2M5OA

Solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHMGSEEDDGVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure CTD domain of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876C
rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
total genus 26
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2m5oA01
1UWDA 1VEHA 2Z51A 3UX2A 2JNVA 3UX3A 3CQ2A 2CU6A 3LNOA 2M5OA 1WCJA 1XHJA 2M5HA 3CQ3A 1TH5A 3CQ1A
chains in the Genus database with same CATH superfamily
2Y27A 3T1YC 4BCAA 4PUGA 3G7SA 2D7VA 4DV1C 4JI6C 3GPCA 1V60A 2D1TA 2E7GA 5CZVA 2ASBA 3FCEA 2P20A 1WCJA 1WH9A 2ZZMA 2P2FA 4DV5C 1O93A 4MTNA 4JI4C 3TR3A 4XX2A 4LFAC 1VEHA 3I08A 3E7WA 3LUSA 1LQLA 5A1IA 1QWIA 4U5YD 4L7IA 3PESA 1MXCA 4JI0C 2OPLA 3H2TA 1RG9A 3A26A 3T1HC 1O90A 3TUFA 4PUHA 5BSTA 3CQ1A 4DV3C 2P2QA 3LNOA 3NYQA 2E8EA 2QL8A 2CXCA 2PROA 4I9FA 1I94C 4KTTA 1V25A 2D1SA 4YHHC 2ZM6C 2CU6A 5BURA 4JM1A 1HR0C 1XNQC 1TH5A 2DHMA 4LF5C 4DR6C 1USPB 1IBLC 4K0BA 3B7WA 4B3TC 4DR1C 2ONFA 2V7BA 1N2FA 3A9UA 1MDFA 5BSUA 1ULTA 2JMPA 4B3SC 1O92A 3CW9A 4RVNA 5BSMA 4LF4C 2VQFC 4D57A 2P2MA 4DV2C 2E0GA 2VQEC 1RY2A 4JI2C 4LF7C 1ZB8A 4OXIA 3NYRA 2KZFA 4B3MC 4R0MA 3RV2A 5IT9D 3CQ3A 3PBKA 2E8CA 1FJGC 4FUQA 1LCIA 5CZXA 4R1LA 4DR7C 3EQ6A 4BSZA 2P02A 4RMNA 2P2BA 4NXMC 1N32C 4ODJA 1MXAA 1IBMC 1IB8A 1MDBA 3VNSA 4GKJC 4ZJZA 1UWDA 2DPLA 5BSVA 2JNVA 4FUTA 2E5LC 4FTFA 1XRCA 3CJEA 5DV9A 5LMNC 2MCQA 4RLQA 5K85A 1XMOC 2WP0C 1USPA 4DV7C 1N33C 2XR1A 2WD9A 2QVZX 3C5EA 4PUIA 3GR0A 4DV6C 5AE2A 4B3RC 5GTDA 4ISBA 1MD9A 3A25A 2Y4NA 3SO4A 4YY3C 4X64C 2MMAB 4G36A 2M5OA 4LFCC 1XMQC 1KKGA 1MKYA 4DUZC 2D1RA 4DUYC 5IFIA 3VNRA 4DG8A 5K8FA 3CW8X 5E7QA 1UKKA 5BR8C 2KDNA 4IR7A 4DV0C 1JOSA 4NOZA 3ETCA 2PN2A 4G1IA 4I9GA 4LF8C 2F4VC 2YX1A 2D27A 4WS9A 3IPLA 3OTOC 5A2QD 4DR3C 4EATA 1VLAA 2BH1X 3UX2A 3JAMD 3KXWA 1ML8A 3NPDA 2ATWA 3N54B 2E8FA 1M6XC 2OO4A 4X65C 1XNRC 2D1QA 5ADZA 3A9VA 5IWAC 5FLXD 1FLOA 4DCVA 4MH4A 4D4GA 4GS5A 2HJGA 1HNZC 3TQIA 4D56A 3DHVA 2MM9A 2QVXX 1T5DX 1NY8A 4LFBC 3L8CA 4AQYC 3AF6A 3NI2A 5KEIA 4JYAC 3IEUA 4RVOA 1PG4A 2CY1A 1PA4A 5AE1A 4NDNA 3N2QA 4ZLPA 4WV3A 4D4IA 1WF3A 2KZ0A 4BC7A 3VNQA 1XHJA 1K0RA 3LNVA 5KYTA 3A4IA 1J5EC 4K0KC 5BUQA 1GPMA 4PHTA 4KTVA 4LF6C 2HHHC 4JI5C 3TDEA 2EGTA 5A1GA 3AY0A 2YCBA 2M5HA 4LE5A 1XRBA 2VSQA 4L4QA 1HNXC 4DR2C 4RM2A 3R9XA 3R44A 4G37A 4JV5C 1ZB9A 4KHPC 2UU9C 4IZ6A 3S82A 2UUAC 4HPVA 1P4EA 3R9WA 2QVYX 2D28C 4GXQA 5BSWA 2Y4OA 1T5HX 5BUSA 2UUBC 1XRAA 5T8SA 3K6RA 5KYVA 1P4EC 1YJ7A 5LCIA 2DYJA 5T8TA 2UXBC 4OYCA 2UUCC 1PU1A 1MXBA 1XS3A 3DAYA 3CQ2A 3L95X 4R1MA 1P7LA 2AYAA 4L2ZA 1FUGA 3LAXA 4TPSB 1NYEA 3LGXA 4GKKC 2VZEA 3UZ0A 3IMLA 4JI3C 4JI1C 2QW0X 4PROC 3J80D 5LMUC 3AF5A 3UEBA 4JI8C 1N36C 1IBKC 4DG9A 2ZZNA 1EGAA 4DCUA 3O2EA 3GKUA 2NCLA 3UOWA 4DV4C 5H9UA 4X66C 4RM3A 1AMUA 5BSRA 3EERA 1PG3A 3DLPX 4RLFA 3GR1A 4DCSA 1HH2P 2YWBA 5A19A 3I07A 2YWCA 5AE3A 1N34C 3RG2A 2PT7G 3FCCA 4PZPA 3J81D 1M6XA 5JRHA 2BJOA 3ETOA 1BA3A 3PROC 4DCTA 4OX9C 4BC9A 1HNWC 1V26A 1O9TA 1L2FA 3IEVA 2UXCC 4NXNC 4BBYA 4LF9C 2UXDC 2OPLB 2Z51A 4JI7C 4X62C 2P2JA 2OBVA 4DR5C 3UX3A 4GXRA 1QM4A 4DR4C 3E7XA
chains in the Genus database with same CATH topology
1UWDA 1VEHA 2Z51A 3UX2A 2JNVA 3UX3A 3CQ2A 2CU6A 3LNOA 2M5OA 1WCJA 1XHJA 2M5HA 3CQ3A 1TH5A 3CQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWD A;  1VEH A;  2Z51 A;  3UX2 A;  2JNV A;  3UX3 A;  3CQ2 A;  2CU6 A;  3LNO A;  2M5O A;  1WCJ A;  1XHJ A;  2M5H A;  3CQ3 A;  1TH5 A;  3CQ1 A; 
#chains in the Genus database with same CATH topology
 2Y27 A;  3T1Y C;  4BCA A;  4PUG A;  3G7S A;  2D7V A;  4DV1 C;  4JI6 C;  3GPC A;  1V60 A;  2D1T A;  2E7G A;  5CZV A;  2ASB A;  3FCE A;  2P20 A;  1WCJ A;  1WH9 A;  2ZZM A;  2P2F A;  4DV5 C;  1O93 A;  4MTN A;  4JI4 C;  3TR3 A;  4XX2 A;  4LFA C;  1VEH A;  3I08 A;  3E7W A;  3LUS A;  1LQL A;  5A1I A;  1QWI A;  4U5Y D;  4L7I A;  3PES A;  1MXC A;  4JI0 C;  2OPL A;  3H2T A;  1RG9 A;  3A26 A;  3T1H C;  1O90 A;  3TUF A;  4PUH A;  5BST A;  3CQ1 A;  4DV3 C;  2P2Q A;  3LNO A;  3NYQ A;  2E8E A;  2QL8 A;  2CXC A;  2PRO A;  4I9F A;  1I94 C;  4KTT A;  1V25 A;  2D1S A;  4YHH C;  2ZM6 C;  2CU6 A;  5BUR A;  4JM1 A;  1HR0 C;  1XNQ C;  1TH5 A;  2DHM A;  4LF5 C;  4DR6 C;  1USP B;  1IBL C;  4K0B A;  3B7W A;  4B3T C;  4DR1 C;  2ONF A;  2V7B A;  1N2F A;  3A9U A;  1MDF A;  5BSU A;  1ULT A;  2JMP A;  4B3S C;  1O92 A;  3CW9 A;  4RVN A;  5BSM A;  4LF4 C;  2VQF C;  4D57 A;  2P2M A;  4DV2 C;  2E0G A;  2VQE C;  1RY2 A;  4JI2 C;  4LF7 C;  1ZB8 A;  4OXI A;  3NYR A;  2KZF A;  4B3M C;  4R0M A;  3RV2 A;  5IT9 D;  3CQ3 A;  3PBK A;  2E8C A;  1FJG C;  4FUQ A;  1LCI A;  5CZX A;  4R1L A;  4DR7 C;  3EQ6 A;  4BSZ A;  2P02 A;  4RMN A;  2P2B A;  4NXM C;  1N32 C;  4ODJ A;  1MXA A;  1IBM C;  1IB8 A;  1MDB A;  3VNS A;  4GKJ C;  4ZJZ A;  1UWD A;  2DPL A;  5BSV A;  2JNV A;  4FUT A;  2E5L C;  4FTF A;  1XRC A;  3CJE A;  5DV9 A;  5LMN C;  2MCQ A;  4RLQ A;  5K85 A;  1XMO C;  2WP0 C;  1USP A;  4DV7 C;  1N33 C;  2XR1 A;  2WD9 A;  2QVZ X;  3C5E A;  4PUI A;  3GR0 A;  4DV6 C;  5AE2 A;  4B3R C;  5GTD A;  4ISB A;  1MD9 A;  3A25 A;  2Y4N A;  3SO4 A;  4YY3 C;  4X64 C;  2MMA B;  4G36 A;  2M5O A;  4LFC C;  1XMQ C;  1KKG A;  1MKY A;  4DUZ C;  2D1R A;  4DUY C;  5IFI A;  3VNR A;  4DG8 A;  5K8F A;  3CW8 X;  5E7Q A;  1UKK A;  5BR8 C;  2KDN A;  4IR7 A;  4DV0 C;  1JOS A;  4NOZ A;  3ETC A;  2PN2 A;  4G1I A;  4I9G A;  4LF8 C;  2F4V C;  2YX1 A;  2D27 A;  4WS9 A;  3IPL A;  3OTO C;  5A2Q D;  4DR3 C;  4EAT A;  1VLA A;  2BH1 X;  3UX2 A;  3JAM D;  3KXW A;  1ML8 A;  3NPD A;  2ATW A;  3N54 B;  2E8F A;  1M6X C;  2OO4 A;  4X65 C;  1XNR C;  2D1Q A;  5ADZ A;  3A9V A;  5IWA C;  5FLX D;  1FLO A;  4DCV A;  4MH4 A;  4D4G A;  4GS5 A;  2HJG A;  1HNZ C;  3TQI A;  4D56 A;  3DHV A;  2MM9 A;  2QVX X;  1T5D X;  1NY8 A;  4LFB C;  3L8C A;  4AQY C;  3AF6 A;  3NI2 A;  5KEI A;  4JYA C;  3IEU A;  4RVO A;  1PG4 A;  2CY1 A;  1PA4 A;  5AE1 A;  4NDN A;  3N2Q A;  4ZLP A;  4WV3 A;  4D4I A;  1WF3 A;  2KZ0 A;  4BC7 A;  3VNQ A;  1XHJ A;  1K0R A;  3LNV A;  5KYT A;  3A4I A;  1J5E C;  4K0K C;  5BUQ A;  1GPM A;  4PHT A;  4KTV A;  4LF6 C;  2HHH C;  4JI5 C;  3TDE A;  2EGT A;  5A1G A;  3AY0 A;  2YCB A;  2M5H A;  4LE5 A;  1XRB A;  2VSQ A;  4L4Q A;  1HNX C;  4DR2 C;  4RM2 A;  3R9X A;  3R44 A;  4G37 A;  4JV5 C;  1ZB9 A;  4KHP C;  2UU9 C;  4IZ6 A;  3S82 A;  2UUA C;  4HPV A;  1P4E A;  3R9W A;  2QVY X;  2D28 C;  4GXQ A;  5BSW A;  2Y4O A;  1T5H X;  5BUS A;  2UUB C;  1XRA A;  5T8S A;  3K6R A;  5KYV A;  1P4E C;  1YJ7 A;  5LCI A;  2DYJ A;  5T8T A;  2UXB C;  4OYC A;  2UUC C;  1PU1 A;  1MXB A;  1XS3 A;  3DAY A;  3CQ2 A;  3L95 X;  4R1M A;  1P7L A;  2AYA A;  4L2Z A;  1FUG A;  3LAX A;  4TPS B;  1NYE A;  3LGX A;  4GKK C;  2VZE A;  3UZ0 A;  3IML A;  4JI3 C;  4JI1 C;  2QW0 X;  4PRO C;  3J80 D;  5LMU C;  3AF5 A;  3UEB A;  4JI8 C;  1N36 C;  1IBK C;  4DG9 A;  2ZZN A;  1EGA A;  4DCU A;  3O2E A;  3GKU A;  2NCL A;  3UOW A;  4DV4 C;  5H9U A;  4X66 C;  4RM3 A;  1AMU A;  5BSR A;  3EER A;  1PG3 A;  3DLP X;  4RLF A;  3GR1 A;  4DCS A;  1HH2 P;  2YWB A;  5A19 A;  3I07 A;  2YWC A;  5AE3 A;  1N34 C;  3RG2 A;  2PT7 G;  3FCC A;  4PZP A;  3J81 D;  1M6X A;  5JRH A;  2BJO A;  3ETO A;  1BA3 A;  3PRO C;  4DCT A;  4OX9 C;  4BC9 A;  1HNW C;  1V26 A;  1O9T A;  1L2F A;  3IEV A;  2UXC C;  4NXN C;  4BBY A;  4LF9 C;  2UXD C;  2OPL B;  2Z51 A;  4JI7 C;  4X62 C;  2P2J A;  2OBV A;  4DR5 C;  3UX3 A;  4GXR A;  1QM4 A;  4DR4 C;  3E7X A; 
#chains in the Genus database with same CATH homology
 1UWD A;  1VEH A;  2Z51 A;  3UX2 A;  2JNV A;  3UX3 A;  3CQ2 A;  2CU6 A;  3LNO A;  2M5O A;  1WCJ A;  1XHJ A;  2M5H A;  3CQ3 A;  1TH5 A;  3CQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...