2M5OA

Solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHMGSEEDDGVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
publication title Solution NMR Structure CTD domain of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876C
rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
total genus 26
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2m5oA01
3CQ2A 1WCJA 3CQ1A 3CQ3A 2Z51A 1VEHA 3UX2A 1UWDA 2CU6A 1XHJA 2M5HA 2JNVA 2M5OA 3LNOA 3UX3A 1TH5A
chains in the Genus database with same CATH superfamily
4DUYC 1WF3A 1MD9A 1AMUA 2AYAA 3AF6A 1VLAA 3AF5A 2YWCA 1WH9A 5T8SA 3GKUA 2D28C 4PHTA 1HNXC 4GKJC 4I9FA 2OO4A 4DR7C 3CQ1A 4RLQA 2P2FA 5BUQA 4PUHA 2P2QA 4FUQA 3TDEA 3IMLA 4IR7A 3A9UA 2M5HA 2P02A 4GS5A 4LF4C 4JYAC 4KHPC 4DV7C 5IFIA 2BH1X 4DV6C 1XRBA 4G37A 3KXWA 2D1QA 4FUTA 1M6XA 1MDBA 2KZFA 5BSWA 4PZPA 1V26A 1RY2A 1P4EC 4PUGA 4JI4C 4DR6C 3TR3A 1FUGA 1QM4A 1P7LA 4X62C 5BURA 1ZB8A 1I94C 4G36A 5LMNC 3PBKA 5CZXA 3ETOA 4DUZC 4B3TC 4LFCC 4DCUA 2ASBA 4KTVA 2QL8A 3FCEA 1NYEA 4D4IA 4DR5C 3EQ6A 2UXCC 3N2QA 4B3MC 2E8FA 2E7GA 1M6XC 2M5OA 2UXDC 2D1SA 2JMPA 3TUFA 1LCIA 3LNVA 3NYRA 3ETCA 4BCAA 4L2ZA 2F4VC 2P2JA 1USPB 3PROC 2PN2A 1HNZC 4RM3A 1UKKA 5ADZA 5A1GA 3PESA 3A4IA 4PROC 4DCTA 3VNRA 4K0KC 3N54B 4WS9A 4NDNA 4RM2A 3B7WA 1LQLA 5T8TA 3RV2A 1J5EC 4MTNA 5KEIA 3DHVA 2ZM6C 3CW9A 2ZZMA 4LE5A 3J80D 4BBYA 4RLFA 2P20A 5KYTA 4DV2C 2EGTA 4DG9A 1PG4A 3LGXA 5BUSA 2CY1A 3R9XA 1MKYA 4JI6C 1IBMC 5A2QD 3I07A 4PUIA 4YHHC 4ZLPA 4JI1C 3CQ2A 3GPCA 4DV5C 4KTTA 4AQYC 4D57A 5K85A 4DCVA 2WD9A 1O90A 2YX1A 1MXAA 1XS3A 3VNQA 1PG3A 2KDNA 2YCBA 4RMNA 2E8EA 2VZEA 3E7XA 3E7WA 4B3RC 5H9UA 4IZ6A 2Y4NA 2VQFC 2OPLB 1YJ7A 4D56A 3CQ3A 2PROA 1PU1A 1N33C 1KKGA 4OYCA 5KYVA 4JI5C 4XX2A 2UUCC 5BSUA 3GR0A 1HNWC 3NPDA 3NYQA 2D1RA 4I9GA 1T5HX 4BSZA 2JNVA 4JI8C 3LNOA 2P2MA 2QVXX 4NOZA 4X64C 3FCCA 1JOSA 1HH2P 1GPMA 4GKKC 2E8CA 2UUBC 4LFBC 2OBVA 3A25A 5AE2A 1K0RA 3R44A 3DAYA 1FJGC 2WP0C 3IEUA 1N34C 4GXQA 2YWBA 2D7VA 2UU9C 5K8FA 2MCQA 4DR1C 4DG8A 4LFAC 2MMAB 3L95X 2PT7G 3RG2A 4D4GA 2MM9A 5JRHA 2NCLA 4NXMC 4K0BA 5E7QA 4X66C 5A19A 3IEVA 3UEBA 2QW0X 1XNQC 2Y4OA 4BC9A 3JAMD 1O9TA 2QVZX 4JI3C 4DCSA 3UZ0A 5IWAC 4LF8C 1XRCA 2P2BA 4LF9C 3EERA 2ZZNA 4DV3C 4EATA 1IB8A 2CXCA 5LMUC 1MDFA 5CZVA 2HHHC 1NY8A 2UUAC 3LUSA 2ATWA 1RG9A 1N32C 1N2FA 1XRAA 3I08A 3SO4A 3VNSA 2VSQA 4LF6C 2XR1A 4JI0C 2DYJA 4YY3C 4U5YD 4L4QA 2V7BA 1VEHA 2CU6A 1XMQC 5BSRA 1V60A 1O93A 4R0MA 5FLXD 1ULTA 3IPLA 3G7SA 4RVNA 2D27A 1P4EA 4DV1C 4L7IA 3A9VA 4LF7C 1V25A 1XMOC 1FLOA 1EGAA 1ML8A 4OXIA 5BR8C 2E5LC 5GTDA 4MH4A 4ISBA 1MXCA 1USPA 1BA3A 4G1IA 4WV3A 2UXBC 4DV0C 1IBKC 3L8CA 2KZ0A 4JV5C 1O92A 1XHJA 4DR3C 5AE3A 3DLPX 5BSMA 4BC7A 3OTOC 1N36C 2HJGA 3H2TA 3UX2A 5BSVA 3CW8X 1TH5A 3T1HC 4JI7C 5LCIA 4TPSB 4GXRA 4R1LA 1L2FA 2DPLA 1IBLC 1MXBA 1XNRC 3CJEA 5DV9A 4ODJA 3K6RA 1QWIA 2ONFA 1PA4A 4JM1A 4OX9C 1ZB9A 3LAXA 4NXNC 5BSTA 1UWDA 3O2EA 4X65C 4DV4C 4JI2C 5IT9D 3C5EA 3S82A 3UX3A 3A26A 3TQIA 3GR1A 3J81D 4ZJZA 2D1TA 2QVYX 2VQEC 4B3SC 5AE1A 2OPLA 3T1YC 2BJOA 3R9WA 2Z51A 4HPVA 2Y27A 4R1MA 4RVOA 4LF5C 1T5DX 3NI2A 2E0GA 1HR0C 5A1IA 3AY0A 4DR2C 1WCJA 4FTFA 4DR4C 3UOWA 2DHMA
chains in the Genus database with same CATH topology
3CQ2A 1WCJA 3CQ1A 3CQ3A 2Z51A 1VEHA 3UX2A 1UWDA 2CU6A 1XHJA 2M5HA 2JNVA 2M5OA 3LNOA 3UX3A 1TH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ2 A;  1WCJ A;  3CQ1 A;  3CQ3 A;  2Z51 A;  1VEH A;  3UX2 A;  1UWD A;  2CU6 A;  1XHJ A;  2M5H A;  2JNV A;  2M5O A;  3LNO A;  3UX3 A;  1TH5 A; 
#chains in the Genus database with same CATH topology
 4DUY C;  1WF3 A;  1MD9 A;  1AMU A;  2AYA A;  3AF6 A;  1VLA A;  3AF5 A;  2YWC A;  1WH9 A;  5T8S A;  3GKU A;  2D28 C;  4PHT A;  1HNX C;  4GKJ C;  4I9F A;  2OO4 A;  4DR7 C;  3CQ1 A;  4RLQ A;  2P2F A;  5BUQ A;  4PUH A;  2P2Q A;  4FUQ A;  3TDE A;  3IML A;  4IR7 A;  3A9U A;  2M5H A;  2P02 A;  4GS5 A;  4LF4 C;  4JYA C;  4KHP C;  4DV7 C;  5IFI A;  2BH1 X;  4DV6 C;  1XRB A;  4G37 A;  3KXW A;  2D1Q A;  4FUT A;  1M6X A;  1MDB A;  2KZF A;  5BSW A;  4PZP A;  1V26 A;  1RY2 A;  1P4E C;  4PUG A;  4JI4 C;  4DR6 C;  3TR3 A;  1FUG A;  1QM4 A;  1P7L A;  4X62 C;  5BUR A;  1ZB8 A;  1I94 C;  4G36 A;  5LMN C;  3PBK A;  5CZX A;  3ETO A;  4DUZ C;  4B3T C;  4LFC C;  4DCU A;  2ASB A;  4KTV A;  2QL8 A;  3FCE A;  1NYE A;  4D4I A;  4DR5 C;  3EQ6 A;  2UXC C;  3N2Q A;  4B3M C;  2E8F A;  2E7G A;  1M6X C;  2M5O A;  2UXD C;  2D1S A;  2JMP A;  3TUF A;  1LCI A;  3LNV A;  3NYR A;  3ETC A;  4BCA A;  4L2Z A;  2F4V C;  2P2J A;  1USP B;  3PRO C;  2PN2 A;  1HNZ C;  4RM3 A;  1UKK A;  5ADZ A;  5A1G A;  3PES A;  3A4I A;  4PRO C;  4DCT A;  3VNR A;  4K0K C;  3N54 B;  4WS9 A;  4NDN A;  4RM2 A;  3B7W A;  1LQL A;  5T8T A;  3RV2 A;  1J5E C;  4MTN A;  5KEI A;  3DHV A;  2ZM6 C;  3CW9 A;  2ZZM A;  4LE5 A;  3J80 D;  4BBY A;  4RLF A;  2P20 A;  5KYT A;  4DV2 C;  2EGT A;  4DG9 A;  1PG4 A;  3LGX A;  5BUS A;  2CY1 A;  3R9X A;  1MKY A;  4JI6 C;  1IBM C;  5A2Q D;  3I07 A;  4PUI A;  4YHH C;  4ZLP A;  4JI1 C;  3CQ2 A;  3GPC A;  4DV5 C;  4KTT A;  4AQY C;  4D57 A;  5K85 A;  4DCV A;  2WD9 A;  1O90 A;  2YX1 A;  1MXA A;  1XS3 A;  3VNQ A;  1PG3 A;  2KDN A;  2YCB A;  4RMN A;  2E8E A;  2VZE A;  3E7X A;  3E7W A;  4B3R C;  5H9U A;  4IZ6 A;  2Y4N A;  2VQF C;  2OPL B;  1YJ7 A;  4D56 A;  3CQ3 A;  2PRO A;  1PU1 A;  1N33 C;  1KKG A;  4OYC A;  5KYV A;  4JI5 C;  4XX2 A;  2UUC C;  5BSU A;  3GR0 A;  1HNW C;  3NPD A;  3NYQ A;  2D1R A;  4I9G A;  1T5H X;  4BSZ A;  2JNV A;  4JI8 C;  3LNO A;  2P2M A;  2QVX X;  4NOZ A;  4X64 C;  3FCC A;  1JOS A;  1HH2 P;  1GPM A;  4GKK C;  2E8C A;  2UUB C;  4LFB C;  2OBV A;  3A25 A;  5AE2 A;  1K0R A;  3R44 A;  3DAY A;  1FJG C;  2WP0 C;  3IEU A;  1N34 C;  4GXQ A;  2YWB A;  2D7V A;  2UU9 C;  5K8F A;  2MCQ A;  4DR1 C;  4DG8 A;  4LFA C;  2MMA B;  3L95 X;  2PT7 G;  3RG2 A;  4D4G A;  2MM9 A;  5JRH A;  2NCL A;  4NXM C;  4K0B A;  5E7Q A;  4X66 C;  5A19 A;  3IEV A;  3UEB A;  2QW0 X;  1XNQ C;  2Y4O A;  4BC9 A;  3JAM D;  1O9T A;  2QVZ X;  4JI3 C;  4DCS A;  3UZ0 A;  5IWA C;  4LF8 C;  1XRC A;  2P2B A;  4LF9 C;  3EER A;  2ZZN A;  4DV3 C;  4EAT A;  1IB8 A;  2CXC A;  5LMU C;  1MDF A;  5CZV A;  2HHH C;  1NY8 A;  2UUA C;  3LUS A;  2ATW A;  1RG9 A;  1N32 C;  1N2F A;  1XRA A;  3I08 A;  3SO4 A;  3VNS A;  2VSQ A;  4LF6 C;  2XR1 A;  4JI0 C;  2DYJ A;  4YY3 C;  4U5Y D;  4L4Q A;  2V7B A;  1VEH A;  2CU6 A;  1XMQ C;  5BSR A;  1V60 A;  1O93 A;  4R0M A;  5FLX D;  1ULT A;  3IPL A;  3G7S A;  4RVN A;  2D27 A;  1P4E A;  4DV1 C;  4L7I A;  3A9V A;  4LF7 C;  1V25 A;  1XMO C;  1FLO A;  1EGA A;  1ML8 A;  4OXI A;  5BR8 C;  2E5L C;  5GTD A;  4MH4 A;  4ISB A;  1MXC A;  1USP A;  1BA3 A;  4G1I A;  4WV3 A;  2UXB C;  4DV0 C;  1IBK C;  3L8C A;  2KZ0 A;  4JV5 C;  1O92 A;  1XHJ A;  4DR3 C;  5AE3 A;  3DLP X;  5BSM A;  4BC7 A;  3OTO C;  1N36 C;  2HJG A;  3H2T A;  3UX2 A;  5BSV A;  3CW8 X;  1TH5 A;  3T1H C;  4JI7 C;  5LCI A;  4TPS B;  4GXR A;  4R1L A;  1L2F A;  2DPL A;  1IBL C;  1MXB A;  1XNR C;  3CJE A;  5DV9 A;  4ODJ A;  3K6R A;  1QWI A;  2ONF A;  1PA4 A;  4JM1 A;  4OX9 C;  1ZB9 A;  3LAX A;  4NXN C;  5BST A;  1UWD A;  3O2E A;  4X65 C;  4DV4 C;  4JI2 C;  5IT9 D;  3C5E A;  3S82 A;  3UX3 A;  3A26 A;  3TQI A;  3GR1 A;  3J81 D;  4ZJZ A;  2D1T A;  2QVY X;  2VQE C;  4B3S C;  5AE1 A;  2OPL A;  3T1Y C;  2BJO A;  3R9W A;  2Z51 A;  4HPV A;  2Y27 A;  4R1M A;  4RVO A;  4LF5 C;  1T5D X;  3NI2 A;  2E0G A;  1HR0 C;  5A1I A;  3AY0 A;  4DR2 C;  1WCJ A;  4FTF A;  4DR4 C;  3UOW A;  2DHM A; 
#chains in the Genus database with same CATH homology
 3CQ2 A;  1WCJ A;  3CQ1 A;  3CQ3 A;  2Z51 A;  1VEH A;  3UX2 A;  1UWD A;  2CU6 A;  1XHJ A;  2M5H A;  2JNV A;  2M5O A;  3LNO A;  3UX3 A;  1TH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...