSA 3S82A 1MDBA 4DR7C 2ATWA 2Z51A 2P2BA 1MXCA 2D1QA 2MM9A 4D4IA 2V7BA 3H2TA 4JYAC 3TDEA 2Y27A 3NYQA 2OBVA 4MTNA 2QVZX 4OYCA 3PROC 4DV3C 4R0MA 2CU6A 2D28C 2QVXX 1M6XA 3T1YC 5FLXD 4L4QA 3I07A 3I08A 5BUQA 1V26A 4HPVA 3T1HC 4KHPC 4JI4C 3GPCA 2YCBA 1WCJA 2F4VC 3J80D 4GKKC 4JM1A 3CQ1A 5BSMA 3IEVA 4JI8C 2EGTA 3ETCA 4RLFA 4JI0C 2ZZMA 2UUBC 1MD9A 3GR0A 2D1SA 3CQ2A 1RG9A 5A19A 4OX9C 5A1IA 5T8TA 1JOSA 1HR0C 5BURA 1XNRC 2OO4A 3A25A 4FUQA 4L7IA 4DCTA 4FTFA 1IBMC 3NYRA 2D7VA 1T5DX 4KTVA 3SO4A 1PG4A 2WP0C 3GR1A 1N36C 2DHMA 2E0GA 4LF6C 4BC9A 3A4IA 4GXRA 4TPSB 2UXDC 1FUGA 2Y4NA 4DV2C 1XMOC 3O2EA 2CXCA 3G7SA 1P4EC 1RY2A 4G36A 3L8CA 2YWBA 2ZZNA 2UXCC 4NXNC 2PROA 2CY1A 1USPA 2E7GA 3RG2A 1V60A 3TR3A 4DV5C 3LNOA 2DYJA 2P20A 4DR3C 1PU1A 3NPDA 2UU9C 1O9TA 4GS5A 3A26A 4LE5A 3EERA 5K85A 1BA3A 3DHVA 1XRBA 4DCSA 4LFBC 2VQFC 3TQIA 4PHTA 5AE3A 2E8CA 4IR7A 1ZB8A 1P4EA 2YWCA 2UUCC 2QW0X 4AQYC 2VZEA 5IFIA 5T8SA 4BC7A 3UZ0A 1MKYA 1L2FA 4GKJC 1IB8A 1O93A 3A9VA 4DV7C 2P2JA 1M6XC 1J5EC 4JI1C 2P2MA 1XRCA 3FCCA 4RVOA 5IWAC 1VLAA 5AE2A 4LF5C 1XNQC 4K0BA 3UX3A 1O92A 3LAXA 5JRHA 1NY8A 3K6RA 3NI2A 5A2QD 1HH2P 2NCLA 4DV6C 4LF9C 4DR5C 2E8FA 2BJOA 3PESA 3FCEA 1ZB9A 1PA4A 1PG3A 5KYTA 5CZXA 4B3TC 1N2FA 4X62C 1V25A 2KDNA 1LCIA 4DR4C 1N34C 3IMLA 3R9XA 4R1MA 5ADZA 4DV4C 4DV1C 1WH9A 1IBKC 1YJ7A 1UKKA 4RM2A 4MH4A 4DR2C 1VEHA 3IEUA 2OPLB 5LMNC 5CZVA 5LMUC 4DV0C 4B3SC 4EATA 4WS9A 2UXBC 1LQLA 3UEBA 4WV3A 2VQEC 1FLOA 3UOWA 4RM3A 3C5EA 3LGXA 2XR1A 5LCIA 4DCUA 4G1IA 3DLPX 3IPLA 2YX1A 5A1GA 2P02A 4RMNA 2BH1X 3OTOC 3L95X 5GTDA 1ML8A 4XX2A 4NOZA 2ASBA 5K8FA 3GKUA 4NDNA 1I94C 4G37A 4L2ZA 4KTTA 1XS3A 3A9UA 1WF3A 1ULTA 1MDFA 2PN2A 5BSTA 5BUSA 3B7WA 4PUIA 2QVYX 4LF4C 2P2QA 4OXIA 4GXQA 2MMAB 1QWIA 5KYVA 1N32C 4DUZC 2E5LC 3N2QA 5BSWA 4DG8A 4X66C 4PUHA 3RV2A 2ZM6C 4YHHC 4RVNA 3JAMD 4K0KC 3PBKA 2M5HA 4D56A 5DV9A 2HJGA 1O90A 3TUFA
chains in the Genus database with same CATH topology
2P2FA 5BSVA 3EQ6A 2QL8A 4PROC 4LF7C 3E7WA 4I9FA 4DG9A 4BCAA 3ETOA 4IZ6A 1AMUA 4X65C 3J81D 4RLQA 1T5HX 3CW9A 4PZPA 3AF6A 1IBLC 1NYEA 5IT9D 1XMQC 4I9GA 4B3RC 3LNVA 4DR6C 4DR1C 2JMPA 4LFAC 4JI7C 1P7LA 5BSRA 2AYAA 3AF5A 4BSZA 3VNQA 1QM4A 1MXBA 1GPMA 4B3MC 4FUTA 5KEIA 2D1TA 5E7QA 2OPLA 4JI5C 4JI2C 1K0RA 1N33C 4ODJA 4JI3C 3N54B 1XRAA 1HNZC 5AE1A 1FJGC 4U5YD 2D1RA 3KXWA 2WD9A 2VSQA 3E7XA 5H9UA 1MXAA 3CJEA 5BSUA 1KKGA 4D57A 2ONFA 4ISBA 4LFCC 4YY3C 1HNXC 1USPB 4R1LA 2PT7G 4JV5C 3VNSA 4ZLPA 4JI6C 2DPLA 3R44A 3DAYA 2E8EA 4NXMC 1HNWC 4BBYA 2D27A 4D4GA 3VNRA 2UUAC 2Y4OA 2KZFA 3R9WA 5BR8C 1EGAA 2HHHC 4ZJZA 4LF8C 4DUYC 4DCVA 3CW8X 4X64C 3LUSA 3S82A 1MDBA 4DR7C 2ATWA 2P2BA 1MXCA 2D1QA 4D4IA 2V7BA 3H2TA 4JYAC 3TDEA 2Y27A 3NYQA 2OBVA 4MTNA 2QVZX 4OYCA 3PROC 4DV3C 4R0MA 2D28C 2QVXX 3T1YC 5FLXD 4L4QA 3I07A 3I08A 5BUQA 1V26A 4HPVA 3T1HC 4KHPC 4JI4C 3GPCA 2YCBA 2F4VC 3J80D 4GKKC 4JM1A 5BSMA 3IEVA 4JI8C 2EGTA 3ETCA 4RLFA 4JI0C 2UUBC 1MD9A 3GR0A 2D1SA 1RG9A 5A19A 4OX9C 5A1IA 5T8TA 1JOSA 1HR0C 5BURA 1XNRC 2OO4A 4FUQA 4L7IA 4DCTA 4FTFA 1IBMC 3NYRA 2D7VA 1T5DX 4KTVA 3SO4A 1PG4A 2WP0C 3GR1A 1N36C 2E0GA 4LF6C 4BC9A 3A4IA 4GXRA 4TPSB 2UXDC 1FUGA 2Y4NA 4DV2C 1XMOC 2CXCA 3G7SA 1RY2A 4G36A 3L8CA 2YWBA 2UXCC 4NXNC 2PROA 2CY1A 1USPA 2E7GA 3RG2A 4DV5C 2DYJA 2P20A 4DR3C 3NPDA 2UU9C 1O9TA 4GS5A 4LE5A 3EERA 5K85A 1BA3A 3DHVA 1XRBA 4DCSA 4LFBC 2VQFC 3TQIA 4PHTA 5AE3A 2E8CA 4IR7A 1ZB8A 2YWCA 2UUCC 2QW0X 4AQYC 2VZEA 5IFIA 5T8SA 4BC7A 3UZ0A 1MKYA 1L2FA 4GKJC 1O93A 3A9VA 4DV7C 2P2JA 1J5EC 4JI1C 2P2MA 1XRCA 3FCCA 4RVOA 5IWAC 1VLAA 5AE2A 4LF5C 1XNQC 4K0BA 1O92A 3LAXA 5JRHA 3NI2A 5A2QD 1HH2P 4DV6C 4LF9C 4DR5C 2E8FA 2BJOA 3PESA 3FCEA 1ZB9A 1PA4A 1PG3A 5KYTA 5CZXA 4B3TC 1N2FA 4X62C 1V25A 1LCIA 4DR4C 1N34C 3IMLA 3R9XA 4R1MA 5ADZA 4DV4C 4DV1C 1WH9A 1IBKC 1YJ7A 1UKKA 4RM2A 4MH4A 4DR2C 3IEUA 2OPLB 5LMNC 5CZVA 5LMUC 4DV0C 4B3SC 4EATA 4WS9A 2UXBC 1LQLA 4WV3A 2VQEC 3UOWA 4RM3A 3C5EA 3LGXA 2XR1A 4DCUA 4G1IA 3DLPX 3IPLA 5A1GA 2P02A 4RMNA 2BH1X 3OTOC 3L95X 5GTDA 1ML8A 4XX2A 4NOZA 2ASBA 5K8FA 3GKUA 4NDNA 1I94C 4G37A 4L2ZA 4KTTA 3A9UA 1WF3A 1ULTA 1MDFA 2PN2A 5BSTA 5BUSA 3B7WA 2QVYX 4LF4C 2P2QA 4OXIA 4GXQA 1QWIA 5KYVA 1N32C 4DUZC 2E5LC 3N2QA 5BSWA 4DG8A 4X66C 3RV2A 2ZM6C 4YHHC 4RVNA 3JAMD 4K0KC 3PBKA 4D56A 5DV9A 2HJGA 1O90A 3TUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOW A;  1XRA A;  3TQI A;  4KTV A;  4L4Q A;  1O93 A;  3S82 A;  3SO4 A;  1P7L A;  4HPV A;  2YWC A;  1MXC A;  1XRC A;  5H9U A;  1QM4 A;  2DPL A;  1RG9 A;  1MXB A;  1MXA A;  3RV2 A;  1GPM A;  4NDN A;  3A4I A;  5T8S A;  4L2Z A;  5A19 A;  4KTT A;  5A1I A;  1FUG A;  4K0B A;  5T8T A;  3TDE A;  5A1G A;  2P02 A;  1O92 A;  2OBV A;  1O9T A;  4WS9 A;  3IML A;  4ODJ A;  1O90 A;  2YWB A;  4LE5 A;  4L7I A;  1XRB A; 
#chains in the Genus database with same CATH topology
 2P2F A;  5BSV A;  3EQ6 A;  1UWD A;  2QL8 A;  4PRO C;  4LF7 C;  3E7W A;  4I9F A;  4DG9 A;  4BCA A;  3ETO A;  1AMU A;  4IZ6 A;  4X65 C;  3J81 D;  4RLQ A;  1T5H X;  3CW9 A;  3AY0 A;  3UX2 A;  4PZP A;  3AF6 A;  1IBL C;  1NYE A;  5IT9 D;  1XMQ C;  4I9G A;  4B3R C;  3LNV A;  4DR6 C;  3CQ3 A;  4DR1 C;  2JMP A;  1XHJ A;  4LFA C;  4JI7 C;  1P7L A;  5BSR A;  2AYA A;  3AF5 A;  4BSZ A;  3VNQ A;  1QM4 A;  1MXB A;  1GPM A;  4PUG A;  4FUT A;  5KEI A;  2D1T A;  4B3M C;  5E7Q A;  2OPL A;  4JI5 C;  4JI2 C;  1K0R A;  1N33 C;  4ODJ A;  4JI3 C;  3N54 B;  1XRA A;  1HNZ C;  5AE1 A;  1FJG C;  4U5Y D;  2D1R A;  3KXW A;  2WD9 A;  2VSQ A;  3E7X A;  5H9U A;  1MXA A;  3CJE A;  5BSU A;  1KKG A;  4D57 A;  2ONF A;  2MCQ A;  1TH5 A;  4ISB A;  4LFC C;  4YY3 C;  2KZ0 A;  1HNX C;  2M5O A;  1USP B;  2JNV A;  4R1L A;  2PT7 G;  4JV5 C;  3VNS A;  4ZLP A;  4JI6 C;  2DPL A;  3R44 A;  3DAY A;  2E8E A;  4NXM C;  1HNW C;  4BBY A;  2D27 A;  4D4G A;  3VNR A;  2UUA C;  2Y4O A;  2KZF A;  3R9W A;  5BR8 C;  1EGA A;  2HHH C;  4ZJZ A;  4LF8 C;  4DUY C;  4DCV A;  3CW8 X;  4X64 C;  3LUS A;  3S82 A;  1MDB A;  4DR7 C;  2ATW A;  2Z51 A;  2P2B A;  1MXC A;  2D1Q A;  2MM9 A;  4D4I A;  2V7B A;  3H2T A;  4JYA C;  3TDE A;  2Y27 A;  3NYQ A;  2OBV A;  4MTN A;  2QVZ X;  4OYC A;  3PRO C;  4DV3 C;  4R0M A;  2CU6 A;  2D28 C;  2QVX X;  1M6X A;  3T1Y C;  5FLX D;  4L4Q A;  3I07 A;  3I08 A;  5BUQ A;  1V26 A;  4HPV A;  3T1H C;  4KHP C;  4JI4 C;  3GPC A;  2YCB A;  1WCJ A;  2F4V C;  3J80 D;  4GKK C;  4JM1 A;  3CQ1 A;  5BSM A;  3IEV A;  4JI8 C;  2EGT A;  3ETC A;  4RLF A;  4JI0 C;  2ZZM A;  2UUB C;  1MD9 A;  3GR0 A;  2D1S A;  3CQ2 A;  1RG9 A;  5A19 A;  4OX9 C;  5A1I A;  5T8T A;  1JOS A;  1HR0 C;  5BUR A;  1XNR C;  2OO4 A;  3A25 A;  4FUQ A;  4L7I A;  4DCT A;  4FTF A;  1IBM C;  3NYR A;  2D7V A;  1T5D X;  4KTV A;  3SO4 A;  1PG4 A;  2WP0 C;  3GR1 A;  1N36 C;  2DHM A;  2E0G A;  4LF6 C;  4BC9 A;  3A4I A;  4GXR A;  4TPS B;  2UXD C;  1FUG A;  2Y4N A;  4DV2 C;  1XMO C;  3O2E A;  2CXC A;  3G7S A;  1P4E C;  1RY2 A;  4G36 A;  3L8C A;  2YWB A;  2ZZN A;  2UXC C;  4NXN C;  2PRO A;  2CY1 A;  1USP A;  2E7G A;  3RG2 A;  1V60 A;  3TR3 A;  4DV5 C;  3LNO A;  2DYJ A;  2P20 A;  4DR3 C;  1PU1 A;  3NPD A;  2UU9 C;  1O9T A;  4GS5 A;  3A26 A;  4LE5 A;  3EER A;  5K85 A;  1BA3 A;  3DHV A;  1XRB A;  4DCS A;  4LFB C;  2VQF C;  3TQI A;  4PHT A;  5AE3 A;  2E8C A;  4IR7 A;  1ZB8 A;  1P4E A;  2YWC A;  2UUC C;  2QW0 X;  4AQY C;  2VZE A;  5IFI A;  5T8S A;  4BC7 A;  3UZ0 A;  1MKY A;  1L2F A;  4GKJ C;  1IB8 A;  1O93 A;  3A9V A;  4DV7 C;  2P2J A;  1M6X C;  1J5E C;  4JI1 C;  2P2M A;  1XRC A;  3FCC A;  4RVO A;  5IWA C;  1VLA A;  5AE2 A;  4LF5 C;  1XNQ C;  4K0B A;  3UX3 A;  1O92 A;  3LAX A;  5JRH A;  1NY8 A;  3K6R A;  3NI2 A;  5A2Q D;  1HH2 P;  2NCL A;  4DV6 C;  4LF9 C;  4DR5 C;  2E8F A;  2BJO A;  3PES A;  3FCE A;  1ZB9 A;  1PA4 A;  1PG3 A;  5KYT A;  5CZX A;  4B3T C;  1N2F A;  4X62 C;  1V25 A;  2KDN A;  1LCI A;  4DR4 C;  1N34 C;  3IML A;  3R9X A;  4R1M A;  5ADZ A;  4DV4 C;  4DV1 C;  1WH9 A;  1IBK C;  1YJ7 A;  1UKK A;  4RM2 A;  4MH4 A;  4DR2 C;  1VEH A;  3IEU A;  2OPL B;  5LMN C;  5CZV A;  5LMU C;  4DV0 C;  4B3S C;  4EAT A;  4WS9 A;  2UXB C;  1LQL A;  3UEB A;  4WV3 A;  2VQE C;  1FLO A;  3UOW A;  4RM3 A;  3C5E A;  3LGX A;  2XR1 A;  5LCI A;  4DCU A;  4G1I A;  3DLP X;  3IPL A;  2YX1 A;  5A1G A;  2P02 A;  4RMN A;  2BH1 X;  3OTO C;  3L95 X;  5GTD A;  1ML8 A;  4XX2 A;  4NOZ A;  2ASB A;  5K8F A;  3GKU A;  4NDN A;  1I94 C;  4G37 A;  4L2Z A;  4KTT A;  1XS3 A;  3A9U A;  1WF3 A;  1ULT A;  1MDF A;  2PN2 A;  5BST A;  5BUS A;  3B7W A;  4PUI A;  2QVY X;  4LF4 C;  2P2Q A;  4OXI A;  4GXQ A;  2MMA B;  1QWI A;  5KYV A;  1N32 C;  4DUZ C;  2E5L C;  3N2Q A;  5BSW A;  4DG8 A;  4X66 C;  4PUH A;  3RV2 A;  2ZM6 C;  4YHH C;  4RVN A;  3JAM D;  4K0K C;  3PBK A;  2M5H A;  4D56 A;  5DV9 A;  2HJG A;  1O90 A;  3TUF A; 
#chains in the Genus database with same CATH homology
 2P2F A;  5BSV A;  3EQ6 A;  2QL8 A;  4PRO C;  4LF7 C;  3E7W A;  4I9F A;  4DG9 A;  4BCA A;  3ETO A;  4IZ6 A;  1AMU A;  4X65 C;  3J81 D;  4RLQ A;  1T5H X;  3CW9 A;  4PZP A;  3AF6 A;  1IBL C;  1NYE A;  5IT9 D;  1XMQ C;  4I9G A;  4B3R C;  3LNV A;  4DR6 C;  4DR1 C;  2JMP A;  4LFA C;  4JI7 C;  1P7L A;  5BSR A;  2AYA A;  3AF5 A;  4BSZ A;  3VNQ A;  1QM4 A;  1MXB A;  1GPM A;  4B3M C;  4FUT A;  5KEI A;  2D1T A;  5E7Q A;  2OPL A;  4JI5 C;  4JI2 C;  1K0R A;  1N33 C;  4ODJ A;  4JI3 C;  3N54 B;  1XRA A;  1HNZ C;  5AE1 A;  1FJG C;  4U5Y D;  2D1R A;  3KXW A;  2WD9 A;  2VSQ A;  3E7X A;  5H9U A;  1MXA A;  3CJE A;  5BSU A;  1KKG A;  4D57 A;  2ONF A;  4ISB A;  4LFC C;  4YY3 C;  1HNX C;  1USP B;  4R1L A;  2PT7 G;  4JV5 C;  3VNS A;  4ZLP A;  4JI6 C;  2DPL A;  3R44 A;  3DAY A;  2E8E A;  4NXM C;  1HNW C;  4BBY A;  2D27 A;  4D4G A;  3VNR A;  2UUA C;  2Y4O A;  2KZF A;  3R9W A;  5BR8 C;  1EGA A;  2HHH C;  4ZJZ A;  4LF8 C;  4DUY C;  4DCV A;  3CW8 X;  4X64 C;  3LUS A;  3S82 A;  1MDB A;  4DR7 C;  2ATW A;  2P2B A;  1MXC A;  2D1Q A;  4D4I A;  2V7B A;  3H2T A;  4JYA C;  3TDE A;  2Y27 A;  3NYQ A;  2OBV A;  4MTN A;  2QVZ X;  4OYC A;  3PRO C;  4DV3 C;  4R0M A;  2D28 C;  2QVX X;  3T1Y C;  5FLX D;  4L4Q A;  3I07 A;  3I08 A;  5BUQ A;  1V26 A;  4HPV A;  3T1H C;  4KHP C;  4JI4 C;  3GPC A;  2YCB A;  2F4V C;  3J80 D;  4GKK C;  4JM1 A;  5BSM A;  3IEV A;  4JI8 C;  2EGT A;  3ETC A;  4RLF A;  4JI0 C;  2UUB C;  1MD9 A;  3GR0 A;  2D1S A;  1RG9 A;  5A19 A;  4OX9 C;  5A1I A;  5T8T A;  1JOS A;  1HR0 C;  5BUR A;  1XNR C;  2OO4 A;  4FUQ A;  4L7I A;  4DCT A;  4FTF A;  1IBM C;  3NYR A;  2D7V A;  1T5D X;  4KTV A;  3SO4 A;  1PG4 A;  2WP0 C;  3GR1 A;  1N36 C;  2E0G A;  4LF6 C;  4BC9 A;  3A4I A;  4GXR A;  4TPS B;  2UXD C;  1FUG A;  2Y4N A;  4DV2 C;  1XMO C;  2CXC A;  3G7S A;  1RY2 A;  4G36 A;  3L8C A;  2YWB A;  2UXC C;  4NXN C;  2PRO A;  2CY1 A;  1USP A;  2E7G A;  3RG2 A;  4DV5 C;  2DYJ A;  2P20 A;  4DR3 C;  3NPD A;  2UU9 C;  1O9T A;  4GS5 A;  4LE5 A;  3EER A;  5K85 A;  1BA3 A;  3DHV A;  1XRB A;  4DCS A;  4LFB C;  2VQF C;  3TQI A;  4PHT A;  5AE3 A;  2E8C A;  4IR7 A;  1ZB8 A;  2YWC A;  2UUC C;  2QW0 X;  4AQY C;  2VZE A;  5IFI A;  5T8S A;  4BC7 A;  3UZ0 A;  1MKY A;  1L2F A;  4GKJ C;  1O93 A;  3A9V A;  4DV7 C;  2P2J A;  1J5E C;  4JI1 C;  2P2M A;  1XRC A;  3FCC A;  4RVO A;  5IWA C;  1VLA A;  5AE2 A;  4LF5 C;  1XNQ C;  4K0B A;  1O92 A;  3LAX A;  5JRH A;  3NI2 A;  5A2Q D;  1HH2 P;  4DV6 C;  4LF9 C;  4DR5 C;  2E8F A;  2BJO A;  3PES A;  3FCE A;  1ZB9 A;  1PA4 A;  1PG3 A;  5KYT A;  5CZX A;  4B3T C;  1N2F A;  4X62 C;  1V25 A;  1LCI A;  4DR4 C;  1N34 C;  3IML A;  3R9X A;  4R1M A;  5ADZ A;  4DV4 C;  4DV1 C;  1WH9 A;  1IBK C;  1YJ7 A;  1UKK A;  4RM2 A;  4MH4 A;  4DR2 C;  3IEU A;  2OPL B;  5LMN C;  5CZV A;  5LMU C;  4DV0 C;  4B3S C;  4EAT A;  4WS9 A;  2UXB C;  1LQL A;  4WV3 A;  2VQE C;  3UOW A;  4RM3 A;  3C5E A;  3LGX A;  2XR1 A;  4DCU A;  4G1I A;  3DLP X;  3IPL A;  5A1G A;  2P02 A;  4RMN A;  2BH1 X;  3OTO C;  3L95 X;  5GTD A;  1ML8 A;  4XX2 A;  4NOZ A;  2ASB A;  5K8F A;  3GKU A;  4NDN A;  1I94 C;  4G37 A;  4L2Z A;  4KTT A;  3A9U A;  1WF3 A;  1ULT A;  1MDF A;  2PN2 A;  5BST A;  5BUS A;  3B7W A;  2QVY X;  4LF4 C;  2P2Q A;  4OXI A;  4GXQ A;  1QWI A;  5KYV A;  1N32 C;  4DUZ C;  2E5L C;  3N2Q A;  5BSW A;  4DG8 A;  4X66 C;  3RV2 A;  2ZM6 C;  4YHH C;  4RVN A;  3JAM D;  4K0K C;  3PBK A;  4D56 A;  5DV9 A;  2HJG A;  1O90 A;  3TUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...