2M5OA

Solution nmr structure ctd domain of nfu1 iron-sulfur cluster scaffold homolog from homo sapiens, northeast structural genomics consortium (nesg) target hr2876c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
MGHHHHHHSHMGSEEDDGVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
publication title Solution NMR Structure CTD domain of NFU1 Iron-Sulfur Cluster Scaffold Homolog from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR2876C
rcsb
source organism Homo sapiens
total genus 26
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2m5oA01
1TH5A 2JNVA 3CQ3A 3CQ1A 1XHJA 1WCJA 3UX2A 3CQ2A 2CU6A 1UWDA 2M5HA 1VEHA 2M5OA 3UX3A 2Z51A 3LNOA
chains in the Genus database with same CATH superfamily
2V7BA 1XS3A 4BBYA 3CJEA 3GR0A 2ASBA 1HR0C 2CY1A 4DV7C 4BCAA 4MTNA 4FUQA 1FLOA 3H2TA 4DCSA 5AE2A 2VSQA 1IBKC 1N32C 3VNQA 4X65C 3J80D 4DR7C 1ZB8A 1O90A 4D56A 4GXRA 3I08A 1K0RA 5BSUA 2UUCC 4DV1C 2HJGA 1XRCA 1LCIA 2D1RA 1NYEA 4FTFA 4DUZC 4BC7A 5GTDA 3FCCA 3TQIA 2Y4NA 1BA3A 1XNQC 5CZVA 4KHPC 1O92A 5FLXD 2D7VA 4EATA 1MKYA 4LF7C 5BUSA 4PUGA 3UEBA 2UXCC 2CXCA 4GKKC 1WF3A 4U5YD 4DR5C 3G7SA 1XHJA 2QL8A 4JI1C 4GXQA 4PUIA 2MCQA 3N54B 5BSWA 2M5HA 5H9UA 1JOSA 4B3SC 3NYRA 4R1MA 4OXIA 1HNXC 4WS9A 1IBMC 5BURA 1MXCA 4L7IA 1LQLA 2Z51A 3JAMD 3GPCA 1UKKA 3PROC 1IBLC 3FCEA 5ADZA 4JYAC 1PU1A 4RM3A 4DR6C 2P20A 1VLAA 4NXMC 4G36A 2D1QA 3UOWA 4DCTA 4RMNA 2VQFC 2OPLA 4GKJC 3IEUA 4DV0C 4K0KC 1P7LA 1XMOC 5BSTA 1RY2A 3LUSA 1FJGC 3OTOC 4PUHA 1IB8A 3CQ3A 2OBVA 5K8FA 4L2ZA 3R44A 5JRHA 2YCBA 4LF9C 2EGTA 2DHMA 1USPB 3CQ2A 5DV9A 4JV5C 3NI2A 5BR8C 2OO4A 3LNVA 1O93A 1GPMA 4FUTA 2ZM6C 4JI5C 2PROA 4B3TC 4JI8C 5BSRA 3AF5A 3LAXA 1T5HX 5A1IA 2P2BA 5AE1A 4IR7A 1V26A 5A1GA 1XRAA 2UUAC 1MXBA 1M6XA 4IZ6A 2Y4OA 4HPVA 2E8EA 3IMLA 2D27A 4DV3C 1MD9A 3VNRA 3DLPX 5E7QA 3A9UA 4X64C 4LE5A 4YY3C 5T8SA 5LCIA 2D28C 2VZEA 4I9FA 3SO4A 2YX1A 4ZJZA 1UWDA 4JI6C 4LF5C 1MDFA 1J5EC 2QVXX 4D4GA 5A19A 4I9GA 4LF8C 4NOZA 2E5LC 2P2QA 1N33C 4RVNA 1P4EA 4AQYC 2PN2A 3E7WA 4DUYC 4DG8A 1MXAA 3AF6A 2UXBC 5CZXA 3CQ1A 2YWCA 3CW9A 1ML8A 3NPDA 4BC9A 4JI7C 1T5DX 4LFCC 1PG3A 2DPLA 3EERA 2UUBC 1O9TA 4JI0C 2F4VC 1VEHA 3RG2A 2ATWA 3LGXA 4MH4A 2P2MA 2QVZX 2D1TA 3A9VA 3ETOA 1HH2P 4DV4C 4TPSB 4RM2A 4PHTA 2VQEC 1WCJA 3UZ0A 4XX2A 4KTVA 3O2EA 2P2JA 4DCUA 2AYAA 5IFIA 4JM1A 4ISBA 3L95X 4G37A 4GS5A 1TH5A 5KEIA 4ODJA 2KZFA 5T8TA 1I94C 1MDBA 1XRBA 3A26A 5KYVA 2CU6A 2D1SA 4X66C 2QW0X 2OPLB 3GR1A 3NYQA 3R9XA 3KXWA 4R1LA 4D57A 3LNOA 3L8CA 2P02A 3PBKA 3N2QA 5BSMA 2UU9C 1QWIA 2E8CA 1PG4A 4L4QA 3S82A 5IT9D 1ULTA 5IWAC 4DR4C 3IPLA 1HNWC 2QVYX 2E0GA 4G1IA 1WH9A 1PA4A 4X62C 4DR2C 4BSZA 2M5OA 4RLQA 4JI2C 4OYCA 1N36C 1V25A 3E7XA 3AY0A 4PZPA 2E8FA 4OX9C 2E7GA 5BSVA 4DG9A 4DR1C 3DAYA 1EGAA 4PROC 4JI4C 4LFBC 3TUFA 3B7WA 5LMUC 3UX2A 3DHVA 3ETCA 3RV2A 4B3MC 2Y27A 1N2FA 2YWBA 1V60A 3TDEA 4DV6C 2BJOA 3GKUA 3I07A 2JMPA 1USPA 5LMNC 2JNVA 2HHHC 5K85A 2DYJA 3C5EA 3K6RA 2KDNA 2ZZMA 4DV5C 5A2QD 3IEVA 4RLFA 1YJ7A 4LFAC 3A25A 4YHHC 1XMQC 1XNRC 3PESA 2P2FA 2WP0C 1FUGA 3A4IA 4B3RC 3T1HC 3T1YC 4D4IA 1QM4A 5KYTA 4DR3C 1M6XC 1RG9A 4KTTA 1ZB9A 2KZ0A 1N34C 4NXNC 4WV3A 3VNSA 4DCVA 2ONFA 4ZLPA 1AMUA 2BH1X 3TR3A 5AE3A 2NCLA 2ZZNA 2MMAB 4R0MA 2PT7G 4DV2C 4NDNA 2XR1A 5BUQA 4K0BA 3R9WA 3CW8X 3J81D 1NY8A 1HNZC 4LF4C 1P4EC 4RVOA 2UXDC 2WD9A 4JI3C 2MM9A 4LF6C 1KKGA 1L2FA 3UX3A 3EQ6A
chains in the Genus database with same CATH topology
1TH5A 2JNVA 3CQ3A 3CQ1A 1XHJA 1WCJA 3UX2A 3CQ2A 2CU6A 1UWDA 2M5HA 1VEHA 2M5OA 3UX3A 2Z51A 3LNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TH5 A;  2JNV A;  3CQ3 A;  3CQ1 A;  1XHJ A;  1WCJ A;  3UX2 A;  3CQ2 A;  2CU6 A;  1UWD A;  2M5H A;  1VEH A;  2M5O A;  3UX3 A;  2Z51 A;  3LNO A; 
#chains in the Genus database with same CATH topology
 2V7B A;  1XS3 A;  4BBY A;  3CJE A;  3GR0 A;  2ASB A;  1HR0 C;  2CY1 A;  4DV7 C;  4BCA A;  4MTN A;  4FUQ A;  1FLO A;  3H2T A;  4DCS A;  5AE2 A;  2VSQ A;  1IBK C;  1N32 C;  3VNQ A;  4X65 C;  3J80 D;  4DR7 C;  1ZB8 A;  1O90 A;  4D56 A;  4GXR A;  3I08 A;  1K0R A;  5BSU A;  2UUC C;  4DV1 C;  2HJG A;  1XRC A;  1LCI A;  2D1R A;  1NYE A;  4FTF A;  4DUZ C;  4BC7 A;  5GTD A;  3FCC A;  3TQI A;  2Y4N A;  1BA3 A;  1XNQ C;  5CZV A;  4KHP C;  1O92 A;  5FLX D;  2D7V A;  4EAT A;  1MKY A;  4LF7 C;  5BUS A;  4PUG A;  3UEB A;  2UXC C;  2CXC A;  4GKK C;  1WF3 A;  4U5Y D;  4DR5 C;  3G7S A;  1XHJ A;  2QL8 A;  4JI1 C;  4GXQ A;  4PUI A;  2MCQ A;  3N54 B;  5BSW A;  2M5H A;  5H9U A;  1JOS A;  4B3S C;  3NYR A;  4R1M A;  4OXI A;  1HNX C;  4WS9 A;  1IBM C;  5BUR A;  1MXC A;  4L7I A;  1LQL A;  2Z51 A;  3JAM D;  3GPC A;  1UKK A;  3PRO C;  1IBL C;  3FCE A;  5ADZ A;  4JYA C;  1PU1 A;  4RM3 A;  4DR6 C;  2P20 A;  1VLA A;  4NXM C;  4G36 A;  2D1Q A;  3UOW A;  4DCT A;  4RMN A;  2VQF C;  2OPL A;  4GKJ C;  3IEU A;  4DV0 C;  4K0K C;  1P7L A;  1XMO C;  5BST A;  1RY2 A;  3LUS A;  1FJG C;  3OTO C;  4PUH A;  1IB8 A;  3CQ3 A;  2OBV A;  5K8F A;  4L2Z A;  3R44 A;  5JRH A;  2YCB A;  4LF9 C;  2EGT A;  2DHM A;  1USP B;  3CQ2 A;  5DV9 A;  4JV5 C;  3NI2 A;  5BR8 C;  2OO4 A;  3LNV A;  1O93 A;  1GPM A;  4FUT A;  2ZM6 C;  4JI5 C;  2PRO A;  4B3T C;  4JI8 C;  5BSR A;  3AF5 A;  3LAX A;  1T5H X;  5A1I A;  2P2B A;  5AE1 A;  4IR7 A;  1V26 A;  5A1G A;  1XRA A;  2UUA C;  1MXB A;  1M6X A;  4IZ6 A;  2Y4O A;  4HPV A;  2E8E A;  3IML A;  2D27 A;  4DV3 C;  1MD9 A;  3VNR A;  3DLP X;  5E7Q A;  3A9U A;  4X64 C;  4LE5 A;  4YY3 C;  5T8S A;  5LCI A;  2D28 C;  2VZE A;  4I9F A;  3SO4 A;  2YX1 A;  4ZJZ A;  1UWD A;  4JI6 C;  4LF5 C;  1MDF A;  1J5E C;  2QVX X;  4D4G A;  5A19 A;  4I9G A;  4LF8 C;  4NOZ A;  2E5L C;  2P2Q A;  1N33 C;  4RVN A;  1P4E A;  4AQY C;  2PN2 A;  3E7W A;  4DUY C;  4DG8 A;  1MXA A;  3AF6 A;  2UXB C;  5CZX A;  3CQ1 A;  2YWC A;  3CW9 A;  1ML8 A;  3NPD A;  4BC9 A;  4JI7 C;  1T5D X;  4LFC C;  1PG3 A;  2DPL A;  3EER A;  2UUB C;  1O9T A;  4JI0 C;  2F4V C;  1VEH A;  3RG2 A;  2ATW A;  3LGX A;  4MH4 A;  2P2M A;  2QVZ X;  2D1T A;  3A9V A;  3ETO A;  1HH2 P;  4DV4 C;  4TPS B;  4RM2 A;  4PHT A;  2VQE C;  1WCJ A;  3UZ0 A;  4XX2 A;  4KTV A;  3O2E A;  2P2J A;  4DCU A;  2AYA A;  5IFI A;  4JM1 A;  4ISB A;  3L95 X;  4G37 A;  4GS5 A;  1TH5 A;  5KEI A;  4ODJ A;  2KZF A;  5T8T A;  1I94 C;  1MDB A;  1XRB A;  3A26 A;  5KYV A;  2CU6 A;  2D1S A;  4X66 C;  2QW0 X;  2OPL B;  3GR1 A;  3NYQ A;  3R9X A;  3KXW A;  4R1L A;  4D57 A;  3LNO A;  3L8C A;  2P02 A;  3PBK A;  3N2Q A;  5BSM A;  2UU9 C;  1QWI A;  2E8C A;  1PG4 A;  4L4Q A;  3S82 A;  5IT9 D;  1ULT A;  5IWA C;  4DR4 C;  3IPL A;  1HNW C;  2QVY X;  2E0G A;  4G1I A;  1WH9 A;  1PA4 A;  4X62 C;  4DR2 C;  4BSZ A;  2M5O A;  4RLQ A;  4JI2 C;  4OYC A;  1N36 C;  1V25 A;  3E7X A;  3AY0 A;  4PZP A;  2E8F A;  4OX9 C;  2E7G A;  5BSV A;  4DG9 A;  4DR1 C;  3DAY A;  1EGA A;  4PRO C;  4JI4 C;  4LFB C;  3TUF A;  3B7W A;  5LMU C;  3UX2 A;  3DHV A;  3ETC A;  3RV2 A;  4B3M C;  2Y27 A;  1N2F A;  2YWB A;  1V60 A;  3TDE A;  4DV6 C;  2BJO A;  3GKU A;  3I07 A;  2JMP A;  1USP A;  5LMN C;  2JNV A;  2HHH C;  5K85 A;  2DYJ A;  3C5E A;  3K6R A;  2KDN A;  2ZZM A;  4DV5 C;  5A2Q D;  3IEV A;  4RLF A;  1YJ7 A;  4LFA C;  3A25 A;  4YHH C;  1XMQ C;  1XNR C;  3PES A;  2P2F A;  2WP0 C;  1FUG A;  3A4I A;  4B3R C;  3T1H C;  3T1Y C;  4D4I A;  1QM4 A;  5KYT A;  4DR3 C;  1M6X C;  1RG9 A;  4KTT A;  1ZB9 A;  2KZ0 A;  1N34 C;  4NXN C;  4WV3 A;  3VNS A;  4DCV A;  2ONF A;  4ZLP A;  1AMU A;  2BH1 X;  3TR3 A;  5AE3 A;  2NCL A;  2ZZN A;  2MMA B;  4R0M A;  2PT7 G;  4DV2 C;  4NDN A;  2XR1 A;  5BUQ A;  4K0B A;  3R9W A;  3CW8 X;  3J81 D;  1NY8 A;  1HNZ C;  4LF4 C;  1P4E C;  4RVO A;  2UXD C;  2WD9 A;  4JI3 C;  2MM9 A;  4LF6 C;  1KKG A;  1L2F A;  3UX3 A;  3EQ6 A; 
#chains in the Genus database with same CATH homology
 1TH5 A;  2JNV A;  3CQ3 A;  3CQ1 A;  1XHJ A;  1WCJ A;  3UX2 A;  3CQ2 A;  2CU6 A;  1UWD A;  2M5H A;  1VEH A;  2M5O A;  3UX3 A;  2Z51 A;  3LNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...