1ZB9A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
141
Chain Sequence
b'NSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords organic hydroperoxide resistance protein
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
total genus 34
structure length 141
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb9A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb9A02
2KPIA 4JI6C 4DCSA 2JA7I 2R93I 3FKII 1WF3A 1N33C 1WH9A 3S1NI 1JOSA 5BR8C 3S15I 3I4MI 4DUYC 5A2QD 4DR1C 2JR6A 3CJEA 1N2FA 5IWAC 1HNWC 1XNQC 4DV4C 2UXCC 3CQZI 4NBFA 4BXXI 2E5LC 2PT7G 4JI7C 1Y1WI 4DV5C 2B63I 2ZM6C 4JI4C 4JI8C 3K7AI 3HOXI 4NBHA 2UUAC 2DE7A 2F4MA 2JMPA 3VMHA 4Y52I 5LMUC 2NVYI 2JA5I 2OPLA 4A93I 4YHHC 3VMIA 3J80D 3GTMI 2NVXI 2JA8I 2R92I 1PA4A 2VQEC 1WCMI 1RLYA 2UU9C 1Y1VI 1K0RA 3VMGA 2NVQI 4B3MC 2D7VA 5FLMI 4DV1C 1TWHI 4NB9A 1YUAA 3D6WA 3S16I 3RZDI 3VB9A 4DR2C 1KKGA 1RO4A 4A3LI 3EERA 3PO3S 2UUBC 2JNYA 4DCTA 4QTUA 4DR4C 1IBKC 4GKKC 2HF1A 2HJGA 3HOZI 4MH4A 2F4OA 4JI1C 2K5RA 4BSZA 4DV0C 5IP7I 4DV7C 1X3ZA 2E2II 3I07A 5LMNC 1J5EC 2PK7A 5C44I 4B3SC 1TWFI 3HOUI 4BBSI 1VLAA 4DR3C 3OTOC 4BBRI 2F4VC 1N32C 2P3YA 1I3QI 3GTQI 1ML8A 4DV3C 4K0KC 4MTNA 4GKJC 4AQYC 3S1RI 4DUZC 4XX2A 1PFTA 1HR0C 4DV6C 3PO2I 4A3DI 4LF9C 2RBLA 3RZOI 4LFAC 3S14I 3T1HC 3M3YI 1QYPA 3GTPI 4A3BI 4B3TC 5C4XI 3R9XA 1UKKA 2UXBC 1HH2P 4B3RC 4A3JI 2E7GA 2KZFA 5C3EI 1K83I 3IEVA 4LF7C 3S1QI 1XMOC 3AF6A 5IP9I 2J6AA 3IEUA 2PN2A 3GKUA 2QL8A 2DYJA 4NBBA 2DE6A 3R9WA 2CY1A 2UXDC 4KHPC 1NUIA 2BJOA 3S1MI 4DR7C 3GTLI 4JI3C 3GTJI 2NVTI 2JA6I 4YY3C 2HHHC 3LUSA 4DR5C 3HOVI 3HOYI 3GTOI 5C4JI 4A3CI 5FLXD 4JI0C 4DCUA 4NXNC 1I94C 1TWGI 3HOWI 3JAMD 1N36C 4LF8C 1XNRC 3H3VJ 2VQFC 3S17I 4NBEA 2E8FA 4NXMC 2ASBA 1HNZC 1ZB9A 4JYAC 4A3GI 4JV5C 1FJGC 3AF5A 4DCVA 4NBAA 1QWIA 3PO3I 1TWCI 4LF5C 5CM2M 1SFOI 3S2DI 2EGTA 2YU9I 3Q87A 2E8CA 2UUCC 3H0GI 4LFCC 3S2HI 2CXCA 3GTMS 4NBDA 1USPB 3U50C 4X66C 1NYEA 1TFIA 1Y1VS 3GKQA 1R9TI 4JI2C 1DL6A 4QTTA 4DV2C 1ZB8A 5IT9D 4X64C 4BY7I 4X62C 1I50I 1MKYA 1EGAA 3J81D 3M4OI 3GCFA 2YCBA 4A3FI 2E2HI 2VUMI 4A3KI 4NBGA 2XR1A 3T1YC 1IBMC 4LFBC 3ESWA 4LF6C 4A3MI 1L1OC 4NOZA 2R7ZI 4LF4C 4X6AI 2JS4A 3GTKI 1TWAI 2E8EA 1IBLC 3GTGI 2AKLA 1USPA 2ONFA 4JI5C 1L2FA 3I4NI 1HNXC 4BY1I 1WW9A 1LQLA 4OX9C 1I6HI 4NBCA 1X3WA 2E2JI 1XMQC 4DR6C 1N34C 2ATWA 4A3EI 4Y7NI 2OPLB 2DE5A 4A3II 4NB8A 4X65C
chains in the Genus database with same CATH superfamily
3F3PC 2I3CA 5FLXb 2KPIA 3CCE1 4JI6C 2OTLZ 5T64A 3IR7A 2VUGA 1YHQ1 4DCSA 1XS3A 2JA7I 2R93I 1SIWA 3PBKA 2VSQA 2QR1B 3FKII 3CCQZ 2V7BA 3A26A 2DHMA 4E31A 1WF3A 1N33C 1WH9A 3S1NI 1JOSA 5BR8C 3S15I 1QXFA 3I4MI 4DUYC 4IZ6A 5A2QD 4DR1C 3DLPX 3CCUZ 3CW8X 2JR6A 3G711 2OOXB 2YADA 3NFZA 2Y4OA 3CJEA 1N2FA 3SO4A 4MRIA 3CC4Z 2PM9A 1VQ71 1M6XC 5IWAC 1HNWC 2VPYA 3PESA 1GPMA 3J7A4 1XNQC 1YJW1 4DV4C 2UXCC 3CQZI 2P20A 2Y4NA 1WIIA 2LIYA 4RS4A 4NBFA 2QLVB 1FUGA 1P4EC 3CD6Z 4BXXI 2E5LC 2PT7G 4JI7C 2QEXZ 1K9M1 1Y1WI 4I9GA 4DV5C 2B63I 1VQ4Z 2ZM6C 4JI4C 3LGXA 4JI8C 1K8A2 1S7MA 3K7AI 3HOXI 4ODJA 3CC7Z 3R44A 4NBHA 2UUAC 3CCVZ 1ULTA 2DE7A 1W2BZ 3N2QA 2F4MA 4DGLA 2JMPA 4IR7A 4E2ZA 3DAYA 1W2BY 4RLQA 1VQLZ 1XRBA 3VMHA 4Y52I 1YJ9Z 2ZZNA 1VQO1 5LMUC 2NVYI 3PROC 4I9FA 3IFUA 2JA5I 3LNVA 2OPLA 5T8TA 4RVDA 2K3RA 3CCL1 1KQSZ 4A93I 4YHHC 4RV9A 3TQIA 5CZXA 3VMIA 1KQSY 3J80D 3CXCZ 3FQQA 3G4SZ 3UX2A 3CXCY 3GTMI 3CCJZ 1XHJA 2E0GA 4KTTA 4RLFA 3H2TA 4FTFA 4JM1A 5BSWA 2NVXI 2JA8I 2YX1A 2R92I 2QKDA 5AN9F 1VQK1 1PA4A 2QVXX 4E2WA 2VQEC 3HKZA 1WCMI 4PZPA 5A19A 2W03A 1RLYA 2V8KA 3A4IA 2UU9C 1Y1VI 2VF1A 1K0RA 3L8CA 3VMGA 1S721 2NVQI 4PROC 4B3MC 5BSRA 3CCS1 3UZ0A 3GR0A 2E7ZA 2MM9A 2BH1X 1Q812 5CZVA 4ISBA 1NP6A 5AE2A 2D7VA 3CCR1 2Z51A 2OTJ1 2V8JA 1QF8A 5FLMI 4DV1C 1NJI2 1YJN1 4BCAA 3KXWA 1JWHC 1TWHI 4NB9A 1YUAA 1K8A1 3D6WA 1MXBA 2D1SA 1PU1A 3S16I 3RZDI 3VB9A 5E7QA 4DR2C 1KKGA 1RO4A 4HGYA 4A3LI 3EERA 1MXAA 1BA3A 3PO3S 1V26A 2UUBC 2JNYA 4DCTA 1XRAA 2VZEA 4CL1A 1VQP1 4QTUA 4HH4A 3GPCA 2JIOA 5IFIA 4DR4C 1Q822 1IBKC 1Q7Y2 4GKKC 2HF1A 2HJGA 3CQ1A 3HOZI 4WV3A 3EEDA 4MH4A 1Z01A 2F4OA 1VQNZ 4JI1C 2K5RA 4BSZA 4DV0C 5T67A 5T6BA 1MXCA 3A9UA 5IP7I 2OTL1 1VQ6Z 4LE5A 3CCM1 3CQ3A 4DV7C 3TDHB 1VQ5Z 1P7LA 1X3ZA 2E2II 3ETOA 1YIJ1 2OZKA 2D27A 3I07A 5LMNC 3CC21 1J5EC 2PK7A 5C44I 4B3SC 3F3FC 1TWFI 4R0MA 1RY2A 3FCCA 4BC9A 3HOUI 4BBSI 1VLAA 3IF8A 1Q811 4RVNA 5GTDA 1VQ81 5BURA 4DR3C 3OTOC 4BBRI 2F4VC 2NAPA 1NJI1 1N32C 2QA41 2P3YA 4PUIA 5BUQA 3NH8A 4ZLPA 3D9XA 1I3QI 3GTQI 1ML8A 2V45A 1YI21 4PUGA 2JIPA 4DV3C 2ZZMA 4K0KC 5BSTA 3CD61 4MTNA 3CCEZ 4GS5A 4GKJC 4AQYC 4D57A 3S1RI 3NYRA 4DUZC 4XX2A 1VQM1 3OW2Z 3NPDA 1PFTA 1HR0C 3OW2Y 1Q821 4DV6C 4E2YA 5K8FA 1Q7Y1 5BSVA 1RG9A 1YJ7A 5A2Qf 3CCV1 3PO2I 4A3DI 4LF9C 2RBLA 3I551 3K6RA 3VNRA 4OYCA 2IZ3A 3RZOI 1WZNA 4LFAC 3S14I 3RV2A 4R1MA 3G71Z 4BC7A 1QVGZ 3T1HC 3M3YI 4RMNA 1VQ7Z 4HPVA 1QYPA 1QVGY 3GTPI 4A3BI 1T5DX 2JIMA 4B3TC 5C4XI 1YJWZ 5BSMA 3E7XA 3R9XA 2M6NA 1UKKA 5A1GA 5A2Qb 4TNUA 5BSUA 2UXBC 1HH2P 3CMAZ 4B3RC 3IPLA 4A3JI 3BG1B 3LNOA 2E7GA 2V8IA 2KZFA 3UOWA 3TUFA 5C3EI 1IB8A 2Q51A 1K83I 2MCQA 1YIT1 1T5HX 3I08A 4PUHA 3S1QI 4LF7C 1XMOC 3IEVA 3KIHA 1Z02A 2KDNA 3G6E1 2JNVA 1FDIA 5IP9I 3AF6A 2YWBA 3NH5A 2J6AA 2NCLA 2JUBA 2P2QA 3IEUA 2PN2A 3GKUA 2QL8A 2DYJA 2QW0X 4U5YD 2JIQA 2WB1A 4RVFA 5A1IA 4MONA 4NBBA 2LEXA 2DE6A 2D1QA 3R9WA 2CY1A 2UXDC 1VQOZ 1V25A 3NYQA 4KHPC 2O4HA 1NUIA 3J80f 3FQMA 2BJOA 4HGZA 3CCLZ 3S1MI 2QVYX 3EQ6A 3MZLB 5K85A 4RVHA 4DR7C 4TPSB 3GTLI 4MD9A 1VQ9Z 4JI3C 2R6MA 4D4GA 3GTJI 2VPXA 3I561 3CME1 2NVTI 2QRDB 2JA6I 4YY3C 3IX0A 3CPWZ 3VNQA 1M902 2HHHC 3LUSA 1VQKZ 1YUKA 4DR5C 4GXRA 3CPWY 1PG4A 2IV2X 3HOVI 2QRCB 4D4IA 3J80b 2ZAEB 4FUTA 4RM2A 5LCIA 1MD9A 3HOYI 3GTOI 2P28A 1S72Z 3O2EA 5C4JI 3CCSZ 4A3CI 5FLXD 2RHBA 4JI0C 1VQN1 4DCUA 3BG0B 3UX3A 2P02A 3NDIA 4NXNC 1I94C 3MZKB 3T4NB 1Z03A 2IZ4A 1TWGI 2LFUA 2VPZA 3HOWI 3JAMD 2JMOA 1N36C 1VQ51 4LF8C 3IMLA 4OXIA 1Q862 1XNRC 3H3VJ 2AYDA 2E9HA 2VQFC 3S17I 1RQFA 5T8SA 4NBEA 2E8FA 4FUQA 2PROA 3CCQ1 1KRLA 2RT9A 1VQPZ 2OO4A 4DG9A 4NXMC 2M48A 2ASBA 1HNZC 2QREB 2GTIA 1ZB9A 2GTHA 4KTVA 1ZH1A 2JIRA 2RPRA 2DPLA 4JYAC 5ADZA 4A3GI 3JAMf 4JV5C 4GXQA 2KI7B 3CCU1 1XRCA 1FJGC 1O92A 3NI2A 4DK1A 3AF5A 3G7SA 3CC41 1NY8A 3DHVA 3VTNA 2WP0C 4DCVA 2AYAA 4NBAA 2HU9A 1QWIA 4G36A 3PO3I 1TWCI 3CCMZ 1M901 1JJ2Z 2YWCA 4LF5C 2Q4ZA 1JJ2Y 1YIJZ 5CM2M 2QEX1 4R1LA 3JAMb 1SFOI 3CC2Z 1YHQZ 1VQ41 3S2DI 2QVZX 3AY0A 1FLOA 2EGTA 2YU9I 3Q87A 2E8CA 2UUCC 3H0GI 4LFCC 3S2HI 3CC71 1VQ8Z 4ZJZA 3VNSA 2CXCA 4AYBA 3GTMS 2WAQA 5JRHA 4NBDA 5D1OB 2QA4Z 1USPB 3U50C 4X66C 4NFRA 1Q861 1VQL1 1YI2Z 1NYEA 1TFIA 1YJ91 3CMA1 1PG3A 1Y1VS 3GKQA 1R9TI 3LAXA 4JI2C 1DL6A 3TE5B 4QTTA 4DV2C 1ZB8A 5IT9D 4L4QA 4DG8A 1VQMZ 1MDFA 4X64C 4MXUA 4BY7I 1WCJA 3S82A 3G4S1 2P2FA 5H9UA 3CCJ1 4X62C 4RM3A 3CQ2A 2P2JA 1I50I 1MKYA 2GU2A 1EGAA 2D1TA 3I55Z 1AMUA 2RIQA 3TR3A 3KIFA 3J81D 5KYVA 1UWDA 3M4OI 2CU6A 3GR1A 3GCFA 1O93A 1V60A 2YCBA 4S1TA 1N8R2 4A3FI 2D28C 3FCEA 2E2HI 5IT9f 4MD8A 2M5HA 1QM4A 3QWUA 3CW9A 4L2ZA 2VPWA 2VUMI 4E32A 4PHTA 1M1K2 3C5EA 4A3KI 4NBGA 3P5JB 2D1RA 2XR1A 1VQ91 1Q16A 2V3VA 3T1YC 1K732 3D2LA 4WS9A 1IBMC 1O90A 1KD12 4LFBC 1YITZ 3J81f 1KC82 4E30A 2P2BA 5IT9b 2OBVA 3UEBA 3NDJA 3ESWA 5KYTA 4LF6C 1AA6A 3G6EZ 4A3MI 1TH5A 4BBYA 1L1OC 2W04A 4G37A 3N54B 4RVGA 4NOZA 2R7ZI 2KZ0A 4D56A 4LF4C 2Y0SA 3A25A 4X6AI 2JS4A 3RG2A 2P2MA 4E33A 2OOYB 3GTKI 1TWAI 3NH4A 4NH1C 2E8EA 1IBLC 3J81b 5AE3A 4EATA 3GTGI 2G2KA 4K0BA 2MMAB 4G1IA 2AKLA 5D1OA 1USPA 3CCRZ 1LCIA 2OTJZ 2ONFA 4JI5C 3MONA 1RO2A 1L2FA 1M6XA 1RO0A 3I4NI 1VQ61 5KEIA 4E2XA 1YJNZ 5LL6f 2PMZA 1HNXC 1Y8CA 4BY1I 3I56Z 1O9TA 2H85A 1MDBA 1WW9A 3CMEZ 1WJ2A 4RVOA 4MD7A 1P4EA 1LQLA 4OX9C 1I6HI 4NBCA 1X3WA 1VEHA 2E2JI 4L7IA 1N8R1 1FDOA 3ETCA 1XMQC 3TDEA 1K9M2 2M5OA 5FLXf 4DR6C 1X0TA 3A9VA 5BUSA 1M1K1 1QVFZ 4DQYB 1N34C 2ATWA 1QVFY 4A3EI 4Y7NI 3B7WA 4EWCA 1K731 2OPLB 3L95X 2DE5A 4A3II 5D1PA 4NB8A 2Y27A 4X65C 5DV9A 1KD11 3E7WA 4NDNA 1P9NA 2O53A 1KC81 2WD9A 1RNIA 5AE1A
chains in the Genus database with same CATH topology
3F3PC 2I3CA 5FLXb 2KPIA 3CCE1 4JI6C 2OTLZ 5T64A 2VUGA 1YHQ1 4DCSA 2JA7I 2R93I 3PBKA 2VSQA 2QR1B 3FKII 3CCQZ 2V7BA 4E31A 1WF3A 1N33C 1WH9A 3S1NI 1JOSA 5BR8C 3S15I 3I4MI 4DUYC 4IZ6A 5A2QD 4DR1C 3DLPX 3CCUZ 3CW8X 2JR6A 3G711 2OOXB 2YADA 3NFZA 2Y4OA 3CJEA 1N2FA 3SO4A 4MRIA 3CC4Z 2PM9A 1VQ71 5IWAC 1HNWC 3PESA 1GPMA 3J7A4 1XNQC 1YJW1 4DV4C 2UXCC 3CQZI 2P20A 2Y4NA 1WIIA 2LIYA 4RS4A 4NBFA 2QLVB 1FUGA 3CD6Z 4BXXI 2E5LC 2PT7G 4JI7C 2QEXZ 1K9M1 1Y1WI 4I9GA 4DV5C 2B63I 1VQ4Z 2ZM6C 4JI4C 3LGXA 4JI8C 1K8A2 1S7MA 3K7AI 3HOXI 4ODJA 3CC7Z 3R44A 4NBHA 2UUAC 3CCVZ 1ULTA 2DE7A 1W2BZ 3N2QA 2F4MA 4DGLA 2JMPA 4IR7A 4E2ZA 3DAYA 1W2BY 4RLQA 1VQLZ 1XRBA 3VMHA 4Y52I 1YJ9Z 1VQO1 5LMUC 2NVYI 3PROC 4I9FA 3IFUA 2JA5I 3LNVA 2OPLA 5T8TA 4RVDA 2K3RA 3CCL1 1KQSZ 4A93I 4YHHC 4RV9A 3TQIA 5CZXA 3VMIA 1KQSY 3J80D 3CXCZ 3FQQA 3G4SZ 3CXCY 3GTMI 3CCJZ 2E0GA 4KTTA 5BSWA 4RLFA 3H2TA 4FTFA 4JM1A 2NVXI 2JA8I 2R92I 2QKDA 5AN9F 1VQK1 1PA4A 2QVXX 4E2WA 2VQEC 3HKZA 1WCMI 4PZPA 5A19A 2W03A 1RLYA 2V8KA 3A4IA 2UU9C 1Y1VI 2VF1A 1K0RA 3L8CA 3VMGA 1S721 2NVQI 4PROC 4B3MC 5BSRA 3CCS1 3UZ0A 3GR0A 2BH1X 1Q812 5CZVA 4ISBA 1NP6A 5AE2A 2D7VA 3CCR1 2OTJ1 2V8JA 1QF8A 5FLMI 4DV1C 1NJI2 1YJN1 4BCAA 3KXWA 1JWHC 1TWHI 4NB9A 1YUAA 1K8A1 3D6WA 1MXBA 2D1SA 3S16I 3RZDI 3VB9A 5E7QA 4DR2C 1KKGA 1RO4A 4HGYA 4A3LI 3EERA 1MXAA 1BA3A 3PO3S 1V26A 2UUBC 2JNYA 4DCTA 1XRAA 2VZEA 4CL1A 1VQP1 4QTUA 4HH4A 3GPCA 5IFIA 4DR4C 1Q822 1IBKC 1Q7Y2 4GKKC 2HF1A 2HJGA 4WV3A 3HOZI 3EEDA 4MH4A 1Z01A 2F4OA 1VQNZ 4JI1C 2K5RA 4BSZA 4DV0C 5T67A 5T6BA 1MXCA 3A9UA 5IP7I 2OTL1 1VQ6Z 4LE5A 3CCM1 4DV7C 3TDHB 1VQ5Z 1P7LA 1X3ZA 2E2II 3ETOA 1YIJ1 2OZKA 2D27A 3I07A 5LMNC 3CC21 1J5EC 2PK7A 5C44I 4B3SC 3F3FC 1TWFI 4R0MA 1RY2A 3FCCA 4BC9A 3HOUI 4BBSI 1VLAA 3IF8A 1Q811 4RVNA 5GTDA 1VQ81 5BURA 4DR3C 3OTOC 4BBRI 2F4VC 1NJI1 1N32C 2QA41 2P3YA 5BUQA 3NH8A 4ZLPA 3D9XA 1I3QI 3GTQI 1ML8A 1YI21 4DV3C 4K0KC 5BSTA 3CD61 4MTNA 3CCEZ 4GS5A 4GKJC 4AQYC 4D57A 3S1RI 3NYRA 4DUZC 4XX2A 1VQM1 3OW2Z 3NPDA 1PFTA 1HR0C 3OW2Y 1Q821 4DV6C 4E2YA 5K8FA 1Q7Y1 5BSVA 1RG9A 1YJ7A 5A2Qf 3CCV1 3PO2I 4A3DI 4LF9C 2RBLA 3I551 3VNRA 4OYCA 2IZ3A 3RZOI 4LFAC 3S14I 3RV2A 4R1MA 3G71Z 4BC7A 1QVGZ 3T1HC 3M3YI 4RMNA 1VQ7Z 4HPVA 1QYPA 1QVGY 3GTPI 4A3BI 1T5DX 4B3TC 5C4XI 1YJWZ 5BSMA 3E7XA 3R9XA 2M6NA 1UKKA 5A1GA 5A2Qb 4TNUA 5BSUA 2UXBC 1HH2P 3CMAZ 4B3RC 3IPLA 4A3JI 3BG1B 2E7GA 2V8IA 2KZFA 3UOWA 3TUFA 5C3EI 2Q51A 1K83I 1YIT1 1T5HX 3I08A 3IEVA 3S1QI 4LF7C 1XMOC 3KIHA 1Z02A 3G6E1 3AF6A 5IP9I 2YWBA 3NH5A 2J6AA 2JUBA 2P2QA 3IEUA 2PN2A 3GKUA 2QL8A 2DYJA 2QW0X 4U5YD 2WB1A 4RVFA 5A1IA 4MONA 4NBBA 2DE6A 2D1QA 3R9WA 2CY1A 2UXDC 1VQOZ 1V25A 3NYQA 4KHPC 2O4HA 1NUIA 3J80f 3FQMA 2BJOA 4HGZA 3CCLZ 3S1MI 2QVYX 3EQ6A 3MZLB 5K85A 4RVHA 4DR7C 4TPSB 3GTLI 4MD9A 1VQ9Z 4JI3C 2R6MA 4D4GA 3GTJI 3I561 3CME1 2NVTI 2QRDB 2JA6I 4YY3C 3IX0A 3CPWZ 3VNQA 1M902 2HHHC 3LUSA 1VQKZ 1YUKA 4DR5C 4GXRA 3CPWY 1PG4A 4D4IA 3HOVI 2QRCB 3J80b 2ZAEB 4FUTA 4RM2A 1MD9A 3HOYI 3GTOI 2P28A 1S72Z 5C4JI 3CCSZ 4A3CI 5FLXD 2RHBA 4JI0C 1VQN1 4DCUA 3BG0B 2P02A 3NDIA 4NXNC 1I94C 3MZKB 3T4NB 1Z03A 2IZ4A 1TWGI 2LFUA 3HOWI 3JAMD 2JMOA 1N36C 1VQ51 4LF8C 3IMLA 4OXIA 1Q862 1XNRC 3H3VJ 2E9HA 2VQFC 3S17I 1RQFA 5T8SA 4NBEA 2E8FA 4FUQA 2PROA 3CCQ1 1KRLA 2RT9A 1VQPZ 2OO4A 4DG9A 4NXMC 2M48A 2ASBA 1HNZC 2QREB 2GTIA 1ZB9A 2GTHA 4KTVA 1ZH1A 2RPRA 4JYAC 2DPLA 5ADZA 4A3GI 3JAMf 4JV5C 4GXQA 2KI7B 3CCU1 1XRCA 1FJGC 1O92A 3NI2A 4DK1A 3AF5A 3G7SA 3CC41 3DHVA 3VTNA 2WP0C 4DCVA 2AYAA 4NBAA 2HU9A 1QWIA 4G36A 3PO3I 1TWCI 3CCMZ 1M901 1JJ2Z 2YWCA 4LF5C 2Q4ZA 1JJ2Y 1YIJZ 5CM2M 2QEX1 4R1LA 3JAMb 1SFOI 3CC2Z 1YHQZ 1VQ41 3S2DI 2QVZX 2EGTA 2YU9I 3Q87A 2E8CA 2UUCC 3H0GI 4LFCC 3S2HI 3CC71 1VQ8Z 4ZJZA 3VNSA 2CXCA 4AYBA 3GTMS 2WAQA 5JRHA 4NBDA 5D1OB 2QA4Z 1USPB 3U50C 4X66C 4NFRA 1Q861 1VQL1 1YI2Z 1NYEA 1TFIA 1YJ91 3CMA1 1PG3A 1Y1VS 3GKQA 1R9TI 3LAXA 4JI2C 1DL6A 3TE5B 4QTTA 4DV2C 1ZB8A 5IT9D 4L4QA 4DG8A 1VQMZ 1MDFA 4X64C 4MXUA 4BY7I 3S82A 3G4S1 2P2FA 5H9UA 3CCJ1 4X62C 4RM3A 2P2JA 1I50I 1MKYA 2GU2A 1EGAA 2D1TA 3I55Z 1AMUA 2RIQA 3KIFA 3J81D 5KYVA 3M4OI 3GR1A 3GCFA 1O93A 2YCBA 4S1TA 1N8R2 4A3FI 2D28C 3FCEA 2E2HI 5IT9f 4MD8A 1QM4A 3QWUA 3CW9A 4L2ZA 2VUMI 4E32A 4PHTA 1M1K2 3C5EA 4A3KI 4NBGA 3P5JB 2D1RA 2XR1A 1VQ91 3T1YC 1K732 4WS9A 1IBMC 1O90A 1KD12 4LFBC 1YITZ 3J81f 1KC82 4E30A 2P2BA 5IT9b 2OBVA 3NDJA 3ESWA 5KYTA 4LF6C 3G6EZ 4A3MI 4BBYA 1L1OC 2W04A 4G37A 3N54B 4RVGA 4NOZA 2R7ZI 4D56A 4LF4C 2Y0SA 4X6AI 2JS4A 3RG2A 2P2MA 4E33A 2OOYB 3GTKI 1TWAI 3NH4A 4NH1C 2E8EA 1IBLC 3J81b 5AE3A 4EATA 3GTGI 2G2KA 4K0BA 4G1IA 2AKLA 5D1OA 1USPA 3CCRZ 1LCIA 2OTJZ 2ONFA 4JI5C 3MONA 1RO2A 1L2FA 1RO0A 3I4NI 1VQ61 5KEIA 4E2XA 1YJNZ 5LL6f 2PMZA 1HNXC 4BY1I 3I56Z 1O9TA 2H85A 1MDBA 1WW9A 3CMEZ 4RVOA 4MD7A 1LQLA 4OX9C 1I6HI 4NBCA 1X3WA 4L7IA 2E2JI 1N8R1 3ETCA 1XMQC 3TDEA 1K9M2 5FLXf 4DR6C 1X0TA 3A9VA 5BUSA 1M1K1 1QVFZ 4DQYB 1N34C 2ATWA 1QVFY 4A3EI 4Y7NI 3B7WA 4EWCA 1K731 2OPLB 3L95X 2DE5A 4A3II 5D1PA 4NB8A 2Y27A 4X65C 5DV9A 1KD11 3E7WA 4NDNA 1P9NA 2O53A 1KC81 2WD9A 1RNIA 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPI A;  4JI6 C;  4DCS A;  2JA7 I;  2R93 I;  3FKI I;  1WF3 A;  1N33 C;  1WH9 A;  3S1N I;  1JOS A;  5BR8 C;  3S15 I;  3I4M I;  4DUY C;  5A2Q D;  4DR1 C;  2JR6 A;  3CJE A;  1N2F A;  5IWA C;  1HNW C;  1XNQ C;  4DV4 C;  2UXC C;  3CQZ I;  4NBF A;  4BXX I;  2E5L C;  2PT7 G;  4JI7 C;  1Y1W I;  4DV5 C;  2B63 I;  2ZM6 C;  4JI4 C;  4JI8 C;  3K7A I;  3HOX I;  4NBH A;  2UUA C;  2DE7 A;  2F4M A;  2JMP A;  3VMH A;  4Y52 I;  5LMU C;  2NVY I;  2JA5 I;  2OPL A;  4A93 I;  4YHH C;  3VMI A;  3J80 D;  3GTM I;  2NVX I;  2JA8 I;  2R92 I;  1PA4 A;  2VQE C;  1WCM I;  1RLY A;  2UU9 C;  1Y1V I;  1K0R A;  3VMG A;  2NVQ I;  4B3M C;  2D7V A;  5FLM I;  4DV1 C;  1TWH I;  4NB9 A;  1YUA A;  3D6W A;  3S16 I;  3RZD I;  3VB9 A;  4DR2 C;  1KKG A;  1RO4 A;  4A3L I;  3EER A;  3PO3 S;  2UUB C;  2JNY A;  4DCT A;  4QTU A;  4DR4 C;  1IBK C;  4GKK C;  2HF1 A;  2HJG A;  3HOZ I;  4MH4 A;  2F4O A;  4JI1 C;  2K5R A;  4BSZ A;  4DV0 C;  5IP7 I;  4DV7 C;  1X3Z A;  2E2I I;  3I07 A;  5LMN C;  1J5E C;  2PK7 A;  5C44 I;  4B3S C;  1TWF I;  3HOU I;  4BBS I;  1VLA A;  4DR3 C;  3OTO C;  4BBR I;  2F4V C;  1N32 C;  2P3Y A;  1I3Q I;  3GTQ I;  1ML8 A;  4DV3 C;  4K0K C;  4MTN A;  4GKJ C;  4AQY C;  3S1R I;  4DUZ C;  4XX2 A;  1PFT A;  1HR0 C;  4DV6 C;  3PO2 I;  4A3D I;  4LF9 C;  2RBL A;  3RZO I;  4LFA C;  3S14 I;  3T1H C;  3M3Y I;  1QYP A;  3GTP I;  4A3B I;  4B3T C;  5C4X I;  3R9X A;  1UKK A;  2UXB C;  1HH2 P;  4B3R C;  4A3J I;  2E7G A;  2KZF A;  5C3E I;  1K83 I;  3IEV A;  4LF7 C;  3S1Q I;  1XMO C;  3AF6 A;  5IP9 I;  2J6A A;  3IEU A;  2PN2 A;  3GKU A;  2QL8 A;  2DYJ A;  4NBB A;  2DE6 A;  3R9W A;  2CY1 A;  2UXD C;  4KHP C;  1NUI A;  2BJO A;  3S1M I;  4DR7 C;  3GTL I;  4JI3 C;  3GTJ I;  2NVT I;  2JA6 I;  4YY3 C;  2HHH C;  3LUS A;  4DR5 C;  3HOV I;  3HOY I;  3GTO I;  5C4J I;  4A3C I;  5FLX D;  4JI0 C;  4DCU A;  4NXN C;  1I94 C;  1TWG I;  3HOW I;  3JAM D;  1N36 C;  4LF8 C;  1XNR C;  3H3V J;  2VQF C;  3S17 I;  4NBE A;  2E8F A;  4NXM C;  2ASB A;  1HNZ C;  1ZB9 A;  4JYA C;  4A3G I;  4JV5 C;  1FJG C;  3AF5 A;  4DCV A;  4NBA A;  1QWI A;  3PO3 I;  1TWC I;  4LF5 C;  5CM2 M;  1SFO I;  3S2D I;  2EGT A;  2YU9 I;  3Q87 A;  2E8C A;  2UUC C;  3H0G I;  4LFC C;  3S2H I;  2CXC A;  3GTM S;  4NBD A;  1USP B;  3U50 C;  4X66 C;  1NYE A;  1TFI A;  1Y1V S;  3GKQ A;  1R9T I;  4JI2 C;  1DL6 A;  4QTT A;  4DV2 C;  1ZB8 A;  5IT9 D;  4X64 C;  4BY7 I;  4X62 C;  1I50 I;  1MKY A;  1EGA A;  3J81 D;  3M4O I;  3GCF A;  2YCB A;  4A3F I;  2E2H I;  2VUM I;  4A3K I;  4NBG A;  2XR1 A;  3T1Y C;  1IBM C;  4LFB C;  3ESW A;  4LF6 C;  4A3M I;  1L1O C;  4NOZ A;  2R7Z I;  4LF4 C;  4X6A I;  2JS4 A;  3GTK I;  1TWA I;  2E8E A;  1IBL C;  3GTG I;  2AKL A;  1USP A;  2ONF A;  4JI5 C;  1L2F A;  3I4N I;  1HNX C;  4BY1 I;  1WW9 A;  1LQL A;  4OX9 C;  1I6H I;  4NBC A;  1X3W A;  2E2J I;  1XMQ C;  4DR6 C;  1N34 C;  2ATW A;  4A3E I;  4Y7N I;  2OPL B;  2DE5 A;  4A3I I;  4NB8 A;  4X65 C; 
#chains in the Genus database with same CATH topology
 3F3P C;  2I3C A;  5FLX b;  2KPI A;  3CCE 1;  4JI6 C;  2OTL Z;  5T64 A;  3IR7 A;  2VUG A;  1YHQ 1;  4DCS A;  1XS3 A;  2JA7 I;  2R93 I;  1SIW A;  3PBK A;  2VSQ A;  2QR1 B;  3FKI I;  3CCQ Z;  2V7B A;  3A26 A;  2DHM A;  4E31 A;  1WF3 A;  1N33 C;  1WH9 A;  3S1N I;  1JOS A;  5BR8 C;  3S15 I;  1QXF A;  3I4M I;  4DUY C;  4IZ6 A;  5A2Q D;  4DR1 C;  3DLP X;  3CCU Z;  3CW8 X;  2JR6 A;  3G71 1;  2OOX B;  2YAD A;  3NFZ A;  2Y4O A;  3CJE A;  1N2F A;  3SO4 A;  4MRI A;  3CC4 Z;  2PM9 A;  1VQ7 1;  1M6X C;  5IWA C;  1HNW C;  2VPY A;  3PES A;  1GPM A;  3J7A 4;  1XNQ C;  1YJW 1;  4DV4 C;  2UXC C;  3CQZ I;  2P20 A;  2Y4N A;  1WII A;  2LIY A;  4RS4 A;  4NBF A;  2QLV B;  1FUG A;  1P4E C;  3CD6 Z;  4BXX I;  2E5L C;  2PT7 G;  4JI7 C;  2QEX Z;  1K9M 1;  1Y1W I;  4I9G A;  4DV5 C;  2B63 I;  1VQ4 Z;  2ZM6 C;  4JI4 C;  3LGX A;  4JI8 C;  1K8A 2;  1S7M A;  3K7A I;  3HOX I;  4ODJ A;  3CC7 Z;  3R44 A;  4NBH A;  2UUA C;  3CCV Z;  1ULT A;  2DE7 A;  1W2B Z;  3N2Q A;  2F4M A;  4DGL A;  2JMP A;  4IR7 A;  4E2Z A;  3DAY A;  1W2B Y;  4RLQ A;  1VQL Z;  1XRB A;  3VMH A;  4Y52 I;  1YJ9 Z;  2ZZN A;  1VQO 1;  5LMU C;  2NVY I;  3PRO C;  4I9F A;  3IFU A;  2JA5 I;  3LNV A;  2OPL A;  5T8T A;  4RVD A;  2K3R A;  3CCL 1;  1KQS Z;  4A93 I;  4YHH C;  4RV9 A;  3TQI A;  5CZX A;  3VMI A;  1KQS Y;  3J80 D;  3CXC Z;  3FQQ A;  3G4S Z;  3UX2 A;  3CXC Y;  3GTM I;  3CCJ Z;  1XHJ A;  2E0G A;  4KTT A;  4RLF A;  3H2T A;  4FTF A;  4JM1 A;  5BSW A;  2NVX I;  2JA8 I;  2YX1 A;  2R92 I;  2QKD A;  5AN9 F;  1VQK 1;  1PA4 A;  2QVX X;  4E2W A;  2VQE C;  3HKZ A;  1WCM I;  4PZP A;  5A19 A;  2W03 A;  1RLY A;  2V8K A;  3A4I A;  2UU9 C;  1Y1V I;  2VF1 A;  1K0R A;  3L8C A;  3VMG A;  1S72 1;  2NVQ I;  4PRO C;  4B3M C;  5BSR A;  3CCS 1;  3UZ0 A;  3GR0 A;  2E7Z A;  2MM9 A;  2BH1 X;  1Q81 2;  5CZV A;  4ISB A;  1NP6 A;  5AE2 A;  2D7V A;  3CCR 1;  2Z51 A;  2OTJ 1;  2V8J A;  1QF8 A;  5FLM I;  4DV1 C;  1NJI 2;  1YJN 1;  4BCA A;  3KXW A;  1JWH C;  1TWH I;  4NB9 A;  1YUA A;  1K8A 1;  3D6W A;  1MXB A;  2D1S A;  1PU1 A;  3S16 I;  3RZD I;  3VB9 A;  5E7Q A;  4DR2 C;  1KKG A;  1RO4 A;  4HGY A;  4A3L I;  3EER A;  1MXA A;  1BA3 A;  3PO3 S;  1V26 A;  2UUB C;  2JNY A;  4DCT A;  1XRA A;  2VZE A;  4CL1 A;  1VQP 1;  4QTU A;  4HH4 A;  3GPC A;  2JIO A;  5IFI A;  4DR4 C;  1Q82 2;  1IBK C;  1Q7Y 2;  4GKK C;  2HF1 A;  2HJG A;  3CQ1 A;  3HOZ I;  4WV3 A;  3EED A;  4MH4 A;  1Z01 A;  2F4O A;  1VQN Z;  4JI1 C;  2K5R A;  4BSZ A;  4DV0 C;  5T67 A;  5T6B A;  1MXC A;  3A9U A;  5IP7 I;  2OTL 1;  1VQ6 Z;  4LE5 A;  3CCM 1;  3CQ3 A;  4DV7 C;  3TDH B;  1VQ5 Z;  1P7L A;  1X3Z A;  2E2I I;  3ETO A;  1YIJ 1;  2OZK A;  2D27 A;  3I07 A;  5LMN C;  3CC2 1;  1J5E C;  2PK7 A;  5C44 I;  4B3S C;  3F3F C;  1TWF I;  4R0M A;  1RY2 A;  3FCC A;  4BC9 A;  3HOU I;  4BBS I;  1VLA A;  3IF8 A;  1Q81 1;  4RVN A;  5GTD A;  1VQ8 1;  5BUR A;  4DR3 C;  3OTO C;  4BBR I;  2F4V C;  2NAP A;  1NJI 1;  1N32 C;  2QA4 1;  2P3Y A;  4PUI A;  5BUQ A;  3NH8 A;  4ZLP A;  3D9X A;  1I3Q I;  3GTQ I;  1ML8 A;  2V45 A;  1YI2 1;  4PUG A;  2JIP A;  4DV3 C;  2ZZM A;  4K0K C;  5BST A;  3CD6 1;  4MTN A;  3CCE Z;  4GS5 A;  4GKJ C;  4AQY C;  4D57 A;  3S1R I;  3NYR A;  4DUZ C;  4XX2 A;  1VQM 1;  3OW2 Z;  3NPD A;  1PFT A;  1HR0 C;  3OW2 Y;  1Q82 1;  4DV6 C;  4E2Y A;  5K8F A;  1Q7Y 1;  5BSV A;  1RG9 A;  1YJ7 A;  5A2Q f;  3CCV 1;  3PO2 I;  4A3D I;  4LF9 C;  2RBL A;  3I55 1;  3K6R A;  3VNR A;  4OYC A;  2IZ3 A;  3RZO I;  1WZN A;  4LFA C;  3S14 I;  3RV2 A;  4R1M A;  3G71 Z;  4BC7 A;  1QVG Z;  3T1H C;  3M3Y I;  4RMN A;  1VQ7 Z;  4HPV A;  1QYP A;  1QVG Y;  3GTP I;  4A3B I;  1T5D X;  2JIM A;  4B3T C;  5C4X I;  1YJW Z;  5BSM A;  3E7X A;  3R9X A;  2M6N A;  1UKK A;  5A1G A;  5A2Q b;  4TNU A;  5BSU A;  2UXB C;  1HH2 P;  3CMA Z;  4B3R C;  3IPL A;  4A3J I;  3BG1 B;  3LNO A;  2E7G A;  2V8I A;  2KZF A;  3UOW A;  3TUF A;  5C3E I;  1IB8 A;  2Q51 A;  1K83 I;  2MCQ A;  1YIT 1;  1T5H X;  3I08 A;  4PUH A;  3S1Q I;  4LF7 C;  1XMO C;  3IEV A;  3KIH A;  1Z02 A;  2KDN A;  3G6E 1;  2JNV A;  1FDI A;  5IP9 I;  3AF6 A;  2YWB A;  3NH5 A;  2J6A A;  2NCL A;  2JUB A;  2P2Q A;  3IEU A;  2PN2 A;  3GKU A;  2QL8 A;  2DYJ A;  2QW0 X;  4U5Y D;  2JIQ A;  2WB1 A;  4RVF A;  5A1I A;  4MON A;  4NBB A;  2LEX A;  2DE6 A;  2D1Q A;  3R9W A;  2CY1 A;  2UXD C;  1VQO Z;  1V25 A;  3NYQ A;  4KHP C;  2O4H A;  1NUI A;  3J80 f;  3FQM A;  2BJO A;  4HGZ A;  3CCL Z;  3S1M I;  2QVY X;  3EQ6 A;  3MZL B;  5K85 A;  4RVH A;  4DR7 C;  4TPS B;  3GTL I;  4MD9 A;  1VQ9 Z;  4JI3 C;  2R6M A;  4D4G A;  3GTJ I;  2VPX A;  3I56 1;  3CME 1;  2NVT I;  2QRD B;  2JA6 I;  4YY3 C;  3IX0 A;  3CPW Z;  3VNQ A;  1M90 2;  2HHH C;  3LUS A;  1VQK Z;  1YUK A;  4DR5 C;  4GXR A;  3CPW Y;  1PG4 A;  2IV2 X;  3HOV I;  2QRC B;  4D4I A;  3J80 b;  2ZAE B;  4FUT A;  4RM2 A;  5LCI A;  1MD9 A;  3HOY I;  3GTO I;  2P28 A;  1S72 Z;  3O2E A;  5C4J I;  3CCS Z;  4A3C I;  5FLX D;  2RHB A;  4JI0 C;  1VQN 1;  4DCU A;  3BG0 B;  3UX3 A;  2P02 A;  3NDI A;  4NXN C;  1I94 C;  3MZK B;  3T4N B;  1Z03 A;  2IZ4 A;  1TWG I;  2LFU A;  2VPZ A;  3HOW I;  3JAM D;  2JMO A;  1N36 C;  1VQ5 1;  4LF8 C;  3IML A;  4OXI A;  1Q86 2;  1XNR C;  3H3V J;  2AYD A;  2E9H A;  2VQF C;  3S17 I;  1RQF A;  5T8S A;  4NBE A;  2E8F A;  4FUQ A;  2PRO A;  3CCQ 1;  1KRL A;  2RT9 A;  1VQP Z;  2OO4 A;  4DG9 A;  4NXM C;  2M48 A;  2ASB A;  1HNZ C;  2QRE B;  2GTI A;  1ZB9 A;  2GTH A;  4KTV A;  1ZH1 A;  2JIR A;  2RPR A;  2DPL A;  4JYA C;  5ADZ A;  4A3G I;  3JAM f;  4JV5 C;  4GXQ A;  2KI7 B;  3CCU 1;  1XRC A;  1FJG C;  1O92 A;  3NI2 A;  4DK1 A;  3AF5 A;  3G7S A;  3CC4 1;  1NY8 A;  3DHV A;  3VTN A;  2WP0 C;  4DCV A;  2AYA A;  4NBA A;  2HU9 A;  1QWI A;  4G36 A;  3PO3 I;  1TWC I;  3CCM Z;  1M90 1;  1JJ2 Z;  2YWC A;  4LF5 C;  2Q4Z A;  1JJ2 Y;  1YIJ Z;  5CM2 M;  2QEX 1;  4R1L A;  3JAM b;  1SFO I;  3CC2 Z;  1YHQ Z;  1VQ4 1;  3S2D I;  2QVZ X;  3AY0 A;  1FLO A;  2EGT A;  2YU9 I;  3Q87 A;  2E8C A;  2UUC C;  3H0G I;  4LFC C;  3S2H I;  3CC7 1;  1VQ8 Z;  4ZJZ A;  3VNS A;  2CXC A;  4AYB A;  3GTM S;  2WAQ A;  5JRH A;  4NBD A;  5D1O B;  2QA4 Z;  1USP B;  3U50 C;  4X66 C;  4NFR A;  1Q86 1;  1VQL 1;  1YI2 Z;  1NYE A;  1TFI A;  1YJ9 1;  3CMA 1;  1PG3 A;  1Y1V S;  3GKQ A;  1R9T I;  3LAX A;  4JI2 C;  1DL6 A;  3TE5 B;  4QTT A;  4DV2 C;  1ZB8 A;  5IT9 D;  4L4Q A;  4DG8 A;  1VQM Z;  1MDF A;  4X64 C;  4MXU A;  4BY7 I;  1WCJ A;  3S82 A;  3G4S 1;  2P2F A;  5H9U A;  3CCJ 1;  4X62 C;  4RM3 A;  3CQ2 A;  2P2J A;  1I50 I;  1MKY A;  2GU2 A;  1EGA A;  2D1T A;  3I55 Z;  1AMU A;  2RIQ A;  3TR3 A;  3KIF A;  3J81 D;  5KYV A;  1UWD A;  3M4O I;  2CU6 A;  3GR1 A;  3GCF A;  1O93 A;  1V60 A;  2YCB A;  4S1T A;  1N8R 2;  4A3F I;  2D28 C;  3FCE A;  2E2H I;  5IT9 f;  4MD8 A;  2M5H A;  1QM4 A;  3QWU A;  3CW9 A;  4L2Z A;  2VPW A;  2VUM I;  4E32 A;  4PHT A;  1M1K 2;  3C5E A;  4A3K I;  4NBG A;  3P5J B;  2D1R A;  2XR1 A;  1VQ9 1;  1Q16 A;  2V3V A;  3T1Y C;  1K73 2;  3D2L A;  4WS9 A;  1IBM C;  1O90 A;  1KD1 2;  4LFB C;  1YIT Z;  3J81 f;  1KC8 2;  4E30 A;  2P2B A;  5IT9 b;  2OBV A;  3UEB A;  3NDJ A;  3ESW A;  5KYT A;  4LF6 C;  1AA6 A;  3G6E Z;  4A3M I;  1TH5 A;  4BBY A;  1L1O C;  2W04 A;  4G37 A;  3N54 B;  4RVG A;  4NOZ A;  2R7Z I;  2KZ0 A;  4D56 A;  4LF4 C;  2Y0S A;  3A25 A;  4X6A I;  2JS4 A;  3RG2 A;  2P2M A;  4E33 A;  2OOY B;  3GTK I;  1TWA I;  3NH4 A;  4NH1 C;  2E8E A;  1IBL C;  3J81 b;  5AE3 A;  4EAT A;  3GTG I;  2G2K A;  4K0B A;  2MMA B;  4G1I A;  2AKL A;  5D1O A;  1USP A;  3CCR Z;  1LCI A;  2OTJ Z;  2ONF A;  4JI5 C;  3MON A;  1RO2 A;  1L2F A;  1M6X A;  1RO0 A;  3I4N I;  1VQ6 1;  5KEI A;  4E2X A;  1YJN Z;  5LL6 f;  2PMZ A;  1HNX C;  1Y8C A;  4BY1 I;  3I56 Z;  1O9T A;  2H85 A;  1MDB A;  1WW9 A;  3CME Z;  1WJ2 A;  4RVO A;  4MD7 A;  1P4E A;  1LQL A;  4OX9 C;  1I6H I;  4NBC A;  1X3W A;  1VEH A;  2E2J I;  4L7I A;  1N8R 1;  1FDO A;  3ETC A;  1XMQ C;  3TDE A;  1K9M 2;  2M5O A;  5FLX f;  4DR6 C;  1X0T A;  3A9V A;  5BUS A;  1M1K 1;  1QVF Z;  4DQY B;  1N34 C;  2ATW A;  1QVF Y;  4A3E I;  4Y7N I;  3B7W A;  4EWC A;  1K73 1;  2OPL B;  3L95 X;  2DE5 A;  4A3I I;  5D1P A;  4NB8 A;  2Y27 A;  4X65 C;  5DV9 A;  1KD1 1;  3E7W A;  4NDN A;  1P9N A;  2O53 A;  1KC8 1;  2WD9 A;  1RNI A;  5AE1 A; 
#chains in the Genus database with same CATH homology
 3F3P C;  2I3C A;  5FLX b;  2KPI A;  3CCE 1;  4JI6 C;  2OTL Z;  5T64 A;  2VUG A;  1YHQ 1;  4DCS A;  2JA7 I;  2R93 I;  3PBK A;  2VSQ A;  2QR1 B;  3FKI I;  3CCQ Z;  2V7B A;  4E31 A;  1WF3 A;  1N33 C;  1WH9 A;  3S1N I;  1JOS A;  5BR8 C;  3S15 I;  3I4M I;  4DUY C;  4IZ6 A;  5A2Q D;  4DR1 C;  3DLP X;  3CCU Z;  3CW8 X;  2JR6 A;  3G71 1;  2OOX B;  2YAD A;  3NFZ A;  2Y4O A;  3CJE A;  1N2F A;  3SO4 A;  4MRI A;  3CC4 Z;  2PM9 A;  1VQ7 1;  5IWA C;  1HNW C;  3PES A;  1GPM A;  3J7A 4;  1XNQ C;  1YJW 1;  4DV4 C;  2UXC C;  3CQZ I;  2P20 A;  2Y4N A;  1WII A;  2LIY A;  4RS4 A;  4NBF A;  2QLV B;  1FUG A;  3CD6 Z;  4BXX I;  2E5L C;  2PT7 G;  4JI7 C;  2QEX Z;  1K9M 1;  1Y1W I;  4I9G A;  4DV5 C;  2B63 I;  1VQ4 Z;  2ZM6 C;  4JI4 C;  3LGX A;  4JI8 C;  1K8A 2;  1S7M A;  3K7A I;  3HOX I;  4ODJ A;  3CC7 Z;  3R44 A;  4NBH A;  2UUA C;  3CCV Z;  1ULT A;  2DE7 A;  1W2B Z;  3N2Q A;  2F4M A;  4DGL A;  2JMP A;  4IR7 A;  4E2Z A;  3DAY A;  1W2B Y;  4RLQ A;  1VQL Z;  1XRB A;  3VMH A;  4Y52 I;  1YJ9 Z;  1VQO 1;  5LMU C;  2NVY I;  3PRO C;  4I9F A;  3IFU A;  2JA5 I;  3LNV A;  2OPL A;  5T8T A;  4RVD A;  2K3R A;  3CCL 1;  1KQS Z;  4A93 I;  4YHH C;  4RV9 A;  3TQI A;  5CZX A;  3VMI A;  1KQS Y;  3J80 D;  3CXC Z;  3FQQ A;  3G4S Z;  3CXC Y;  3GTM I;  3CCJ Z;  2E0G A;  4KTT A;  5BSW A;  4RLF A;  3H2T A;  4FTF A;  4JM1 A;  2NVX I;  2JA8 I;  2R92 I;  2QKD A;  5AN9 F;  1VQK 1;  1PA4 A;  2QVX X;  4E2W A;  2VQE C;  3HKZ A;  1WCM I;  4PZP A;  5A19 A;  2W03 A;  1RLY A;  2V8K A;  3A4I A;  2UU9 C;  1Y1V I;  2VF1 A;  1K0R A;  3L8C A;  3VMG A;  1S72 1;  2NVQ I;  4PRO C;  4B3M C;  5BSR A;  3CCS 1;  3UZ0 A;  3GR0 A;  2BH1 X;  1Q81 2;  5CZV A;  4ISB A;  1NP6 A;  5AE2 A;  2D7V A;  3CCR 1;  2OTJ 1;  2V8J A;  1QF8 A;  5FLM I;  4DV1 C;  1NJI 2;  1YJN 1;  4BCA A;  3KXW A;  1JWH C;  1TWH I;  4NB9 A;  1YUA A;  1K8A 1;  3D6W A;  1MXB A;  2D1S A;  3S16 I;  3RZD I;  3VB9 A;  5E7Q A;  4DR2 C;  1KKG A;  1RO4 A;  4HGY A;  4A3L I;  3EER A;  1MXA A;  1BA3 A;  3PO3 S;  1V26 A;  2UUB C;  2JNY A;  4DCT A;  1XRA A;  2VZE A;  4CL1 A;  1VQP 1;  4QTU A;  4HH4 A;  3GPC A;  5IFI A;  4DR4 C;  1Q82 2;  1IBK C;  1Q7Y 2;  4GKK C;  2HF1 A;  2HJG A;  4WV3 A;  3HOZ I;  3EED A;  4MH4 A;  1Z01 A;  2F4O A;  1VQN Z;  4JI1 C;  2K5R A;  4BSZ A;  4DV0 C;  5T67 A;  5T6B A;  1MXC A;  3A9U A;  5IP7 I;  2OTL 1;  1VQ6 Z;  4LE5 A;  3CCM 1;  4DV7 C;  3TDH B;  1VQ5 Z;  1P7L A;  1X3Z A;  2E2I I;  3ETO A;  1YIJ 1;  2OZK A;  2D27 A;  3I07 A;  5LMN C;  3CC2 1;  1J5E C;  2PK7 A;  5C44 I;  4B3S C;  3F3F C;  1TWF I;  4R0M A;  1RY2 A;  3FCC A;  4BC9 A;  3HOU I;  4BBS I;  1VLA A;  3IF8 A;  1Q81 1;  4RVN A;  5GTD A;  1VQ8 1;  5BUR A;  4DR3 C;  3OTO C;  4BBR I;  2F4V C;  1NJI 1;  1N32 C;  2QA4 1;  2P3Y A;  5BUQ A;  3NH8 A;  4ZLP A;  3D9X A;  1I3Q I;  3GTQ I;  1ML8 A;  1YI2 1;  4DV3 C;  4K0K C;  5BST A;  3CD6 1;  4MTN A;  3CCE Z;  4GS5 A;  4GKJ C;  4AQY C;  4D57 A;  3S1R I;  3NYR A;  4DUZ C;  4XX2 A;  1VQM 1;  3OW2 Z;  3NPD A;  1PFT A;  1HR0 C;  3OW2 Y;  1Q82 1;  4DV6 C;  4E2Y A;  5K8F A;  1Q7Y 1;  5BSV A;  1RG9 A;  1YJ7 A;  5A2Q f;  3CCV 1;  3PO2 I;  4A3D I;  4LF9 C;  2RBL A;  3I55 1;  3VNR A;  4OYC A;  2IZ3 A;  3RZO I;  4LFA C;  3S14 I;  3RV2 A;  4R1M A;  3G71 Z;  4BC7 A;  1QVG Z;  3T1H C;  3M3Y I;  4RMN A;  1VQ7 Z;  4HPV A;  1QYP A;  1QVG Y;  3GTP I;  4A3B I;  1T5D X;  4B3T C;  5C4X I;  1YJW Z;  5BSM A;  3E7X A;  3R9X A;  2M6N A;  1UKK A;  5A1G A;  5A2Q b;  4TNU A;  5BSU A;  2UXB C;  1HH2 P;  3CMA Z;  4B3R C;  3IPL A;  4A3J I;  3BG1 B;  2E7G A;  2V8I A;  2KZF A;  3UOW A;  3TUF A;  5C3E I;  2Q51 A;  1K83 I;  1YIT 1;  1T5H X;  3I08 A;  3IEV A;  3S1Q I;  4LF7 C;  1XMO C;  3KIH A;  1Z02 A;  3G6E 1;  3AF6 A;  5IP9 I;  2YWB A;  3NH5 A;  2J6A A;  2JUB A;  2P2Q A;  3IEU A;  2PN2 A;  3GKU A;  2QL8 A;  2DYJ A;  2QW0 X;  4U5Y D;  2WB1 A;  4RVF A;  5A1I A;  4MON A;  4NBB A;  2DE6 A;  2D1Q A;  3R9W A;  2CY1 A;  2UXD C;  1VQO Z;  1V25 A;  3NYQ A;  4KHP C;  2O4H A;  1NUI A;  3J80 f;  3FQM A;  2BJO A;  4HGZ A;  3CCL Z;  3S1M I;  2QVY X;  3EQ6 A;  3MZL B;  5K85 A;  4RVH A;  4DR7 C;  4TPS B;  3GTL I;  4MD9 A;  1VQ9 Z;  4JI3 C;  2R6M A;  4D4G A;  3GTJ I;  3I56 1;  3CME 1;  2NVT I;  2QRD B;  2JA6 I;  4YY3 C;  3IX0 A;  3CPW Z;  3VNQ A;  1M90 2;  2HHH C;  3LUS A;  1VQK Z;  1YUK A;  4DR5 C;  4GXR A;  3CPW Y;  1PG4 A;  4D4I A;  3HOV I;  2QRC B;  3J80 b;  2ZAE B;  4FUT A;  4RM2 A;  1MD9 A;  3HOY I;  3GTO I;  2P28 A;  1S72 Z;  5C4J I;  3CCS Z;  4A3C I;  5FLX D;  2RHB A;  4JI0 C;  1VQN 1;  4DCU A;  3BG0 B;  2P02 A;  3NDI A;  4NXN C;  1I94 C;  3MZK B;  3T4N B;  1Z03 A;  2IZ4 A;  1TWG I;  2LFU A;  3HOW I;  3JAM D;  2JMO A;  1N36 C;  1VQ5 1;  4LF8 C;  3IML A;  4OXI A;  1Q86 2;  1XNR C;  3H3V J;  2E9H A;  2VQF C;  3S17 I;  1RQF A;  5T8S A;  4NBE A;  2E8F A;  4FUQ A;  2PRO A;  3CCQ 1;  1KRL A;  2RT9 A;  1VQP Z;  2OO4 A;  4DG9 A;  4NXM C;  2M48 A;  2ASB A;  1HNZ C;  2QRE B;  2GTI A;  1ZB9 A;  2GTH A;  4KTV A;  1ZH1 A;  2RPR A;  4JYA C;  2DPL A;  5ADZ A;  4A3G I;  3JAM f;  4JV5 C;  4GXQ A;  2KI7 B;  3CCU 1;  1XRC A;  1FJG C;  1O92 A;  3NI2 A;  4DK1 A;  3AF5 A;  3G7S A;  3CC4 1;  3DHV A;  3VTN A;  2WP0 C;  4DCV A;  2AYA A;  4NBA A;  2HU9 A;  1QWI A;  4G36 A;  3PO3 I;  1TWC I;  3CCM Z;  1M90 1;  1JJ2 Z;  2YWC A;  4LF5 C;  2Q4Z A;  1JJ2 Y;  1YIJ Z;  5CM2 M;  2QEX 1;  4R1L A;  3JAM b;  1SFO I;  3CC2 Z;  1YHQ Z;  1VQ4 1;  3S2D I;  2QVZ X;  2EGT A;  2YU9 I;  3Q87 A;  2E8C A;  2UUC C;  3H0G I;  4LFC C;  3S2H I;  3CC7 1;  1VQ8 Z;  4ZJZ A;  3VNS A;  2CXC A;  4AYB A;  3GTM S;  2WAQ A;  5JRH A;  4NBD A;  5D1O B;  2QA4 Z;  1USP B;  3U50 C;  4X66 C;  4NFR A;  1Q86 1;  1VQL 1;  1YI2 Z;  1NYE A;  1TFI A;  1YJ9 1;  3CMA 1;  1PG3 A;  1Y1V S;  3GKQ A;  1R9T I;  3LAX A;  4JI2 C;  1DL6 A;  3TE5 B;  4QTT A;  4DV2 C;  1ZB8 A;  5IT9 D;  4L4Q A;  4DG8 A;  1VQM Z;  1MDF A;  4X64 C;  4MXU A;  4BY7 I;  3S82 A;  3G4S 1;  2P2F A;  5H9U A;  3CCJ 1;  4X62 C;  4RM3 A;  2P2J A;  1I50 I;  1MKY A;  2GU2 A;  1EGA A;  2D1T A;  3I55 Z;  1AMU A;  2RIQ A;  3KIF A;  3J81 D;  5KYV A;  3M4O I;  3GR1 A;  3GCF A;  1O93 A;  2YCB A;  4S1T A;  1N8R 2;  4A3F I;  2D28 C;  3FCE A;  2E2H I;  5IT9 f;  4MD8 A;  1QM4 A;  3QWU A;  3CW9 A;  4L2Z A;  2VUM I;  4E32 A;  4PHT A;  1M1K 2;  3C5E A;  4A3K I;  4NBG A;  3P5J B;  2D1R A;  2XR1 A;  1VQ9 1;  3T1Y C;  1K73 2;  4WS9 A;  1IBM C;  1O90 A;  1KD1 2;  4LFB C;  1YIT Z;  3J81 f;  1KC8 2;  4E30 A;  2P2B A;  5IT9 b;  2OBV A;  3NDJ A;  3ESW A;  5KYT A;  4LF6 C;  3G6E Z;  4A3M I;  4BBY A;  1L1O C;  2W04 A;  4G37 A;  3N54 B;  4RVG A;  4NOZ A;  2R7Z I;  4D56 A;  4LF4 C;  2Y0S A;  4X6A I;  2JS4 A;  3RG2 A;  2P2M A;  4E33 A;  2OOY B;  3GTK I;  1TWA I;  3NH4 A;  4NH1 C;  2E8E A;  1IBL C;  3J81 b;  5AE3 A;  4EAT A;  3GTG I;  2G2K A;  4K0B A;  4G1I A;  2AKL A;  5D1O A;  1USP A;  3CCR Z;  1LCI A;  2OTJ Z;  2ONF A;  4JI5 C;  3MON A;  1RO2 A;  1L2F A;  1RO0 A;  3I4N I;  1VQ6 1;  5KEI A;  4E2X A;  1YJN Z;  5LL6 f;  2PMZ A;  1HNX C;  4BY1 I;  3I56 Z;  1O9T A;  2H85 A;  1MDB A;  1WW9 A;  3CME Z;  4RVO A;  4MD7 A;  1LQL A;  4OX9 C;  1I6H I;  4NBC A;  1X3W A;  4L7I A;  2E2J I;  1N8R 1;  3ETC A;  1XMQ C;  3TDE A;  1K9M 2;  5FLX f;  4DR6 C;  1X0T A;  3A9V A;  5BUS A;  1M1K 1;  1QVF Z;  4DQY B;  1N34 C;  2ATW A;  1QVF Y;  4A3E I;  4Y7N I;  3B7W A;  4EWC A;  1K73 1;  2OPL B;  3L95 X;  2DE5 A;  4A3I I;  5D1P A;  4NB8 A;  2Y27 A;  4X65 C;  5DV9 A;  1KD1 1;  3E7W A;  4NDN A;  1P9N A;  2O53 A;  1KC8 1;  2WD9 A;  1RNI A;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...