2M5OA

Solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHMGSEEDDGVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
publication title Solution NMR Structure CTD domain of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876C
rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
total genus 26
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2m5oA01
3CQ1A 3UX3A 3LNOA 1TH5A 1VEHA 2CU6A 1UWDA 1XHJA 2JNVA 3CQ2A 3UX2A 2Z51A 3CQ3A 2M5OA 2M5HA 1WCJA
chains in the Genus database with same CATH superfamily
2OO4A 5AE3A 4K0KC 1XRBA 1J5EC 3OTOC 1RG9A 4FUTA 2QVXX 5BUQA 2E7GA 2M5OA 4U5YD 1IBLC 4KTVA 2PN2A 4GXRA 3J81D 2ONFA 4JI8C 4RLQA 3AF6A 2P2JA 3TDEA 2VSQA 3PROC 3GR1A 2ZZMA 2Y4OA 1ULTA 4B3RC 4IZ6A 4G36A 4LF8C 3DAYA 5T8SA 4D4GA 4YY3C 1VEHA 2P02A 2Z51A 3A25A 5BSUA 4K0BA 4JI0C 4BCAA 2E8FA 1P4EA 3E7XA 4BC9A 4BC7A 1XNRC 2DHMA 3DLPX 3IEVA 1MKYA 4DG8A 4NDNA 3GKUA 4JI2C 4X65C 2DYJA 3A9VA 1MXBA 4DR1C 3R9WA 2UUAC 1FJGC 3N2QA 1XRAA 3ETCA 3PESA 1USPA 3NYRA 3O2EA 2KZFA 4MTNA 1V60A 1IBMC 4PUGA 4WS9A 4DV7C 3L95X 5AE2A 4FUQA 4DCTA 4LF6C 3A26A 4DR2C 2E8EA 1XMOC 4LE5A 3UX3A 1M6XC 1N32C 2AYAA 2Y27A 3CW9A 3TR3A 3AF5A 2P2QA 2E5LC 2OPLB 4DR7C 4YHHC 5IWAC 1QM4A 3E7WA 2UUCC 4BSZA 4GKKC 1MXAA 5LCIA 3CW8X 1V26A 2PROA 5K85A 3B7WA 1GPMA 3G7SA 5LMUC 2QW0X 5GTDA 4LFAC 3VNRA 1IB8A 4DV6C 3IMLA 1LQLA 3R44A 4B3SC 2KDNA 3I08A 3NPDA 2ZZNA 5BR8C 1NYEA 1YJ7A 4JI6C 1T5HX 1FUGA 5CZVA 4GXQA 4XX2A 2YWBA 3UOWA 3LNVA 2E8CA 1HH2P 4KTTA 3UEBA 4DCSA 1XHJA 4DUZC 1HR0C 1HNZC 1VLAA 3LAXA 1HNXC 4WV3A 3CQ1A 3T1HC 4OXIA 5AE1A 4DV4C 3ETOA 2ATWA 5A1GA 4ZLPA 3NYQA 2DPLA 5T8TA 4GS5A 1L2FA 4R1MA 5FLXD 2HHHC 5JRHA 2HJGA 4JI7C 4LF4C 3C5EA 3H2TA 4JI1C 2WD9A 2XR1A 2CY1A 4EATA 2EGTA 4RLFA 4D4IA 2QVYX 1BA3A 3DHVA 3EQ6A 1EGAA 2CXCA 3CQ3A 5BSMA 4X66C 3UX2A 1P7LA 4ISBA 2MMAB 4B3MC 3CJEA 1I94C 4NXNC 2NCLA 2UXBC 5CZXA 4DUYC 1P4EC 4L7IA 1N36C 1IBKC 1N2FA 5ADZA 2E0GA 2QVZX 3TQIA 4MH4A 2ZM6C 1O9TA 1AMUA 2Y4NA 5BURA 2ASBA 2YWCA 4PHTA 4HPVA 4TPSB 3FCCA 4I9GA 4GKJC 3L8CA 3GR0A 4JI4C 1LCIA 4R0MA 4I9FA 5BUSA 2D1TA 2PT7G 4JV5C 4L4QA 1HNWC 2F4VC 4D57A 2P2FA 1MDBA 4DCUA 2UUBC 5BSWA 4PUIA 4R1LA 4DR5C 1N33C 4JYAC 1ZB8A 3RG2A 5H9UA 3VNSA 1FLOA 2BJOA 4LF9C 4LFCC 4DR3C 1O90A 1JOSA 1WCJA 2MM9A 4B3TC 1RY2A 4OYCA 4JI5C 4PUHA 2YX1A 1UKKA 3LGXA 2D1QA 2UXCC 1O92A 2OBVA 3RV2A 1PG4A 1ZB9A 5A2QD 1NY8A 4IR7A 3EERA 5A19A 3TUFA 4DV5C 2VZEA 1K0RA 4OX9C 4RM2A 1XMQC 2KZ0A 4JM1A 5BSTA 1XS3A 3FCEA 3I07A 1N34C 3S82A 1PG3A 4X62C 1PA4A 4DG9A 5DV9A 4PROC 5K8FA 4DV1C 3JAMD 5A1IA 3R9XA 1WH9A 2YCBA 3KXWA 4NXMC 4DCVA 2MCQA 3UZ0A 3A9UA 5LMNC 1T5DX 3IPLA 1TH5A 3NI2A 2D27A 2JNVA 3T1YC 2WP0C 3GPCA 4G1IA 1KKGA 4FTFA 2UXDC 4LF5C 2D1RA 5IT9D 2D7VA 1USPB 4ODJA 4JI3C 2P2MA 4G37A 1PU1A 4AQYC 4RM3A 2D1SA 4L2ZA 1M6XA 3LNOA 2CU6A 1V25A 4RVOA 2QL8A 4D56A 4X64C 5BSVA 1ML8A 3CQ2A 3K6RA 4BBYA 2BH1X 3AY0A 4ZJZA 4DV3C 4LF7C 2VQEC 1XNQC 5KYTA 1MD9A 2VQFC 1QWIA 5BSRA 2D28C 4NOZA 3VNQA 3LUSA 4DR4C 3J80D 2V7BA 2OPLA 1MXCA 4RVNA 2P20A 1XRCA 5KYVA 4DR6C 3A4IA 4DV2C 4LFBC 2P2BA 3N54B 5E7QA 4KHPC 3IEUA 1MDFA 4RMNA 2UU9C 4DV0C 3SO4A 3PBKA 1UWDA 4PZPA 1O93A 5KEIA 1WF3A 2JMPA 5IFIA 2M5HA
chains in the Genus database with same CATH topology
3CQ1A 3UX3A 3LNOA 1TH5A 1VEHA 2CU6A 1UWDA 1XHJA 2JNVA 3CQ2A 3UX2A 2Z51A 3CQ3A 2M5OA 2M5HA 1WCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ1 A;  3UX3 A;  3LNO A;  1TH5 A;  1VEH A;  2CU6 A;  1UWD A;  1XHJ A;  2JNV A;  3CQ2 A;  3UX2 A;  2Z51 A;  3CQ3 A;  2M5O A;  2M5H A;  1WCJ A; 
#chains in the Genus database with same CATH topology
 2OO4 A;  5AE3 A;  4K0K C;  1XRB A;  1J5E C;  3OTO C;  1RG9 A;  4FUT A;  2QVX X;  5BUQ A;  2E7G A;  2M5O A;  4U5Y D;  1IBL C;  4KTV A;  2PN2 A;  4GXR A;  3J81 D;  2ONF A;  4JI8 C;  4RLQ A;  3AF6 A;  2P2J A;  3TDE A;  2VSQ A;  3PRO C;  3GR1 A;  2ZZM A;  2Y4O A;  1ULT A;  4B3R C;  4IZ6 A;  4G36 A;  4LF8 C;  3DAY A;  5T8S A;  4D4G A;  4YY3 C;  1VEH A;  2P02 A;  2Z51 A;  3A25 A;  5BSU A;  4K0B A;  4JI0 C;  4BCA A;  2E8F A;  1P4E A;  3E7X A;  4BC9 A;  4BC7 A;  1XNR C;  2DHM A;  3DLP X;  3IEV A;  1MKY A;  4DG8 A;  4NDN A;  3GKU A;  4JI2 C;  4X65 C;  2DYJ A;  3A9V A;  1MXB A;  4DR1 C;  3R9W A;  2UUA C;  1FJG C;  3N2Q A;  1XRA A;  3ETC A;  3PES A;  1USP A;  3NYR A;  3O2E A;  2KZF A;  4MTN A;  1V60 A;  1IBM C;  4PUG A;  4WS9 A;  4DV7 C;  3L95 X;  5AE2 A;  4FUQ A;  4DCT A;  4LF6 C;  3A26 A;  4DR2 C;  2E8E A;  1XMO C;  4LE5 A;  3UX3 A;  1M6X C;  1N32 C;  2AYA A;  2Y27 A;  3CW9 A;  3TR3 A;  3AF5 A;  2P2Q A;  2E5L C;  2OPL B;  4DR7 C;  4YHH C;  5IWA C;  1QM4 A;  3E7W A;  2UUC C;  4BSZ A;  4GKK C;  1MXA A;  5LCI A;  3CW8 X;  1V26 A;  2PRO A;  5K85 A;  3B7W A;  1GPM A;  3G7S A;  5LMU C;  2QW0 X;  5GTD A;  4LFA C;  3VNR A;  1IB8 A;  4DV6 C;  3IML A;  1LQL A;  3R44 A;  4B3S C;  2KDN A;  3I08 A;  3NPD A;  2ZZN A;  5BR8 C;  1NYE A;  1YJ7 A;  4JI6 C;  1T5H X;  1FUG A;  5CZV A;  4GXQ A;  4XX2 A;  2YWB A;  3UOW A;  3LNV A;  2E8C A;  1HH2 P;  4KTT A;  3UEB A;  4DCS A;  1XHJ A;  4DUZ C;  1HR0 C;  1HNZ C;  1VLA A;  3LAX A;  1HNX C;  4WV3 A;  3CQ1 A;  3T1H C;  4OXI A;  5AE1 A;  4DV4 C;  3ETO A;  2ATW A;  5A1G A;  4ZLP A;  3NYQ A;  2DPL A;  5T8T A;  4GS5 A;  1L2F A;  4R1M A;  5FLX D;  2HHH C;  5JRH A;  2HJG A;  4JI7 C;  4LF4 C;  3C5E A;  3H2T A;  4JI1 C;  2WD9 A;  2XR1 A;  2CY1 A;  4EAT A;  2EGT A;  4RLF A;  4D4I A;  2QVY X;  1BA3 A;  3DHV A;  3EQ6 A;  1EGA A;  2CXC A;  3CQ3 A;  5BSM A;  4X66 C;  3UX2 A;  1P7L A;  4ISB A;  2MMA B;  4B3M C;  3CJE A;  1I94 C;  4NXN C;  2NCL A;  2UXB C;  5CZX A;  4DUY C;  1P4E C;  4L7I A;  1N36 C;  1IBK C;  1N2F A;  5ADZ A;  2E0G A;  2QVZ X;  3TQI A;  4MH4 A;  2ZM6 C;  1O9T A;  1AMU A;  2Y4N A;  5BUR A;  2ASB A;  2YWC A;  4PHT A;  4HPV A;  4TPS B;  3FCC A;  4I9G A;  4GKJ C;  3L8C A;  3GR0 A;  4JI4 C;  1LCI A;  4R0M A;  4I9F A;  5BUS A;  2D1T A;  2PT7 G;  4JV5 C;  4L4Q A;  1HNW C;  2F4V C;  4D57 A;  2P2F A;  1MDB A;  4DCU A;  2UUB C;  5BSW A;  4PUI A;  4R1L A;  4DR5 C;  1N33 C;  4JYA C;  1ZB8 A;  3RG2 A;  5H9U A;  3VNS A;  1FLO A;  2BJO A;  4LF9 C;  4LFC C;  4DR3 C;  1O90 A;  1JOS A;  1WCJ A;  2MM9 A;  4B3T C;  1RY2 A;  4OYC A;  4JI5 C;  4PUH A;  2YX1 A;  1UKK A;  3LGX A;  2D1Q A;  2UXC C;  1O92 A;  2OBV A;  3RV2 A;  1PG4 A;  1ZB9 A;  5A2Q D;  1NY8 A;  4IR7 A;  3EER A;  5A19 A;  3TUF A;  4DV5 C;  2VZE A;  1K0R A;  4OX9 C;  4RM2 A;  1XMQ C;  2KZ0 A;  4JM1 A;  5BST A;  1XS3 A;  3FCE A;  3I07 A;  1N34 C;  3S82 A;  1PG3 A;  4X62 C;  1PA4 A;  4DG9 A;  5DV9 A;  4PRO C;  5K8F A;  4DV1 C;  3JAM D;  5A1I A;  3R9X A;  1WH9 A;  2YCB A;  3KXW A;  4NXM C;  4DCV A;  2MCQ A;  3UZ0 A;  3A9U A;  5LMN C;  1T5D X;  3IPL A;  1TH5 A;  3NI2 A;  2D27 A;  2JNV A;  3T1Y C;  2WP0 C;  3GPC A;  4G1I A;  1KKG A;  4FTF A;  2UXD C;  4LF5 C;  2D1R A;  5IT9 D;  2D7V A;  1USP B;  4ODJ A;  4JI3 C;  2P2M A;  4G37 A;  1PU1 A;  4AQY C;  4RM3 A;  2D1S A;  4L2Z A;  1M6X A;  3LNO A;  2CU6 A;  1V25 A;  4RVO A;  2QL8 A;  4D56 A;  4X64 C;  5BSV A;  1ML8 A;  3CQ2 A;  3K6R A;  4BBY A;  2BH1 X;  3AY0 A;  4ZJZ A;  4DV3 C;  4LF7 C;  2VQE C;  1XNQ C;  5KYT A;  1MD9 A;  2VQF C;  1QWI A;  5BSR A;  2D28 C;  4NOZ A;  3VNQ A;  3LUS A;  4DR4 C;  3J80 D;  2V7B A;  2OPL A;  1MXC A;  4RVN A;  2P20 A;  1XRC A;  5KYV A;  4DR6 C;  3A4I A;  4DV2 C;  4LFB C;  2P2B A;  3N54 B;  5E7Q A;  4KHP C;  3IEU A;  1MDF A;  4RMN A;  2UU9 C;  4DV0 C;  3SO4 A;  3PBK A;  1UWD A;  4PZP A;  1O93 A;  5KEI A;  1WF3 A;  2JMP A;  5IFI A;  2M5H A; 
#chains in the Genus database with same CATH homology
 3CQ1 A;  3UX3 A;  3LNO A;  1TH5 A;  1VEH A;  2CU6 A;  1UWD A;  1XHJ A;  2JNV A;  3CQ2 A;  3UX2 A;  2Z51 A;  3CQ3 A;  2M5O A;  2M5H A;  1WCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...