1MXCA

S-adenosylmethionine synthetase with 8-br-adp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
total genus 129
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxcA01
3S82A 2DPLA 1XRCA 2YWCA 3UOWA 1XRAA 1FUGA 4L2ZA 5H9UA 2P02A 4K0BA 3IMLA 4NDNA 4LE5A 4WS9A 3RV2A 4L4QA 1O9TA 5A19A 5T8TA 5T8SA 4ODJA 3TQIA 5A1GA 1MXCA 3SO4A 3A4IA 1MXBA 3TDEA 1QM4A 1RG9A 1O90A 1GPMA 1XRBA 4L7IA 4HPVA 1O92A 1O93A 2YWBA 4KTTA 4KTVA 2OBVA 1MXAA 1P7LA 5A1IA
chains in the Genus database with same CATH superfamily
1FJGC 1IB8A 2D28C 4ZLPA 3GR1A 1MKYA 3R9WA 1NY8A 1FLOA 4B3RC 3NPDA 4PHTA 4DR5C 4L4QA 4D56A 4R1MA 3IPLA 4DV3C 2WP0C 1USPA 1MXAA 4DV7C 4JYAC 1PG4A 5DV9A 4RVOA 4MTNA 2E7GA 1USPB 3LNOA 2KZ0A 4DG8A 2BJOA 5KYTA 3A9UA 1LCIA 4DUYC 3IEUA 1AMUA 2E8EA 5T8SA 3PBKA 1MXCA 3TDEA 2JMPA 3UEBA 2XR1A 1LQLA 4RLQA 4BC9A 5KEIA 4DV5C 3LAXA 3TR3A 2HJGA 5K85A 5LCIA 2KZFA 1NYEA 3TUFA 2M5OA 1M6XA 2NCLA 2D7VA 1IBKC 1MXBA 1P4EC 2UUCC 1VEHA 1N36C 2UXDC 4NXMC 4R0MA 3S82A 5BURA 4DV0C 4NOZA 2MMAB 2CU6A 4DCVA 2Y4OA 2P2MA 4NDNA 4X66C 1BA3A 3A25A 2MCQA 5BSTA 4BCAA 2P2FA 5BSRA 4PUHA 2QVYX 4LF9C 5LMUC 5BUSA 4KTTA 1UWDA 2BH1X 2DHMA 3CJEA 3KXWA 2VQEC 4PUGA 3H2TA 4DV6C 4X62C 4JI1C 4KHPC 3AY0A 4FTFA 1MD9A 2UUAC 4AQYC 4LE5A 4JV5C 2P2JA 5T8TA 5A1GA 3PROC 2ZM6C 1QM4A 3CQ2A 1K0RA 2P2BA 2P20A 1N33C 1HNZC 5A1IA 3UOWA 4OX9C 4RM2A 3I07A 1N34C 5JRHA 2EGTA 4U5YD 4OXIA 4GKKC 4ODJA 3TQIA 1HNWC 2UU9C 3UZ0A 3FCCA 2QW0X 5AE3A 5IWAC 3NYQA 1VLAA 3O2EA 4DR4C 4B3SC 5IT9D 2Y27A 4DR6C 4JM1A 3T1HC 1M6XC 4K0BA 4D4IA 1UKKA 3DHVA 3B7WA 3CW8X 1ZB9A 5BSUA 3VNRA 4D4GA 4HPVA 1N32C 3UX3A 2QVXX 4KTVA 4WV3A 4JI5C 3R44A 1V26A 2D1RA 4FUTA 4DV1C 3NI2A 3DAYA 4GS5A 5CZVA 5LMNC 4BSZA 1IBMC 1N2FA 5AE1A 2VQFC 4DR2C 4PZPA 3VNQA 5CZXA 4L7IA 4DV2C 2YWBA 1L2FA 2HHHC 1P7LA 4MH4A 4LF6C 2DYJA 3A26A 2E5LC 2P02A 3FCEA 1XNQC 1WH9A 3OTOC 1MDBA 3I08A 1RG9A 1XS3A 2D27A 4LF5C 5IFIA 5E7QA 3GR0A 1YJ7A 1XRAA 4D57A 4DR7C 3EQ6A 3LUSA 3J80D 1XMOC 3N54B 2AYAA 5AE2A 5FLXD 3EERA 5BSVA 4DUZC 3R9XA 2D1SA 5ADZA 3SO4A 1HH2P 1O90A 4JI2C 4DCTA 4YHHC 3GKUA 1XNRC 1ULTA 4K0KC 3E7WA 1RY2A 3T1YC 1IBLC 2WD9A 3VNSA 5K8FA 1WCJA 4JI8C 5BR8C 3L95X 1O9TA 3K6RA 3G7SA 2CXCA 4EATA 4I9GA 1ML8A 4GKJC 2VZEA 1O93A 2CY1A 2OBVA 2D1QA 3N2QA 2KDNA 4JI4C 2DPLA 3J81D 3CQ3A 2D1TA 1V60A 3DLPX 4RM3A 4XX2A 5A2QD 3IMLA 3AF5A 2M5HA 4RMNA 2ASBA 3L8CA 2PT7G 5GTDA 5BUQA 2E8CA 2Z51A 3A4IA 3C5EA 2UXBC 1XRBA 4ISBA 4PUIA 4DCSA 1JOSA 4JI3C 1WF3A 1XRCA 3PESA 1J5EC 2QL8A 2VSQA 2E0GA 2QVZX 4IR7A 2ONFA 5KYVA 5H9UA 1PA4A 3RV2A 4X65C 4B3MC 4YY3C 2F4VC 2ATWA 2OPLA 4TPSB 4DR3C 3AF6A 1EGAA 3LGXA 4IZ6A 2OPLB 1XMQC 4B3TC 1XHJA 2PROA 1HNXC 4L2ZA 4BC7A 4WS9A 2P2QA 2YX1A 5A19A 4JI0C 1KKGA 4R1LA 4JI6C 2JNVA 5BSMA 1T5HX 1GPMA 4LFBC 4GXQA 1PU1A 1O92A 4DG9A 3UX2A 2OO4A 2YCBA 3E7XA 4OYCA 1FUGA 4GXRA 4ZJZA 4DR1C 4X64C 1HR0C 4LF8C 4NXNC 1PG3A 4DCUA 4RVNA 4LFCC 3A9VA 3JAMD 2ZZNA 3LNVA 2ZZMA 4G1IA 2V7BA 3IEVA 4FUQA 2UXCC 4LFAC 3RG2A 3CW9A 1P4EA 1V25A 3CQ1A 3GPCA 4JI7C 2YWCA 4BBYA 4G36A 2E8FA 5BSWA 1I94C 1QWIA 4DV4C 3ETOA 3ETCA 4I9FA 1T5DX 1MDFA 4G37A 1ZB8A 2PN2A 4PROC 2Y4NA 3NYRA 4LF4C 4RLFA 4LF7C 2UUBC 1TH5A 2MM9A
chains in the Genus database with same CATH topology
1FJGC 2D28C 4ZLPA 3GR1A 1MKYA 3R9WA 4B3RC 3NPDA 4PHTA 4DR5C 4L4QA 4D56A 4R1MA 3IPLA 4DV3C 2WP0C 1USPA 1MXAA 4DV7C 4JYAC 1PG4A 5DV9A 4RVOA 4MTNA 2E7GA 1USPB 4DG8A 2BJOA 5KYTA 3A9UA 1LCIA 4DUYC 3IEUA 1AMUA 2E8EA 5T8SA 3PBKA 1MXCA 3TDEA 2JMPA 2XR1A 1LQLA 4RLQA 4BC9A 5KEIA 4DV5C 3LAXA 2HJGA 5K85A 2KZFA 1NYEA 3TUFA 2D7VA 1IBKC 1MXBA 2UUCC 1N36C 2UXDC 4NXMC 4R0MA 3S82A 5BURA 4DV0C 4NOZA 4DCVA 2Y4OA 2P2MA 4NDNA 4X66C 1BA3A 5BSTA 4BCAA 2P2FA 5BSRA 2QVYX 4LF9C 5LMUC 5BUSA 4KTTA 2BH1X 3CJEA 3KXWA 2VQEC 3H2TA 4DV6C 4X62C 4JI1C 4KHPC 4FTFA 1MD9A 2UUAC 4AQYC 4LE5A 4JV5C 2P2JA 5T8TA 5A1GA 3PROC 2ZM6C 1QM4A 1K0RA 2P2BA 2P20A 1N33C 1HNZC 5A1IA 3UOWA 4OX9C 4RM2A 3I07A 1N34C 5JRHA 2EGTA 4U5YD 4OXIA 4GKKC 4ODJA 3TQIA 1HNWC 2UU9C 3UZ0A 3FCCA 2QW0X 5AE3A 5IWAC 3NYQA 1VLAA 4DR4C 4B3SC 5IT9D 2Y27A 4DR6C 4JM1A 3T1HC 4K0BA 4D4IA 1UKKA 3DHVA 3B7WA 3CW8X 1ZB9A 5BSUA 3VNRA 4D4GA 4HPVA 1N32C 2QVXX 4KTVA 4WV3A 4JI5C 3R44A 1V26A 2D1RA 4FUTA 4DV1C 3NI2A 3DAYA 4GS5A 5CZVA 5LMNC 4BSZA 1IBMC 1N2FA 5AE1A 2VQFC 4DR2C 4PZPA 3VNQA 5CZXA 4L7IA 4DV2C 2YWBA 1L2FA 2HHHC 1P7LA 4MH4A 4LF6C 2DYJA 2E5LC 2P02A 3FCEA 1XNQC 1WH9A 3OTOC 1MDBA 3I08A 1RG9A 2D27A 4LF5C 5IFIA 5E7QA 3GR0A 1YJ7A 1XRAA 4D57A 4DR7C 3EQ6A 3LUSA 3J80D 1XMOC 3N54B 2AYAA 5AE2A 5FLXD 3EERA 5BSVA 4DUZC 3R9XA 2D1SA 5ADZA 3SO4A 1HH2P 1O90A 4JI2C 4DCTA 4YHHC 3GKUA 1XNRC 1ULTA 4K0KC 3E7WA 1RY2A 3T1YC 1IBLC 2WD9A 3VNSA 5K8FA 4JI8C 5BR8C 3L95X 1O9TA 3G7SA 2CXCA 4EATA 4I9GA 1ML8A 4GKJC 2VZEA 1O93A 2CY1A 2OBVA 2D1QA 3N2QA 4JI4C 2DPLA 3J81D 2D1TA 3DLPX 4RM3A 4XX2A 5A2QD 3IMLA 3AF5A 4RMNA 2ASBA 3L8CA 2PT7G 5GTDA 5BUQA 2E8CA 3A4IA 3C5EA 2UXBC 1XRBA 4ISBA 4DCSA 1JOSA 4JI3C 1WF3A 1XRCA 3PESA 1J5EC 2QL8A 2VSQA 2E0GA 2QVZX 4IR7A 2ONFA 5KYVA 5H9UA 1PA4A 3RV2A 4X65C 4B3MC 4YY3C 2F4VC 2ATWA 2OPLA 4TPSB 4DR3C 3AF6A 1EGAA 3LGXA 4IZ6A 2OPLB 1XMQC 4B3TC 2PROA 1HNXC 4L2ZA 4BC7A 4WS9A 2P2QA 5A19A 4JI0C 1KKGA 4R1LA 4JI6C 5BSMA 1T5HX 1GPMA 4LFBC 4GXQA 1O92A 4DG9A 2OO4A 2YCBA 3E7XA 4OYCA 1FUGA 4GXRA 4ZJZA 4DR1C 4X64C 1HR0C 4LF8C 4NXNC 1PG3A 4DCUA 4RVNA 4LFCC 3A9VA 3JAMD 3LNVA 4G1IA 2V7BA 3IEVA 4FUQA 2UXCC 4LFAC 3RG2A 3CW9A 1V25A 3GPCA 4JI7C 2YWCA 4BBYA 4G36A 2E8FA 5BSWA 1I94C 1QWIA 4DV4C 3ETOA 3ETCA 4I9FA 1T5DX 1MDFA 4G37A 1ZB8A 2PN2A 4PROC 2Y4NA 3NYRA 4LF4C 4RLFA 4LF7C 2UUBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S82 A;  2DPL A;  1XRC A;  2YWC A;  3UOW A;  1XRA A;  1FUG A;  4L2Z A;  5H9U A;  2P02 A;  4K0B A;  3IML A;  4NDN A;  4LE5 A;  4WS9 A;  3RV2 A;  4L4Q A;  1O9T A;  5A19 A;  5T8T A;  5T8S A;  4ODJ A;  3TQI A;  5A1G A;  1MXC A;  3SO4 A;  3A4I A;  1MXB A;  3TDE A;  1QM4 A;  1RG9 A;  1O90 A;  1GPM A;  1XRB A;  4L7I A;  4HPV A;  1O92 A;  1O93 A;  2YWB A;  4KTT A;  4KTV A;  2OBV A;  1MXA A;  1P7L A;  5A1I A; 
#chains in the Genus database with same CATH topology
 1FJG C;  1IB8 A;  2D28 C;  4ZLP A;  3GR1 A;  1MKY A;  3R9W A;  1NY8 A;  1FLO A;  4B3R C;  3NPD A;  4PHT A;  4DR5 C;  4L4Q A;  4D56 A;  4R1M A;  3IPL A;  4DV3 C;  2WP0 C;  1USP A;  1MXA A;  4DV7 C;  4JYA C;  1PG4 A;  5DV9 A;  4RVO A;  4MTN A;  2E7G A;  1USP B;  3LNO A;  2KZ0 A;  4DG8 A;  2BJO A;  5KYT A;  3A9U A;  1LCI A;  4DUY C;  3IEU A;  1AMU A;  2E8E A;  5T8S A;  3PBK A;  1MXC A;  3TDE A;  2JMP A;  3UEB A;  2XR1 A;  1LQL A;  4RLQ A;  4BC9 A;  5KEI A;  4DV5 C;  3LAX A;  3TR3 A;  2HJG A;  5K85 A;  5LCI A;  2KZF A;  1NYE A;  3TUF A;  2M5O A;  1M6X A;  2NCL A;  2D7V A;  1IBK C;  1MXB A;  1P4E C;  2UUC C;  1VEH A;  1N36 C;  2UXD C;  4NXM C;  4R0M A;  3S82 A;  5BUR A;  4DV0 C;  4NOZ A;  2MMA B;  2CU6 A;  4DCV A;  2Y4O A;  2P2M A;  4NDN A;  4X66 C;  1BA3 A;  3A25 A;  2MCQ A;  5BST A;  4BCA A;  2P2F A;  5BSR A;  4PUH A;  2QVY X;  4LF9 C;  5LMU C;  5BUS A;  4KTT A;  1UWD A;  2BH1 X;  2DHM A;  3CJE A;  3KXW A;  2VQE C;  4PUG A;  3H2T A;  4DV6 C;  4X62 C;  4JI1 C;  4KHP C;  3AY0 A;  4FTF A;  1MD9 A;  2UUA C;  4AQY C;  4LE5 A;  4JV5 C;  2P2J A;  5T8T A;  5A1G A;  3PRO C;  2ZM6 C;  1QM4 A;  3CQ2 A;  1K0R A;  2P2B A;  2P20 A;  1N33 C;  1HNZ C;  5A1I A;  3UOW A;  4OX9 C;  4RM2 A;  3I07 A;  1N34 C;  5JRH A;  2EGT A;  4U5Y D;  4OXI A;  4GKK C;  4ODJ A;  3TQI A;  1HNW C;  2UU9 C;  3UZ0 A;  3FCC A;  2QW0 X;  5AE3 A;  5IWA C;  3NYQ A;  1VLA A;  3O2E A;  4DR4 C;  4B3S C;  5IT9 D;  2Y27 A;  4DR6 C;  4JM1 A;  3T1H C;  1M6X C;  4K0B A;  4D4I A;  1UKK A;  3DHV A;  3B7W A;  3CW8 X;  1ZB9 A;  5BSU A;  3VNR A;  4D4G A;  4HPV A;  1N32 C;  3UX3 A;  2QVX X;  4KTV A;  4WV3 A;  4JI5 C;  3R44 A;  1V26 A;  2D1R A;  4FUT A;  4DV1 C;  3NI2 A;  3DAY A;  4GS5 A;  5CZV A;  5LMN C;  4BSZ A;  1IBM C;  1N2F A;  5AE1 A;  2VQF C;  4DR2 C;  4PZP A;  3VNQ A;  5CZX A;  4L7I A;  4DV2 C;  2YWB A;  1L2F A;  2HHH C;  1P7L A;  4MH4 A;  4LF6 C;  2DYJ A;  3A26 A;  2E5L C;  2P02 A;  3FCE A;  1XNQ C;  1WH9 A;  3OTO C;  1MDB A;  3I08 A;  1RG9 A;  1XS3 A;  2D27 A;  4LF5 C;  5IFI A;  5E7Q A;  3GR0 A;  1YJ7 A;  1XRA A;  4D57 A;  4DR7 C;  3EQ6 A;  3LUS A;  3J80 D;  1XMO C;  3N54 B;  2AYA A;  5AE2 A;  5FLX D;  3EER A;  5BSV A;  4DUZ C;  3R9X A;  2D1S A;  5ADZ A;  3SO4 A;  1HH2 P;  1O90 A;  4JI2 C;  4DCT A;  4YHH C;  3GKU A;  1XNR C;  1ULT A;  4K0K C;  3E7W A;  1RY2 A;  3T1Y C;  1IBL C;  2WD9 A;  3VNS A;  5K8F A;  1WCJ A;  4JI8 C;  5BR8 C;  3L95 X;  1O9T A;  3K6R A;  3G7S A;  2CXC A;  4EAT A;  4I9G A;  1ML8 A;  4GKJ C;  2VZE A;  1O93 A;  2CY1 A;  2OBV A;  2D1Q A;  3N2Q A;  2KDN A;  4JI4 C;  2DPL A;  3J81 D;  3CQ3 A;  2D1T A;  1V60 A;  3DLP X;  4RM3 A;  4XX2 A;  5A2Q D;  3IML A;  3AF5 A;  2M5H A;  4RMN A;  2ASB A;  3L8C A;  2PT7 G;  5GTD A;  5BUQ A;  2E8C A;  2Z51 A;  3A4I A;  3C5E A;  2UXB C;  1XRB A;  4ISB A;  4PUI A;  4DCS A;  1JOS A;  4JI3 C;  1WF3 A;  1XRC A;  3PES A;  1J5E C;  2QL8 A;  2VSQ A;  2E0G A;  2QVZ X;  4IR7 A;  2ONF A;  5KYV A;  5H9U A;  1PA4 A;  3RV2 A;  4X65 C;  4B3M C;  4YY3 C;  2F4V C;  2ATW A;  2OPL A;  4TPS B;  4DR3 C;  3AF6 A;  1EGA A;  3LGX A;  4IZ6 A;  2OPL B;  1XMQ C;  4B3T C;  1XHJ A;  2PRO A;  1HNX C;  4L2Z A;  4BC7 A;  4WS9 A;  2P2Q A;  2YX1 A;  5A19 A;  4JI0 C;  1KKG A;  4R1L A;  4JI6 C;  2JNV A;  5BSM A;  1T5H X;  1GPM A;  4LFB C;  4GXQ A;  1PU1 A;  1O92 A;  4DG9 A;  3UX2 A;  2OO4 A;  2YCB A;  3E7X A;  4OYC A;  1FUG A;  4GXR A;  4ZJZ A;  4DR1 C;  4X64 C;  1HR0 C;  4LF8 C;  4NXN C;  1PG3 A;  4DCU A;  4RVN A;  4LFC C;  3A9V A;  3JAM D;  2ZZN A;  3LNV A;  2ZZM A;  4G1I A;  2V7B A;  3IEV A;  4FUQ A;  2UXC C;  4LFA C;  3RG2 A;  3CW9 A;  1P4E A;  1V25 A;  3CQ1 A;  3GPC A;  4JI7 C;  2YWC A;  4BBY A;  4G36 A;  2E8F A;  5BSW A;  1I94 C;  1QWI A;  4DV4 C;  3ETO A;  3ETC A;  4I9F A;  1T5D X;  1MDF A;  4G37 A;  1ZB8 A;  2PN2 A;  4PRO C;  2Y4N A;  3NYR A;  4LF4 C;  4RLF A;  4LF7 C;  2UUB C;  1TH5 A;  2MM9 A; 
#chains in the Genus database with same CATH homology
 1FJG C;  2D28 C;  4ZLP A;  3GR1 A;  1MKY A;  3R9W A;  4B3R C;  3NPD A;  4PHT A;  4DR5 C;  4L4Q A;  4D56 A;  4R1M A;  3IPL A;  4DV3 C;  2WP0 C;  1USP A;  1MXA A;  4DV7 C;  4JYA C;  1PG4 A;  5DV9 A;  4RVO A;  4MTN A;  2E7G A;  1USP B;  4DG8 A;  2BJO A;  5KYT A;  3A9U A;  1LCI A;  4DUY C;  3IEU A;  1AMU A;  2E8E A;  5T8S A;  3PBK A;  1MXC A;  3TDE A;  2JMP A;  2XR1 A;  1LQL A;  4RLQ A;  4BC9 A;  5KEI A;  4DV5 C;  3LAX A;  2HJG A;  5K85 A;  2KZF A;  1NYE A;  3TUF A;  2D7V A;  1IBK C;  1MXB A;  2UUC C;  1N36 C;  2UXD C;  4NXM C;  4R0M A;  3S82 A;  5BUR A;  4DV0 C;  4NOZ A;  4DCV A;  2Y4O A;  2P2M A;  4NDN A;  4X66 C;  1BA3 A;  5BST A;  4BCA A;  2P2F A;  5BSR A;  2QVY X;  4LF9 C;  5LMU C;  5BUS A;  4KTT A;  2BH1 X;  3CJE A;  3KXW A;  2VQE C;  3H2T A;  4DV6 C;  4X62 C;  4JI1 C;  4KHP C;  4FTF A;  1MD9 A;  2UUA C;  4AQY C;  4LE5 A;  4JV5 C;  2P2J A;  5T8T A;  5A1G A;  3PRO C;  2ZM6 C;  1QM4 A;  1K0R A;  2P2B A;  2P20 A;  1N33 C;  1HNZ C;  5A1I A;  3UOW A;  4OX9 C;  4RM2 A;  3I07 A;  1N34 C;  5JRH A;  2EGT A;  4U5Y D;  4OXI A;  4GKK C;  4ODJ A;  3TQI A;  1HNW C;  2UU9 C;  3UZ0 A;  3FCC A;  2QW0 X;  5AE3 A;  5IWA C;  3NYQ A;  1VLA A;  4DR4 C;  4B3S C;  5IT9 D;  2Y27 A;  4DR6 C;  4JM1 A;  3T1H C;  4K0B A;  4D4I A;  1UKK A;  3DHV A;  3B7W A;  3CW8 X;  1ZB9 A;  5BSU A;  3VNR A;  4D4G A;  4HPV A;  1N32 C;  2QVX X;  4KTV A;  4WV3 A;  4JI5 C;  3R44 A;  1V26 A;  2D1R A;  4FUT A;  4DV1 C;  3NI2 A;  3DAY A;  4GS5 A;  5CZV A;  5LMN C;  4BSZ A;  1IBM C;  1N2F A;  5AE1 A;  2VQF C;  4DR2 C;  4PZP A;  3VNQ A;  5CZX A;  4L7I A;  4DV2 C;  2YWB A;  1L2F A;  2HHH C;  1P7L A;  4MH4 A;  4LF6 C;  2DYJ A;  2E5L C;  2P02 A;  3FCE A;  1XNQ C;  1WH9 A;  3OTO C;  1MDB A;  3I08 A;  1RG9 A;  2D27 A;  4LF5 C;  5IFI A;  5E7Q A;  3GR0 A;  1YJ7 A;  1XRA A;  4D57 A;  4DR7 C;  3EQ6 A;  3LUS A;  3J80 D;  1XMO C;  3N54 B;  2AYA A;  5AE2 A;  5FLX D;  3EER A;  5BSV A;  4DUZ C;  3R9X A;  2D1S A;  5ADZ A;  3SO4 A;  1HH2 P;  1O90 A;  4JI2 C;  4DCT A;  4YHH C;  3GKU A;  1XNR C;  1ULT A;  4K0K C;  3E7W A;  1RY2 A;  3T1Y C;  1IBL C;  2WD9 A;  3VNS A;  5K8F A;  4JI8 C;  5BR8 C;  3L95 X;  1O9T A;  3G7S A;  2CXC A;  4EAT A;  4I9G A;  1ML8 A;  4GKJ C;  2VZE A;  1O93 A;  2CY1 A;  2OBV A;  2D1Q A;  3N2Q A;  4JI4 C;  2DPL A;  3J81 D;  2D1T A;  3DLP X;  4RM3 A;  4XX2 A;  5A2Q D;  3IML A;  3AF5 A;  4RMN A;  2ASB A;  3L8C A;  2PT7 G;  5GTD A;  5BUQ A;  2E8C A;  3A4I A;  3C5E A;  2UXB C;  1XRB A;  4ISB A;  4DCS A;  1JOS A;  4JI3 C;  1WF3 A;  1XRC A;  3PES A;  1J5E C;  2QL8 A;  2VSQ A;  2E0G A;  2QVZ X;  4IR7 A;  2ONF A;  5KYV A;  5H9U A;  1PA4 A;  3RV2 A;  4X65 C;  4B3M C;  4YY3 C;  2F4V C;  2ATW A;  2OPL A;  4TPS B;  4DR3 C;  3AF6 A;  1EGA A;  3LGX A;  4IZ6 A;  2OPL B;  1XMQ C;  4B3T C;  2PRO A;  1HNX C;  4L2Z A;  4BC7 A;  4WS9 A;  2P2Q A;  5A19 A;  4JI0 C;  1KKG A;  4R1L A;  4JI6 C;  5BSM A;  1T5H X;  1GPM A;  4LFB C;  4GXQ A;  1O92 A;  4DG9 A;  2OO4 A;  2YCB A;  3E7X A;  4OYC A;  1FUG A;  4GXR A;  4ZJZ A;  4DR1 C;  4X64 C;  1HR0 C;  4LF8 C;  4NXN C;  1PG3 A;  4DCU A;  4RVN A;  4LFC C;  3A9V A;  3JAM D;  3LNV A;  4G1I A;  2V7B A;  3IEV A;  4FUQ A;  2UXC C;  4LFA C;  3RG2 A;  3CW9 A;  1V25 A;  3GPC A;  4JI7 C;  2YWC A;  4BBY A;  4G36 A;  2E8F A;  5BSW A;  1I94 C;  1QWI A;  4DV4 C;  3ETO A;  3ETC A;  4I9F A;  1T5D X;  1MDF A;  4G37 A;  1ZB8 A;  2PN2 A;  4PRO C;  2Y4N A;  3NYR A;  4LF4 C;  4RLF A;  4LF7 C;  2UUB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...