1ZB9A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
141
Chain Sequence
NSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords organic hydroperoxide resistance protein
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
total genus 34
structure length 141
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb9A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb9A02
3H0GI 2E2II 3M4OI 1USPA 4DR4C 5FLXD 1ZB9A 5LMNC 3FKII 3HOZI 1I94C 1X3ZA 4X64C 4A3LI 4A93I 2AKLA 3GTMI 2KPIA 4NBFA 4JI2C 4X62C 2JA8I 4JI7C 2JR6A 4DV4C 2DE6A 4JI8C 4NXNC 2DE5A 1L1OC 4LFCC 3S2DI 1RO4A 4BY7I 2P3YA 2NVYI 2F4OA 1L2FA 4X66C 3S1QI 2JS4A 4B3TC 4DCVA 1USPB 5IWAC 4DV6C 4DR6C 2JNYA 1TWHI 3PO3I 3S1RI 4JV5C 3HOWI 5BR8C 1XMOC 1ZB8A 2HHHC 1I50I 1TWFI 2ONFA 2YU9I 4BBRI 3I4NI 4DV2C 1NYEA 2EGTA 1Y1VI 3LUSA 3JAMD 3GKUA 4B3MC 4QTTA 4JI6C 4DV0C 4MTNA 4KHPC 3VMHA 2E8EA 3T1HC 2JA7I 3M3YI 2F4VC 1HH2P 3GKQA 2VUMI 1WCMI 2PN2A 4NXMC 4JI5C 4NB9A 1UKKA 3VB9A 4NBDA 2NVXI 2ATWA 4YHHC 2VQEC 3GTLI 2K5RA 4LF9C 1SFOI 5C4JI 4QTUA 3J80D 1N34C 3R9WA 2UU9C 3S1MI 4DR1C 4K0KC 2E2JI 4NBHA 4DR3C 1HNWC 4JI4C 4JI1C 4B3RC 1ML8A 2CY1A 3S17I 1EGAA 1KKGA 1J5EC 4DUZC 1X3WA 4DCSA 5FLMI 4DV3C 2BJOA 2RBLA 4Y7NI 2YCBA 3HOUI 2QL8A 3GTMS 5C44I 3U50C 5IT9D 4LFBC 4A3CI 4LF8C 4B3SC 1QYPA 4OX9C 1K83I 1K0RA 4AQYC 2E5LC 1QWIA 3GTKI 4JYAC 2JA6I 1HNZC 3GTQI 3J81D 3IEVA 2B63I 4LF5C 1TWAI 4NBEA 4X6AI 2E8CA 4Y52I 2DYJA 3K7AI 3S1NI 4A3GI 4A3MI 4JI3C 2HJGA 1DL6A 4NBCA 2JMPA 4NBAA 4X65C 2UUCC 2NVTI 3D6WA 4BXXI 2R92I 1HNXC 1RLYA 2E7GA 3I07A 4JI0C 4XX2A 2UUBC 2R7ZI 2JA5I 3VMIA 3AF6A 4BY1I 4LFAC 4DCUA 1NUIA 4DCTA 1WH9A 5C3EI 4DUYC 3VMGA 4LF4C 4NB8A 1I6HI 4NBBA 4DV7C 4NOZA 2DE7A 4YY3C 2UUAC 1TWCI 2NVQI 1N36C 3AF5A 2D7VA 2J6AA 1LQLA 3S2HI 2VQFC 2UXBC 3S16I 3OTOC 3GTPI 2ZM6C 2CXCA 1MKYA 1XNQC 1JOSA 3CQZI 4DV1C 5C4XI 3GTOI 1N33C 3HOVI 3H3VJ 1IBLC 4GKJC 3RZOI 3I4MI 2OPLA 1HR0C 3RZDI 2R93I 4A3KI 2ASBA 2UXDC 1YUAA 4LF6C 4NBGA 4GKKC 1Y1WI 4A3DI 3GTJI 1TWGI 3R9XA 2PK7A 1IBKC 3HOXI 4A3EI 4A3JI 3GTGI 1WW9A 4A3BI 3GCFA 1I3QI 2KZFA 1PFTA 5IP9I 1N32C 4DR2C 3IEUA 2HF1A 2OPLB 1N2FA 4DV5C 5IP7I 5A2QD 2F4MA 4DR7C 3T1YC 2E2HI 5LMUC 3PO3S 4A3FI 2UXCC 4A3II 1XNRC 1IBMC 1Y1VS 4BSZA 4LF7C 1R9TI 2E8FA 3EERA 4MH4A 1FJGC 3S14I 5CM2M 3PO2I 3Q87A 3ESWA 3S15I 4BBSI 1WF3A 3CJEA 1VLAA 1PA4A 2PT7G 3HOYI 2XR1A 1TFIA 1XMQC 4DR5C
chains in the Genus database with same CATH superfamily
3H0GI 3NYRA 2JUBA 3CC2Z 4DG9A 5FLXb 2E2II 3M4OI 5BSRA 5T8TA 4BC7A 1USPA 4DR4C 1M6XC 1ULTA 4FUTA 2R6MA 2Z51A 5FLXD 1ZB9A 3CCLZ 3FKII 3HOZI 1GPMA 5LMNC 2QLVB 1X3ZA 2WB1A 1FDOA 3G71Z 2VZEA 4X64C 2V3VA 4A3LI 2OBVA 4A93I 4G1IA 4GS5A 2CU6A 2AKLA 3GTMI 2Q51A 5BSUA 2KPIA 1V25A 3C5EA 1M1K2 2JIOA 3FQQA 4NBFA 2VUGA 4JI2C 1YJ7A 3VNRA 5DV9A 4RVFA 3VTNA 1VQMZ 1QVFZ 1YI21 3TDEA 4OYCA 1YITZ 4X62C 2JA8I 3RV2A 1VQO1 1P4EC 1JWHC 1XRCA 3CMA1 4JI7C 3IX0A 2JR6A 2IV2X 2JIRA 1Q7Y2 2MM9A 4DV4C 2W04A 5D1OA 2QEXZ 2DE6A 1VQPZ 2QW0X 5T64A 3I08A 3H2TA 3TE5B 2YWBA 4JI8C 4NXNC 1N8R2 5BUSA 2DE5A 3K6RA 4D4GA 1L1OC 1Y8CA 4BBYA 4LFCC 3FCCA 3NFZA 3S2DI 1RO4A 3TQIA 2D28C 4BY7I 2P3YA 2NVYI 2ZZNA 2NCLA 2F4OA 5LL6f 2VF1A 3CCSZ 4FTFA 3CPWY 1L2FA 3NH5A 5T6BA 3IFUA 4HGYA 1Q862 1KQSY 2QRDB 4X66C 3S1QI 2GU2A 2JS4A 2OTJZ 2D27A 4IR7A 4B3TC 4DCVA 3CD6Z 1USPB 5IWAC 4DV6C 4DR6C 1YJNZ 2JNYA 4MRIA 1TWHI 1RG9A 3G6EZ 2JIQA 5CZVA 1O92A 4ISBA 3PO3I 3S1RI 2Y4OA 4JV5C 1VQN1 2Y0SA 3QWUA 1JJ2Y 3HOWI 5BR8C 2P2MA 2VPWA 1XMOC 1ZB8A 2ZZMA 4MD8A 2HHHC 3UX3A 1I50I 1TWFI 1MDBA 3CC4Z 2NAPA 2ONFA 2YU9I 4BBRI 3JAMf 3CCU1 1VQ9Z 3I4NI 4DV2C 2K3RA 1NYEA 2E9HA 5LCIA 3JAMb 2QR1B 2EGTA 1XHJA 4HH4A 1Y1VI 4DQYB 1YJWZ 3LUSA 1MDFA 1M6XA 4MXUA 3JAMD 3GKUA 2AYAA 4RV9A 3G4SZ 4R1LA 2AYDA 1VQ41 3OW2Y 3O2EA 4B3MC 4QTTA 4DK1A 4JI6C 5D1OB 1M901 4DV0C 2WAQA 4MTNA 5AE1A 1V60A 4KHPC 3VMHA 2E8EA 3CQ3A 4RMNA 4D4IA 4L4QA 2V8JA 2JA7I 3T1HC 3L95X 3M3YI 3EQ6A 1IB8A 4ODJA 2F4VC 1HH2P 4JM1A 3GKQA 2VUMI 1MXAA 1WCMI 2QA41 2PN2A 4NXMC 4JI5C 4NB9A 1UKKA 1P4EA 5K8FA 3VB9A 3S82A 4NBDA 2NVXI 5A1IA 2WD9A 2ATWA 4YHHC 2VQEC 3GTLI 2QRCB 2K5RA 3CCRZ 1VQ7Z 4LF9C 4E2WA 1SFOI 4KTTA 4D56A 3A26A 5C4JI 4QTUA 3CQ1A 1I94C 2OOXB 1BA3A 4DG8A 3J80D 2OTL1 1N34C 1VQ61 3CC7Z 3R9WA 2UU9C 3UEBA 4DGLA 4E33A 2MCQA 1S72Z 3S1MI 4HGZA 2QVZX 2H85A 3MZLB 4PHTA 5K85A 1Q861 5D1PA 4DR1C 1W2BY 4K0KC 2E2JI 5GTDA 4NBHA 3G711 1PG3A 4DR3C 3I561 2V8KA 3VNQA 3N2QA 4PUIA 1YJ9Z 1HNWC 4JI4C 1M902 1FLOA 4JI1C 4B3RC 2M48A 3A9VA 1ML8A 1Z03A 3T4NB 2CY1A 2P2QA 3S17I 5CZXA 1EGAA 1O93A 3EEDA 1KKGA 5A1GA 3SO4A 2W03A 2VPZA 1J5EC 4DUZC 2P28A 3CCE1 3G7SA 3UX2A 1Q821 3GR1A 1X3WA 4DCSA 3L8CA 5FLMI 1WJ2A 3CXCZ 1XRAA 4DV3C 2QEX1 2M6NA 2OO4A 4EATA 3CQ2A 2BJOA 1RY2A 2M5HA 4G37A 2RBLA 4Y7NI 2RPRA 1NP6A 2LFUA 5IT9f 1NJI2 2YCBA 3ETCA 4RVDA 1AA6A 3HOUI 5IT9b 1YI2Z 1X0TA 1VQOZ 2QL8A 3CCVZ 3GTMS 4FUQA 5C44I 3U50C 1WIIA 1QVGZ 5IT9D 4GXRA 3CCS1 4LFBC 4LE5A 2VPXA 4A3CI 4LF8C 1T5HX 3PESA 4B3SC 1QYPA 3I55Z 3CCJ1 3MZKB 4RLFA 2OTJ1 2OOYB 4OX9C 4E32A 3J81f 1K83I 3E7XA 1K0RA 3A25A 4AQYC 2E5LC 1YJN1 1FDIA 3J81b 1QWIA 3G6E1 3F3FC 3UOWA 1VQ5Z 3GTKI 3D9XA 2JA6I 1HNZC 4JYAC 3GTQI 3J81D 2JNVA 4OXIA 1K731 3IEVA 2B63I 4AYBA 1TWAI 4LF5C 2LEXA 4NBEA 3NDJA 1VQK1 4X6AI 3RG2A 3A4IA 1VQ91 2E8CA 1AMUA 4Y52I 3FCEA 2DYJA 1S7MA 3K7AI 1Z01A 3S1NI 4A3GI 1Q822 3DAYA 4A3MI 4I9GA 4JI3C 2HJGA 3R44A 1QVFY 1DL6A 2PROA 2QVYX 4NBCA 2GTIA 4NBAA 2JMPA 2Y4NA 4X65C 2NVTI 3MONA 5KYTA 2UUCC 3D6WA 4BXXI 3E7WA 2P2JA 2R92I 2HU9A 3IF8A 5BSMA 3TDHB 1HNXC 4PZPA 1RLYA 1KC81 2E7GA 3I07A 1Q811 5E7QA 5A19A 1K8A1 3CCUZ 3NH4A 4GXQA 2PMZA 4JI0C 4XX2A 4TNUA 2R7ZI 2JA5I 2UUBC 1KD11 3CCQZ 2YWCA 3VMIA 3F3PC 3AF6A 4WV3A 4BY1I 3NPDA 4LFAC 1Z02A 4DCUA 3A9UA 3NDIA 3PBKA 4PROC 5AE3A 4MD7A 4RLQA 3CCMZ 1NUIA 1QVGY 2QVXX 3AY0A 4DCTA 1WH9A 3J80f 4R0MA 2IZ3A 5T8SA 2D1TA 3LGXA 5C3EI 1YHQZ 4S1TA 4DUYC 1YIJ1 4NH1C 3J80b 3VMGA 1PG4A 1WCJA 2MMAB 4NB8A 1VQ71 1I6HI 4BC9A 4NBBA 1NJI1 2RT9A 5BSVA 4L2ZA 5H9UA 1K732 1VQLZ 4I9FA 1NY8A 4DV7C 4NOZA 1PU1A 1O90A 4MONA 3CC21 2QA4Z 1MD9A 2DE7A 1P7LA 2JIPA 3IR7A 4YY3C 3NI2A 2LIYA 2UUAC 1YUKA 1TWCI 3CCL1 1K9M1 2NVQI 1N36C 2O53A 3B7WA 3KXWA 3AF5A 3P5JB 2D7VA 2J6AA 1O9TA 3CMEZ 3CPWZ 2Y27A 1LQLA 3S2HI 4E2ZA 1KQSZ 4E2XA 1VEHA 1KC82 2VQFC 1VQ8Z 2KDNA 2UXBC 4LF4C 4R1MA 3ETOA 3KIHA 3BG0B 1Q812 3S16I 3GTPI 2M5OA 2QKDA 1K8A2 3LAXA 3OTOC 2ZM6C 1MKYA 2CXCA 1XNQC 1VQM1 3CQZI 1JOSA 4DV1C 1YIT1 2E7ZA 1KD12 5C4XI 3GTOI 1N33C 2QREB 3HOVI 2D1QA 3H3VJ 3I56Z 3DLPX 4PUHA 1JJ2Z 4RM3A 2V8IA 1MXBA 1IBLC 4GKJC 3RZOI 3I4MI 2OPLA 1FUGA 1V26A 2OZKA 1HR0C 3RZDI 2R93I 1VQP1 4A3KI 4BCAA 1P9NA 2ASBA 1RO0A 4L7IA 2O4HA 2UXDC 1YUAA 2G2KA 4EWCA 4LF6C 4TPSB 4NBGA 3DHVA 3J7A4 4GKKC 2Q4ZA 3OW2Z 2I3CA 1Y1WI 2KZ0A 4RVOA 4WS9A 3CCV1 3CCEZ 1RNIA 4RVHA 3CMAZ 3CW8X 5AE2A 4A3DI 5IFIA 1T5DX 3GTJI 3I551 1TWGI 4IZ6A 1QXFA 2RIQA 3GPCA 5ADZA 4E30A 2PK7A 3BG1B 1K9M2 4KTVA 3CD61 1XS3A 3R9XA 2YX1A 1IBKC 3HOXI 4A3EI 4A3JI 3GTGI 3TR3A 4MD9A 2P20A 1WW9A 4RM2A 2IZ4A 2D1SA 4A3BI 1VQ51 1UWDA 3GCFA 1I3QI 4RVNA 2KZFA 2WP0C 5KYVA 2P2BA 1PFTA 1TH5A 5IP9I 1N32C 3CC41 1XRBA 2JMOA 1WZNA 2D1RA 3CCJZ 4DR2C 1YJW1 1KRLA 4E31A 3IEUA 3G4S1 2HF1A 2JIMA 4HPVA 3D2LA 3LNVA 5A2Qf 2KI7B 3IPLA 2BH1X 1ZH1A 2OPLB 1VQNZ 1N2FA 4DV5C 1MXCA 5A2Qb 3NYQA 5AN9F 4E2YA 2YADA 3CXCY 1W2BZ 1RO2A 2GTHA 2V45A 3IMLA 2RHBA 5IP7I 1VQKZ 2DPLA 3PROC 5A2QD 2F4MA 4DR7C 2P2FA 3CW9A 4K0BA 4PUGA 3T1YC 2E0GA 3CCQ1 4D57A 2E2HI 5KEIA 1QF8A 5LMUC 3PO3S 4A3FI 1VQ4Z 4ZJZA 3TUFA 2UXCC 3CCM1 2VPYA 4A3II 1XNRC 1RQFA 1M1K1 5T67A 5BSWA 1VQ81 5BURA 1YHQ1 3CCR1 1IBMC 1Y1VS 4BSZA 4LF7C 1R9TI 2E8FA 3EERA 1VQL1 4MH4A 3LNOA 3CC71 1QM4A 1FJGC 3S14I 5CM2M 3PO2I 3N54B 1S721 3Q87A 2VSQA 4NFRA 5BSTA 5JRHA 1Q7Y1 3KIFA 3VNSA 3ESWA 2ZAEB 3S15I 1LCIA 4BBSI 2PM9A 4CL1A 3UZ0A 1WF3A 4RS4A 3CJEA 4NDNA 1Q16A 3HKZA 1YIJZ 1N8R1 2P02A 1VLAA 1PA4A 4ZLPA 2V7BA 4RVGA 2PT7G 1SIWA 3HOYI 3CME1 2DHMA 4U5YD 3FQMA 1TFIA 3NH8A 1YJ91 2XR1A 3GR0A 1XMQC 2OTLZ 4DR5C 1VQ6Z 5BUQA 4G36A 5FLXf
chains in the Genus database with same CATH topology
3H0GI 3NYRA 2JUBA 3CC2Z 4DG9A 5FLXb 2E2II 3M4OI 5BSRA 5T8TA 4BC7A 1USPA 4DR4C 1ULTA 4FUTA 2R6MA 5FLXD 1ZB9A 3CCLZ 3FKII 3HOZI 1GPMA 5LMNC 2QLVB 1X3ZA 2WB1A 3G71Z 2VZEA 4X64C 1I94C 4A3LI 2OBVA 4A93I 4G1IA 4GS5A 2AKLA 3GTMI 2Q51A 5BSUA 2KPIA 1V25A 3C5EA 1M1K2 3FQQA 4NBFA 2VUGA 4JI2C 1YJ7A 3VNRA 5DV9A 4RVFA 3VTNA 1VQMZ 1QVFZ 1YI21 3TDEA 4OYCA 1YITZ 4X62C 2JA8I 3RV2A 1VQO1 1JWHC 1XRCA 3CMA1 4JI7C 3IX0A 2JR6A 1Q7Y2 4DV4C 2W04A 5D1OA 2QEXZ 2DE6A 1VQPZ 2QW0X 5T64A 3I08A 3H2TA 3TE5B 2YWBA 4JI8C 4NXNC 1N8R2 5BUSA 2DE5A 4D4GA 1L1OC 4BBYA 4LFCC 3FCCA 3NFZA 3S2DI 1RO4A 3TQIA 2D28C 4BY7I 2P3YA 2NVYI 2F4OA 5LL6f 2VF1A 3CCSZ 4FTFA 3CPWY 1L2FA 3NH5A 5T6BA 3IFUA 4HGYA 1Q862 1KQSY 2QRDB 4X66C 3S1QI 2GU2A 2JS4A 2OTJZ 2D27A 4IR7A 4B3TC 4DCVA 3CD6Z 1USPB 5IWAC 4DV6C 4DR6C 1YJNZ 2JNYA 4MRIA 1TWHI 1RG9A 3G6EZ 5CZVA 1O92A 4ISBA 3PO3I 3S1RI 2Y4OA 4JV5C 1VQN1 2Y0SA 3QWUA 1JJ2Y 3HOWI 5BR8C 2P2MA 1XMOC 1ZB8A 4MD8A 2HHHC 1I50I 1TWFI 1MDBA 3CC4Z 2ONFA 2YU9I 4BBRI 3JAMf 3CCU1 1VQ9Z 3I4NI 4DV2C 2K3RA 1NYEA 2E9HA 3JAMb 2QR1B 2EGTA 4HH4A 1Y1VI 4DQYB 1YJWZ 3LUSA 1MDFA 4MXUA 3JAMD 3GKUA 2AYAA 4RV9A 3G4SZ 4R1LA 1VQ41 3OW2Y 4B3MC 4QTTA 4DK1A 4JI6C 5D1OB 1M901 4DV0C 2WAQA 4MTNA 5AE1A 4KHPC 3VMHA 2E8EA 4RMNA 4D4IA 4L4QA 2V8JA 2JA7I 3T1HC 3L95X 3M3YI 3EQ6A 4ODJA 2F4VC 1HH2P 4JM1A 3GKQA 2VUMI 1MXAA 1WCMI 2QA41 2PN2A 4NXMC 4JI5C 4NB9A 1UKKA 5K8FA 3VB9A 3S82A 4NBDA 2NVXI 5A1IA 2WD9A 2ATWA 4YHHC 2VQEC 3GTLI 2QRCB 2K5RA 3CCRZ 1VQ7Z 4LF9C 4E2WA 1SFOI 4KTTA 4D56A 5C4JI 4QTUA 2OOXB 1BA3A 4DG8A 3J80D 2OTL1 1N34C 1VQ61 3CC7Z 3R9WA 2UU9C 4DGLA 4E33A 1S72Z 3S1MI 4HGZA 2QVZX 2H85A 3MZLB 4PHTA 5K85A 1Q861 5D1PA 4DR1C 1W2BY 4K0KC 2E2JI 5GTDA 4NBHA 3G711 1PG3A 4DR3C 3I561 2V8KA 3VNQA 3N2QA 1YJ9Z 1HNWC 4JI4C 1M902 4JI1C 4B3RC 2M48A 3A9VA 1ML8A 1Z03A 3T4NB 2CY1A 2P2QA 3S17I 5CZXA 1EGAA 1O93A 3EEDA 1KKGA 5A1GA 3SO4A 2W03A 1J5EC 4DUZC 2P28A 3CCE1 3G7SA 1Q821 3GR1A 1X3WA 4DCSA 3L8CA 5FLMI 3CXCZ 1XRAA 4DV3C 2QEX1 2M6NA 2OO4A 4EATA 2BJOA 1RY2A 4G37A 2RBLA 4Y7NI 2RPRA 2LFUA 1NP6A 5IT9f 1NJI2 2YCBA 3ETCA 4RVDA 3HOUI 5IT9b 1YI2Z 1X0TA 1VQOZ 2QL8A 3CCVZ 3GTMS 4FUQA 5C44I 3U50C 1WIIA 1QVGZ 5IT9D 4GXRA 3CCS1 4LFBC 4LE5A 4A3CI 4LF8C 1T5HX 3PESA 4B3SC 1QYPA 3I55Z 3CCJ1 3MZKB 4RLFA 2OTJ1 2OOYB 4OX9C 4E32A 3J81f 1K83I 3E7XA 1K0RA 4AQYC 2E5LC 1YJN1 3J81b 1QWIA 3G6E1 3F3FC 3UOWA 1VQ5Z 3GTKI 3D9XA 2JA6I 1HNZC 4JYAC 3GTQI 3J81D 4OXIA 1K731 3IEVA 2B63I 4AYBA 1TWAI 4LF5C 4NBEA 3NDJA 1VQK1 4X6AI 3RG2A 3A4IA 1VQ91 2E8CA 1AMUA 4Y52I 3FCEA 2DYJA 1S7MA 3K7AI 1Z01A 3S1NI 4A3GI 1Q822 3DAYA 4A3MI 4I9GA 4JI3C 2HJGA 3R44A 1QVFY 1DL6A 2PROA 2QVYX 4NBCA 2GTIA 4NBAA 2JMPA 2Y4NA 4X65C 2NVTI 3MONA 5KYTA 2UUCC 3D6WA 4BXXI 3E7WA 2P2JA 2R92I 2HU9A 3IF8A 5BSMA 3TDHB 1HNXC 4PZPA 1RLYA 1KC81 2E7GA 3I07A 1Q811 5E7QA 5A19A 1K8A1 3CCUZ 3NH4A 4GXQA 2PMZA 4JI0C 4XX2A 4TNUA 2R7ZI 2JA5I 2UUBC 1KD11 3CCQZ 2YWCA 3VMIA 3F3PC 3AF6A 4WV3A 4BY1I 3NPDA 4LFAC 1Z02A 4DCUA 3A9UA 3NDIA 3PBKA 4PROC 5AE3A 4MD7A 4RLQA 3CCMZ 1NUIA 1QVGY 2QVXX 4DCTA 1WH9A 3J80f 4R0MA 2IZ3A 5T8SA 2D1TA 3LGXA 5C3EI 1YHQZ 4S1TA 4DUYC 1YIJ1 4NH1C 3J80b 3VMGA 1PG4A 4LF4C 4NB8A 1VQ71 1I6HI 4BC9A 4NBBA 1NJI1 2RT9A 5BSVA 4L2ZA 5H9UA 1K732 1VQLZ 4I9FA 4DV7C 4NOZA 1O90A 4MONA 3CC21 2QA4Z 1MD9A 2DE7A 1P7LA 4YY3C 3NI2A 2LIYA 2UUAC 1YUKA 1TWCI 3CCL1 1K9M1 2NVQI 1N36C 2O53A 3B7WA 3KXWA 3AF5A 3P5JB 2D7VA 2J6AA 1O9TA 3CMEZ 3CPWZ 2Y27A 1LQLA 3S2HI 4E2ZA 1KQSZ 4E2XA 1KC82 2VQFC 1VQ8Z 2UXBC 4R1MA 3ETOA 3KIHA 3BG0B 1Q812 3S16I 3GTPI 3OTOC 2QKDA 1K8A2 3LAXA 2ZM6C 1MKYA 2CXCA 1XNQC 1VQM1 3CQZI 1JOSA 4DV1C 1YIT1 1KD12 5C4XI 3GTOI 1N33C 2QREB 3HOVI 2D1QA 3H3VJ 3I56Z 3DLPX 4RM3A 1JJ2Z 2V8IA 1MXBA 1IBLC 4GKJC 3RZOI 3I4MI 2OPLA 1FUGA 1V26A 2OZKA 1HR0C 3RZDI 2R93I 1VQP1 4A3KI 4BCAA 1P9NA 2ASBA 1RO0A 4L7IA 2O4HA 2UXDC 1YUAA 2G2KA 4EWCA 4LF6C 4TPSB 4NBGA 3DHVA 3J7A4 4GKKC 2Q4ZA 3OW2Z 2I3CA 1Y1WI 4RVOA 4WS9A 3CCV1 3CCEZ 1RNIA 4RVHA 3CMAZ 3CW8X 5AE2A 4A3DI 5IFIA 1T5DX 3GTJI 3I551 1TWGI 4IZ6A 5ADZA 2RIQA 3GPCA 3R9XA 4E30A 2PK7A 3BG1B 1K9M2 4KTVA 3CD61 1IBKC 3HOXI 4A3EI 4A3JI 3GTGI 4MD9A 2P20A 1WW9A 4RM2A 2IZ4A 2D1SA 4A3BI 1VQ51 3GCFA 1I3QI 4RVNA 2KZFA 2WP0C 5KYVA 2P2BA 1PFTA 5IP9I 1N32C 3CC41 1XRBA 2JMOA 2D1RA 3CCJZ 4DR2C 1YJW1 1KRLA 4E31A 3IEUA 3G4S1 2HF1A 4HPVA 3LNVA 5A2Qf 2KI7B 3IPLA 2BH1X 1ZH1A 2OPLB 1VQNZ 1N2FA 4DV5C 1MXCA 5A2Qb 3NYQA 5AN9F 4E2YA 2YADA 3CXCY 1W2BZ 1RO2A 2GTHA 3IMLA 2RHBA 5IP7I 1VQKZ 2DPLA 3PROC 5A2QD 2F4MA 4DR7C 2P2FA 3CW9A 4K0BA 3T1YC 2E0GA 3CCQ1 4D57A 2E2HI 5KEIA 1QF8A 5LMUC 3PO3S 4A3FI 1VQ4Z 4ZJZA 3TUFA 2UXCC 3CCM1 4A3II 1XNRC 1RQFA 1M1K1 5T67A 5BSWA 1VQ81 5BURA 1YHQ1 3CCR1 1IBMC 1Y1VS 4BSZA 4LF7C 1R9TI 2E8FA 3EERA 1VQL1 4MH4A 3CC71 1QM4A 1FJGC 3S14I 5CM2M 3PO2I 3N54B 1S721 3Q87A 2VSQA 4NFRA 5BSTA 5JRHA 1Q7Y1 3KIFA 3VNSA 3ESWA 2ZAEB 3S15I 1LCIA 4BBSI 2PM9A 4CL1A 3UZ0A 1WF3A 4RS4A 3CJEA 4NDNA 3HKZA 1YIJZ 1N8R1 2P02A 1VLAA 1PA4A 4ZLPA 2V7BA 4RVGA 2PT7G 3HOYI 3CME1 4U5YD 3FQMA 1TFIA 3NH8A 1YJ91 2XR1A 3GR0A 1XMQC 2OTLZ 4DR5C 1VQ6Z 5BUQA 4G36A 5FLXf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G I;  2E2I I;  3M4O I;  1USP A;  4DR4 C;  5FLX D;  1ZB9 A;  5LMN C;  3FKI I;  3HOZ I;  1I94 C;  1X3Z A;  4X64 C;  4A3L I;  4A93 I;  2AKL A;  3GTM I;  2KPI A;  4NBF A;  4JI2 C;  4X62 C;  2JA8 I;  4JI7 C;  2JR6 A;  4DV4 C;  2DE6 A;  4JI8 C;  4NXN C;  2DE5 A;  1L1O C;  4LFC C;  3S2D I;  1RO4 A;  4BY7 I;  2P3Y A;  2NVY I;  2F4O A;  1L2F A;  4X66 C;  3S1Q I;  2JS4 A;  4B3T C;  4DCV A;  1USP B;  5IWA C;  4DV6 C;  4DR6 C;  2JNY A;  1TWH I;  3PO3 I;  3S1R I;  4JV5 C;  3HOW I;  5BR8 C;  1XMO C;  1ZB8 A;  2HHH C;  1I50 I;  1TWF I;  2ONF A;  2YU9 I;  4BBR I;  3I4N I;  4DV2 C;  1NYE A;  2EGT A;  1Y1V I;  3LUS A;  3JAM D;  3GKU A;  4B3M C;  4QTT A;  4JI6 C;  4DV0 C;  4MTN A;  4KHP C;  3VMH A;  2E8E A;  3T1H C;  2JA7 I;  3M3Y I;  2F4V C;  1HH2 P;  3GKQ A;  2VUM I;  1WCM I;  2PN2 A;  4NXM C;  4JI5 C;  4NB9 A;  1UKK A;  3VB9 A;  4NBD A;  2NVX I;  2ATW A;  4YHH C;  2VQE C;  3GTL I;  2K5R A;  4LF9 C;  1SFO I;  5C4J I;  4QTU A;  3J80 D;  1N34 C;  3R9W A;  2UU9 C;  3S1M I;  4DR1 C;  4K0K C;  2E2J I;  4NBH A;  4DR3 C;  1HNW C;  4JI4 C;  4JI1 C;  4B3R C;  1ML8 A;  2CY1 A;  3S17 I;  1EGA A;  1KKG A;  1J5E C;  4DUZ C;  1X3W A;  4DCS A;  5FLM I;  4DV3 C;  2BJO A;  2RBL A;  4Y7N I;  2YCB A;  3HOU I;  2QL8 A;  3GTM S;  5C44 I;  3U50 C;  5IT9 D;  4LFB C;  4A3C I;  4LF8 C;  4B3S C;  1QYP A;  4OX9 C;  1K83 I;  1K0R A;  4AQY C;  2E5L C;  1QWI A;  3GTK I;  4JYA C;  2JA6 I;  1HNZ C;  3GTQ I;  3J81 D;  3IEV A;  2B63 I;  4LF5 C;  1TWA I;  4NBE A;  4X6A I;  2E8C A;  4Y52 I;  2DYJ A;  3K7A I;  3S1N I;  4A3G I;  4A3M I;  4JI3 C;  2HJG A;  1DL6 A;  4NBC A;  2JMP A;  4NBA A;  4X65 C;  2UUC C;  2NVT I;  3D6W A;  4BXX I;  2R92 I;  1HNX C;  1RLY A;  2E7G A;  3I07 A;  4JI0 C;  4XX2 A;  2UUB C;  2R7Z I;  2JA5 I;  3VMI A;  3AF6 A;  4BY1 I;  4LFA C;  4DCU A;  1NUI A;  4DCT A;  1WH9 A;  5C3E I;  4DUY C;  3VMG A;  4LF4 C;  4NB8 A;  1I6H I;  4NBB A;  4DV7 C;  4NOZ A;  2DE7 A;  4YY3 C;  2UUA C;  1TWC I;  2NVQ I;  1N36 C;  3AF5 A;  2D7V A;  2J6A A;  1LQL A;  3S2H I;  2VQF C;  2UXB C;  3S16 I;  3OTO C;  3GTP I;  2ZM6 C;  2CXC A;  1MKY A;  1XNQ C;  1JOS A;  3CQZ I;  4DV1 C;  5C4X I;  3GTO I;  1N33 C;  3HOV I;  3H3V J;  1IBL C;  4GKJ C;  3RZO I;  3I4M I;  2OPL A;  1HR0 C;  3RZD I;  2R93 I;  4A3K I;  2ASB A;  2UXD C;  1YUA A;  4LF6 C;  4NBG A;  4GKK C;  1Y1W I;  4A3D I;  3GTJ I;  1TWG I;  3R9X A;  2PK7 A;  1IBK C;  3HOX I;  4A3E I;  4A3J I;  3GTG I;  1WW9 A;  4A3B I;  3GCF A;  1I3Q I;  2KZF A;  1PFT A;  5IP9 I;  1N32 C;  4DR2 C;  3IEU A;  2HF1 A;  2OPL B;  1N2F A;  4DV5 C;  5IP7 I;  5A2Q D;  2F4M A;  4DR7 C;  3T1Y C;  2E2H I;  5LMU C;  3PO3 S;  4A3F I;  2UXC C;  4A3I I;  1XNR C;  1IBM C;  1Y1V S;  4BSZ A;  4LF7 C;  1R9T I;  2E8F A;  3EER A;  4MH4 A;  1FJG C;  3S14 I;  5CM2 M;  3PO2 I;  3Q87 A;  3ESW A;  3S15 I;  4BBS I;  1WF3 A;  3CJE A;  1VLA A;  1PA4 A;  2PT7 G;  3HOY I;  2XR1 A;  1TFI A;  1XMQ C;  4DR5 C; 
#chains in the Genus database with same CATH topology
 3H0G I;  3NYR A;  2JUB A;  3CC2 Z;  4DG9 A;  5FLX b;  2E2I I;  3M4O I;  5BSR A;  5T8T A;  4BC7 A;  1USP A;  4DR4 C;  1M6X C;  1ULT A;  4FUT A;  2R6M A;  2Z51 A;  5FLX D;  1ZB9 A;  3CCL Z;  3FKI I;  3HOZ I;  1GPM A;  5LMN C;  2QLV B;  1X3Z A;  2WB1 A;  1FDO A;  3G71 Z;  2VZE A;  4X64 C;  2V3V A;  4A3L I;  2OBV A;  4A93 I;  4G1I A;  4GS5 A;  2CU6 A;  2AKL A;  3GTM I;  2Q51 A;  5BSU A;  2KPI A;  1V25 A;  3C5E A;  1M1K 2;  2JIO A;  3FQQ A;  4NBF A;  2VUG A;  4JI2 C;  1YJ7 A;  3VNR A;  5DV9 A;  4RVF A;  3VTN A;  1VQM Z;  1QVF Z;  1YI2 1;  3TDE A;  4OYC A;  1YIT Z;  4X62 C;  2JA8 I;  3RV2 A;  1VQO 1;  1P4E C;  1JWH C;  1XRC A;  3CMA 1;  4JI7 C;  3IX0 A;  2JR6 A;  2IV2 X;  2JIR A;  1Q7Y 2;  2MM9 A;  4DV4 C;  2W04 A;  5D1O A;  2QEX Z;  2DE6 A;  1VQP Z;  2QW0 X;  5T64 A;  3I08 A;  3H2T A;  3TE5 B;  2YWB A;  4JI8 C;  4NXN C;  1N8R 2;  5BUS A;  2DE5 A;  3K6R A;  4D4G A;  1L1O C;  1Y8C A;  4BBY A;  4LFC C;  3FCC A;  3NFZ A;  3S2D I;  1RO4 A;  3TQI A;  2D28 C;  4BY7 I;  2P3Y A;  2NVY I;  2ZZN A;  2NCL A;  2F4O A;  5LL6 f;  2VF1 A;  3CCS Z;  4FTF A;  3CPW Y;  1L2F A;  3NH5 A;  5T6B A;  3IFU A;  4HGY A;  1Q86 2;  1KQS Y;  2QRD B;  4X66 C;  3S1Q I;  2GU2 A;  2JS4 A;  2OTJ Z;  2D27 A;  4IR7 A;  4B3T C;  4DCV A;  3CD6 Z;  1USP B;  5IWA C;  4DV6 C;  4DR6 C;  1YJN Z;  2JNY A;  4MRI A;  1TWH I;  1RG9 A;  3G6E Z;  2JIQ A;  5CZV A;  1O92 A;  4ISB A;  3PO3 I;  3S1R I;  2Y4O A;  4JV5 C;  1VQN 1;  2Y0S A;  3QWU A;  1JJ2 Y;  3HOW I;  5BR8 C;  2P2M A;  2VPW A;  1XMO C;  1ZB8 A;  2ZZM A;  4MD8 A;  2HHH C;  3UX3 A;  1I50 I;  1TWF I;  1MDB A;  3CC4 Z;  2NAP A;  2ONF A;  2YU9 I;  4BBR I;  3JAM f;  3CCU 1;  1VQ9 Z;  3I4N I;  4DV2 C;  2K3R A;  1NYE A;  2E9H A;  5LCI A;  3JAM b;  2QR1 B;  2EGT A;  1XHJ A;  4HH4 A;  1Y1V I;  4DQY B;  1YJW Z;  3LUS A;  1MDF A;  1M6X A;  4MXU A;  3JAM D;  3GKU A;  2AYA A;  4RV9 A;  3G4S Z;  4R1L A;  2AYD A;  1VQ4 1;  3OW2 Y;  3O2E A;  4B3M C;  4QTT A;  4DK1 A;  4JI6 C;  5D1O B;  1M90 1;  4DV0 C;  2WAQ A;  4MTN A;  5AE1 A;  1V60 A;  4KHP C;  3VMH A;  2E8E A;  3CQ3 A;  4RMN A;  4D4I A;  4L4Q A;  2V8J A;  2JA7 I;  3T1H C;  3L95 X;  3M3Y I;  3EQ6 A;  1IB8 A;  4ODJ A;  2F4V C;  1HH2 P;  4JM1 A;  3GKQ A;  2VUM I;  1MXA A;  1WCM I;  2QA4 1;  2PN2 A;  4NXM C;  4JI5 C;  4NB9 A;  1UKK A;  1P4E A;  5K8F A;  3VB9 A;  3S82 A;  4NBD A;  2NVX I;  5A1I A;  2WD9 A;  2ATW A;  4YHH C;  2VQE C;  3GTL I;  2QRC B;  2K5R A;  3CCR Z;  1VQ7 Z;  4LF9 C;  4E2W A;  1SFO I;  4KTT A;  4D56 A;  3A26 A;  5C4J I;  4QTU A;  3CQ1 A;  1I94 C;  2OOX B;  1BA3 A;  4DG8 A;  3J80 D;  2OTL 1;  1N34 C;  1VQ6 1;  3CC7 Z;  3R9W A;  2UU9 C;  3UEB A;  4DGL A;  4E33 A;  2MCQ A;  1S72 Z;  3S1M I;  4HGZ A;  2QVZ X;  2H85 A;  3MZL B;  4PHT A;  5K85 A;  1Q86 1;  5D1P A;  4DR1 C;  1W2B Y;  4K0K C;  2E2J I;  5GTD A;  4NBH A;  3G71 1;  1PG3 A;  4DR3 C;  3I56 1;  2V8K A;  3VNQ A;  3N2Q A;  4PUI A;  1YJ9 Z;  1HNW C;  4JI4 C;  1M90 2;  1FLO A;  4JI1 C;  4B3R C;  2M48 A;  3A9V A;  1ML8 A;  1Z03 A;  3T4N B;  2CY1 A;  2P2Q A;  3S17 I;  5CZX A;  1EGA A;  1O93 A;  3EED A;  1KKG A;  5A1G A;  3SO4 A;  2W03 A;  2VPZ A;  1J5E C;  4DUZ C;  2P28 A;  3CCE 1;  3G7S A;  3UX2 A;  1Q82 1;  3GR1 A;  1X3W A;  4DCS A;  3L8C A;  5FLM I;  1WJ2 A;  3CXC Z;  1XRA A;  4DV3 C;  2QEX 1;  2M6N A;  2OO4 A;  4EAT A;  3CQ2 A;  2BJO A;  1RY2 A;  2M5H A;  4G37 A;  2RBL A;  4Y7N I;  2RPR A;  1NP6 A;  2LFU A;  5IT9 f;  1NJI 2;  2YCB A;  3ETC A;  4RVD A;  1AA6 A;  3HOU I;  5IT9 b;  1YI2 Z;  1X0T A;  1VQO Z;  2QL8 A;  3CCV Z;  3GTM S;  4FUQ A;  5C44 I;  3U50 C;  1WII A;  1QVG Z;  5IT9 D;  4GXR A;  3CCS 1;  4LFB C;  4LE5 A;  2VPX A;  4A3C I;  4LF8 C;  1T5H X;  3PES A;  4B3S C;  1QYP A;  3I55 Z;  3CCJ 1;  3MZK B;  4RLF A;  2OTJ 1;  2OOY B;  4OX9 C;  4E32 A;  3J81 f;  1K83 I;  3E7X A;  1K0R A;  3A25 A;  4AQY C;  2E5L C;  1YJN 1;  1FDI A;  3J81 b;  1QWI A;  3G6E 1;  3F3F C;  3UOW A;  1VQ5 Z;  3GTK I;  3D9X A;  2JA6 I;  1HNZ C;  4JYA C;  3GTQ I;  3J81 D;  2JNV A;  4OXI A;  1K73 1;  3IEV A;  2B63 I;  4AYB A;  1TWA I;  4LF5 C;  2LEX A;  4NBE A;  3NDJ A;  1VQK 1;  4X6A I;  3RG2 A;  3A4I A;  1VQ9 1;  2E8C A;  1AMU A;  4Y52 I;  3FCE A;  2DYJ A;  1S7M A;  3K7A I;  1Z01 A;  3S1N I;  4A3G I;  1Q82 2;  3DAY A;  4A3M I;  4I9G A;  4JI3 C;  2HJG A;  3R44 A;  1QVF Y;  1DL6 A;  2PRO A;  2QVY X;  4NBC A;  2GTI A;  4NBA A;  2JMP A;  2Y4N A;  4X65 C;  2NVT I;  3MON A;  5KYT A;  2UUC C;  3D6W A;  4BXX I;  3E7W A;  2P2J A;  2R92 I;  2HU9 A;  3IF8 A;  5BSM A;  3TDH B;  1HNX C;  4PZP A;  1RLY A;  1KC8 1;  2E7G A;  3I07 A;  1Q81 1;  5E7Q A;  5A19 A;  1K8A 1;  3CCU Z;  3NH4 A;  4GXQ A;  2PMZ A;  4JI0 C;  4XX2 A;  4TNU A;  2R7Z I;  2JA5 I;  2UUB C;  1KD1 1;  3CCQ Z;  2YWC A;  3VMI A;  3F3P C;  3AF6 A;  4WV3 A;  4BY1 I;  3NPD A;  4LFA C;  1Z02 A;  4DCU A;  3A9U A;  3NDI A;  3PBK A;  4PRO C;  5AE3 A;  4MD7 A;  4RLQ A;  3CCM Z;  1NUI A;  1QVG Y;  2QVX X;  3AY0 A;  4DCT A;  1WH9 A;  3J80 f;  4R0M A;  2IZ3 A;  5T8S A;  2D1T A;  3LGX A;  5C3E I;  1YHQ Z;  4S1T A;  4DUY C;  1YIJ 1;  4NH1 C;  3J80 b;  3VMG A;  1PG4 A;  1WCJ A;  2MMA B;  4NB8 A;  1VQ7 1;  1I6H I;  4BC9 A;  4NBB A;  1NJI 1;  2RT9 A;  5BSV A;  4L2Z A;  5H9U A;  1K73 2;  1VQL Z;  4I9F A;  1NY8 A;  4DV7 C;  4NOZ A;  1PU1 A;  1O90 A;  4MON A;  3CC2 1;  2QA4 Z;  1MD9 A;  2DE7 A;  1P7L A;  2JIP A;  3IR7 A;  4YY3 C;  3NI2 A;  2LIY A;  2UUA C;  1YUK A;  1TWC I;  3CCL 1;  1K9M 1;  2NVQ I;  1N36 C;  2O53 A;  3B7W A;  3KXW A;  3AF5 A;  3P5J B;  2D7V A;  2J6A A;  1O9T A;  3CME Z;  3CPW Z;  2Y27 A;  1LQL A;  3S2H I;  4E2Z A;  1KQS Z;  4E2X A;  1VEH A;  1KC8 2;  2VQF C;  1VQ8 Z;  2KDN A;  2UXB C;  4LF4 C;  4R1M A;  3ETO A;  3KIH A;  3BG0 B;  1Q81 2;  3S16 I;  3GTP I;  2M5O A;  2QKD A;  1K8A 2;  3LAX A;  3OTO C;  2ZM6 C;  1MKY A;  2CXC A;  1XNQ C;  1VQM 1;  3CQZ I;  1JOS A;  4DV1 C;  1YIT 1;  2E7Z A;  1KD1 2;  5C4X I;  3GTO I;  1N33 C;  2QRE B;  3HOV I;  2D1Q A;  3H3V J;  3I56 Z;  3DLP X;  4PUH A;  1JJ2 Z;  4RM3 A;  2V8I A;  1MXB A;  1IBL C;  4GKJ C;  3RZO I;  3I4M I;  2OPL A;  1FUG A;  1V26 A;  2OZK A;  1HR0 C;  3RZD I;  2R93 I;  1VQP 1;  4A3K I;  4BCA A;  1P9N A;  2ASB A;  1RO0 A;  4L7I A;  2O4H A;  2UXD C;  1YUA A;  2G2K A;  4EWC A;  4LF6 C;  4TPS B;  4NBG A;  3DHV A;  3J7A 4;  4GKK C;  2Q4Z A;  3OW2 Z;  2I3C A;  1Y1W I;  2KZ0 A;  4RVO A;  4WS9 A;  3CCV 1;  3CCE Z;  1RNI A;  4RVH A;  3CMA Z;  3CW8 X;  5AE2 A;  4A3D I;  5IFI A;  1T5D X;  3GTJ I;  3I55 1;  1TWG I;  4IZ6 A;  1QXF A;  2RIQ A;  3GPC A;  5ADZ A;  4E30 A;  2PK7 A;  3BG1 B;  1K9M 2;  4KTV A;  3CD6 1;  1XS3 A;  3R9X A;  2YX1 A;  1IBK C;  3HOX I;  4A3E I;  4A3J I;  3GTG I;  3TR3 A;  4MD9 A;  2P20 A;  1WW9 A;  4RM2 A;  2IZ4 A;  2D1S A;  4A3B I;  1VQ5 1;  1UWD A;  3GCF A;  1I3Q I;  4RVN A;  2KZF A;  2WP0 C;  5KYV A;  2P2B A;  1PFT A;  1TH5 A;  5IP9 I;  1N32 C;  3CC4 1;  1XRB A;  2JMO A;  1WZN A;  2D1R A;  3CCJ Z;  4DR2 C;  1YJW 1;  1KRL A;  4E31 A;  3IEU A;  3G4S 1;  2HF1 A;  2JIM A;  4HPV A;  3D2L A;  3LNV A;  5A2Q f;  2KI7 B;  3IPL A;  2BH1 X;  1ZH1 A;  2OPL B;  1VQN Z;  1N2F A;  4DV5 C;  1MXC A;  5A2Q b;  3NYQ A;  5AN9 F;  4E2Y A;  2YAD A;  3CXC Y;  1W2B Z;  1RO2 A;  2GTH A;  2V45 A;  3IML A;  2RHB A;  5IP7 I;  1VQK Z;  2DPL A;  3PRO C;  5A2Q D;  2F4M A;  4DR7 C;  2P2F A;  3CW9 A;  4K0B A;  4PUG A;  3T1Y C;  2E0G A;  3CCQ 1;  4D57 A;  2E2H I;  5KEI A;  1QF8 A;  5LMU C;  3PO3 S;  4A3F I;  1VQ4 Z;  4ZJZ A;  3TUF A;  2UXC C;  3CCM 1;  2VPY A;  4A3I I;  1XNR C;  1RQF A;  1M1K 1;  5T67 A;  5BSW A;  1VQ8 1;  5BUR A;  1YHQ 1;  3CCR 1;  1IBM C;  1Y1V S;  4BSZ A;  4LF7 C;  1R9T I;  2E8F A;  3EER A;  1VQL 1;  4MH4 A;  3LNO A;  3CC7 1;  1QM4 A;  1FJG C;  3S14 I;  5CM2 M;  3PO2 I;  3N54 B;  1S72 1;  3Q87 A;  2VSQ A;  4NFR A;  5BST A;  5JRH A;  1Q7Y 1;  3KIF A;  3VNS A;  3ESW A;  2ZAE B;  3S15 I;  1LCI A;  4BBS I;  2PM9 A;  4CL1 A;  3UZ0 A;  1WF3 A;  4RS4 A;  3CJE A;  4NDN A;  1Q16 A;  3HKZ A;  1YIJ Z;  1N8R 1;  2P02 A;  1VLA A;  1PA4 A;  4ZLP A;  2V7B A;  4RVG A;  2PT7 G;  1SIW A;  3HOY I;  3CME 1;  2DHM A;  4U5Y D;  3FQM A;  1TFI A;  3NH8 A;  1YJ9 1;  2XR1 A;  3GR0 A;  1XMQ C;  2OTL Z;  4DR5 C;  1VQ6 Z;  5BUQ A;  4G36 A;  5FLX f; 
#chains in the Genus database with same CATH homology
 3H0G I;  3NYR A;  2JUB A;  3CC2 Z;  4DG9 A;  5FLX b;  2E2I I;  3M4O I;  5BSR A;  5T8T A;  4BC7 A;  1USP A;  4DR4 C;  1ULT A;  4FUT A;  2R6M A;  5FLX D;  1ZB9 A;  3CCL Z;  3FKI I;  3HOZ I;  1GPM A;  5LMN C;  2QLV B;  1X3Z A;  2WB1 A;  3G71 Z;  2VZE A;  4X64 C;  1I94 C;  4A3L I;  2OBV A;  4A93 I;  4G1I A;  4GS5 A;  2AKL A;  3GTM I;  2Q51 A;  5BSU A;  2KPI A;  1V25 A;  3C5E A;  1M1K 2;  3FQQ A;  4NBF A;  2VUG A;  4JI2 C;  1YJ7 A;  3VNR A;  5DV9 A;  4RVF A;  3VTN A;  1VQM Z;  1QVF Z;  1YI2 1;  3TDE A;  4OYC A;  1YIT Z;  4X62 C;  2JA8 I;  3RV2 A;  1VQO 1;  1JWH C;  1XRC A;  3CMA 1;  4JI7 C;  3IX0 A;  2JR6 A;  1Q7Y 2;  4DV4 C;  2W04 A;  5D1O A;  2QEX Z;  2DE6 A;  1VQP Z;  2QW0 X;  5T64 A;  3I08 A;  3H2T A;  3TE5 B;  2YWB A;  4JI8 C;  4NXN C;  1N8R 2;  5BUS A;  2DE5 A;  4D4G A;  1L1O C;  4BBY A;  4LFC C;  3FCC A;  3NFZ A;  3S2D I;  1RO4 A;  3TQI A;  2D28 C;  4BY7 I;  2P3Y A;  2NVY I;  2F4O A;  5LL6 f;  2VF1 A;  3CCS Z;  4FTF A;  3CPW Y;  1L2F A;  3NH5 A;  5T6B A;  3IFU A;  4HGY A;  1Q86 2;  1KQS Y;  2QRD B;  4X66 C;  3S1Q I;  2GU2 A;  2JS4 A;  2OTJ Z;  2D27 A;  4IR7 A;  4B3T C;  4DCV A;  3CD6 Z;  1USP B;  5IWA C;  4DV6 C;  4DR6 C;  1YJN Z;  2JNY A;  4MRI A;  1TWH I;  1RG9 A;  3G6E Z;  5CZV A;  1O92 A;  4ISB A;  3PO3 I;  3S1R I;  2Y4O A;  4JV5 C;  1VQN 1;  2Y0S A;  3QWU A;  1JJ2 Y;  3HOW I;  5BR8 C;  2P2M A;  1XMO C;  1ZB8 A;  4MD8 A;  2HHH C;  1I50 I;  1TWF I;  1MDB A;  3CC4 Z;  2ONF A;  2YU9 I;  4BBR I;  3JAM f;  3CCU 1;  1VQ9 Z;  3I4N I;  4DV2 C;  2K3R A;  1NYE A;  2E9H A;  3JAM b;  2QR1 B;  2EGT A;  4HH4 A;  1Y1V I;  4DQY B;  1YJW Z;  3LUS A;  1MDF A;  4MXU A;  3JAM D;  3GKU A;  2AYA A;  4RV9 A;  3G4S Z;  4R1L A;  1VQ4 1;  3OW2 Y;  4B3M C;  4QTT A;  4DK1 A;  4JI6 C;  5D1O B;  1M90 1;  4DV0 C;  2WAQ A;  4MTN A;  5AE1 A;  4KHP C;  3VMH A;  2E8E A;  4RMN A;  4D4I A;  4L4Q A;  2V8J A;  2JA7 I;  3T1H C;  3L95 X;  3M3Y I;  3EQ6 A;  4ODJ A;  2F4V C;  1HH2 P;  4JM1 A;  3GKQ A;  2VUM I;  1MXA A;  1WCM I;  2QA4 1;  2PN2 A;  4NXM C;  4JI5 C;  4NB9 A;  1UKK A;  5K8F A;  3VB9 A;  3S82 A;  4NBD A;  2NVX I;  5A1I A;  2WD9 A;  2ATW A;  4YHH C;  2VQE C;  3GTL I;  2QRC B;  2K5R A;  3CCR Z;  1VQ7 Z;  4LF9 C;  4E2W A;  1SFO I;  4KTT A;  4D56 A;  5C4J I;  4QTU A;  2OOX B;  1BA3 A;  4DG8 A;  3J80 D;  2OTL 1;  1N34 C;  1VQ6 1;  3CC7 Z;  3R9W A;  2UU9 C;  4DGL A;  4E33 A;  1S72 Z;  3S1M I;  4HGZ A;  2QVZ X;  2H85 A;  3MZL B;  4PHT A;  5K85 A;  1Q86 1;  5D1P A;  4DR1 C;  1W2B Y;  4K0K C;  2E2J I;  5GTD A;  4NBH A;  3G71 1;  1PG3 A;  4DR3 C;  3I56 1;  2V8K A;  3VNQ A;  3N2Q A;  1YJ9 Z;  1HNW C;  4JI4 C;  1M90 2;  4JI1 C;  4B3R C;  2M48 A;  3A9V A;  1ML8 A;  1Z03 A;  3T4N B;  2CY1 A;  2P2Q A;  3S17 I;  5CZX A;  1EGA A;  1O93 A;  3EED A;  1KKG A;  5A1G A;  3SO4 A;  2W03 A;  1J5E C;  4DUZ C;  2P28 A;  3CCE 1;  3G7S A;  1Q82 1;  3GR1 A;  1X3W A;  4DCS A;  3L8C A;  5FLM I;  3CXC Z;  1XRA A;  4DV3 C;  2QEX 1;  2M6N A;  2OO4 A;  4EAT A;  2BJO A;  1RY2 A;  4G37 A;  2RBL A;  4Y7N I;  2RPR A;  2LFU A;  1NP6 A;  5IT9 f;  1NJI 2;  2YCB A;  3ETC A;  4RVD A;  3HOU I;  5IT9 b;  1YI2 Z;  1X0T A;  1VQO Z;  2QL8 A;  3CCV Z;  3GTM S;  4FUQ A;  5C44 I;  3U50 C;  1WII A;  1QVG Z;  5IT9 D;  4GXR A;  3CCS 1;  4LFB C;  4LE5 A;  4A3C I;  4LF8 C;  1T5H X;  3PES A;  4B3S C;  1QYP A;  3I55 Z;  3CCJ 1;  3MZK B;  4RLF A;  2OTJ 1;  2OOY B;  4OX9 C;  4E32 A;  3J81 f;  1K83 I;  3E7X A;  1K0R A;  4AQY C;  2E5L C;  1YJN 1;  3J81 b;  1QWI A;  3G6E 1;  3F3F C;  3UOW A;  1VQ5 Z;  3GTK I;  3D9X A;  2JA6 I;  1HNZ C;  4JYA C;  3GTQ I;  3J81 D;  4OXI A;  1K73 1;  3IEV A;  2B63 I;  4AYB A;  1TWA I;  4LF5 C;  4NBE A;  3NDJ A;  1VQK 1;  4X6A I;  3RG2 A;  3A4I A;  1VQ9 1;  2E8C A;  1AMU A;  4Y52 I;  3FCE A;  2DYJ A;  1S7M A;  3K7A I;  1Z01 A;  3S1N I;  4A3G I;  1Q82 2;  3DAY A;  4A3M I;  4I9G A;  4JI3 C;  2HJG A;  3R44 A;  1QVF Y;  1DL6 A;  2PRO A;  2QVY X;  4NBC A;  2GTI A;  4NBA A;  2JMP A;  2Y4N A;  4X65 C;  2NVT I;  3MON A;  5KYT A;  2UUC C;  3D6W A;  4BXX I;  3E7W A;  2P2J A;  2R92 I;  2HU9 A;  3IF8 A;  5BSM A;  3TDH B;  1HNX C;  4PZP A;  1RLY A;  1KC8 1;  2E7G A;  3I07 A;  1Q81 1;  5E7Q A;  5A19 A;  1K8A 1;  3CCU Z;  3NH4 A;  4GXQ A;  2PMZ A;  4JI0 C;  4XX2 A;  4TNU A;  2R7Z I;  2JA5 I;  2UUB C;  1KD1 1;  3CCQ Z;  2YWC A;  3VMI A;  3F3P C;  3AF6 A;  4WV3 A;  4BY1 I;  3NPD A;  4LFA C;  1Z02 A;  4DCU A;  3A9U A;  3NDI A;  3PBK A;  4PRO C;  5AE3 A;  4MD7 A;  4RLQ A;  3CCM Z;  1NUI A;  1QVG Y;  2QVX X;  4DCT A;  1WH9 A;  3J80 f;  4R0M A;  2IZ3 A;  5T8S A;  2D1T A;  3LGX A;  5C3E I;  1YHQ Z;  4S1T A;  4DUY C;  1YIJ 1;  4NH1 C;  3J80 b;  3VMG A;  1PG4 A;  4LF4 C;  4NB8 A;  1VQ7 1;  1I6H I;  4BC9 A;  4NBB A;  1NJI 1;  2RT9 A;  5BSV A;  4L2Z A;  5H9U A;  1K73 2;  1VQL Z;  4I9F A;  4DV7 C;  4NOZ A;  1O90 A;  4MON A;  3CC2 1;  2QA4 Z;  1MD9 A;  2DE7 A;  1P7L A;  4YY3 C;  3NI2 A;  2LIY A;  2UUA C;  1YUK A;  1TWC I;  3CCL 1;  1K9M 1;  2NVQ I;  1N36 C;  2O53 A;  3B7W A;  3KXW A;  3AF5 A;  3P5J B;  2D7V A;  2J6A A;  1O9T A;  3CME Z;  3CPW Z;  2Y27 A;  1LQL A;  3S2H I;  4E2Z A;  1KQS Z;  4E2X A;  1KC8 2;  2VQF C;  1VQ8 Z;  2UXB C;  4R1M A;  3ETO A;  3KIH A;  3BG0 B;  1Q81 2;  3S16 I;  3GTP I;  3OTO C;  2QKD A;  1K8A 2;  3LAX A;  2ZM6 C;  1MKY A;  2CXC A;  1XNQ C;  1VQM 1;  3CQZ I;  1JOS A;  4DV1 C;  1YIT 1;  1KD1 2;  5C4X I;  3GTO I;  1N33 C;  2QRE B;  3HOV I;  2D1Q A;  3H3V J;  3I56 Z;  3DLP X;  4RM3 A;  1JJ2 Z;  2V8I A;  1MXB A;  1IBL C;  4GKJ C;  3RZO I;  3I4M I;  2OPL A;  1FUG A;  1V26 A;  2OZK A;  1HR0 C;  3RZD I;  2R93 I;  1VQP 1;  4A3K I;  4BCA A;  1P9N A;  2ASB A;  1RO0 A;  4L7I A;  2O4H A;  2UXD C;  1YUA A;  2G2K A;  4EWC A;  4LF6 C;  4TPS B;  4NBG A;  3DHV A;  3J7A 4;  4GKK C;  2Q4Z A;  3OW2 Z;  2I3C A;  1Y1W I;  4RVO A;  4WS9 A;  3CCV 1;  3CCE Z;  1RNI A;  4RVH A;  3CMA Z;  3CW8 X;  5AE2 A;  4A3D I;  5IFI A;  1T5D X;  3GTJ I;  3I55 1;  1TWG I;  4IZ6 A;  5ADZ A;  2RIQ A;  3GPC A;  3R9X A;  4E30 A;  2PK7 A;  3BG1 B;  1K9M 2;  4KTV A;  3CD6 1;  1IBK C;  3HOX I;  4A3E I;  4A3J I;  3GTG I;  4MD9 A;  2P20 A;  1WW9 A;  4RM2 A;  2IZ4 A;  2D1S A;  4A3B I;  1VQ5 1;  3GCF A;  1I3Q I;  4RVN A;  2KZF A;  2WP0 C;  5KYV A;  2P2B A;  1PFT A;  5IP9 I;  1N32 C;  3CC4 1;  1XRB A;  2JMO A;  2D1R A;  3CCJ Z;  4DR2 C;  1YJW 1;  1KRL A;  4E31 A;  3IEU A;  3G4S 1;  2HF1 A;  4HPV A;  3LNV A;  5A2Q f;  2KI7 B;  3IPL A;  2BH1 X;  1ZH1 A;  2OPL B;  1VQN Z;  1N2F A;  4DV5 C;  1MXC A;  5A2Q b;  3NYQ A;  5AN9 F;  4E2Y A;  2YAD A;  3CXC Y;  1W2B Z;  1RO2 A;  2GTH A;  3IML A;  2RHB A;  5IP7 I;  1VQK Z;  2DPL A;  3PRO C;  5A2Q D;  2F4M A;  4DR7 C;  2P2F A;  3CW9 A;  4K0B A;  3T1Y C;  2E0G A;  3CCQ 1;  4D57 A;  2E2H I;  5KEI A;  1QF8 A;  5LMU C;  3PO3 S;  4A3F I;  1VQ4 Z;  4ZJZ A;  3TUF A;  2UXC C;  3CCM 1;  4A3I I;  1XNR C;  1RQF A;  1M1K 1;  5T67 A;  5BSW A;  1VQ8 1;  5BUR A;  1YHQ 1;  3CCR 1;  1IBM C;  1Y1V S;  4BSZ A;  4LF7 C;  1R9T I;  2E8F A;  3EER A;  1VQL 1;  4MH4 A;  3CC7 1;  1QM4 A;  1FJG C;  3S14 I;  5CM2 M;  3PO2 I;  3N54 B;  1S72 1;  3Q87 A;  2VSQ A;  4NFR A;  5BST A;  5JRH A;  1Q7Y 1;  3KIF A;  3VNS A;  3ESW A;  2ZAE B;  3S15 I;  1LCI A;  4BBS I;  2PM9 A;  4CL1 A;  3UZ0 A;  1WF3 A;  4RS4 A;  3CJE A;  4NDN A;  3HKZ A;  1YIJ Z;  1N8R 1;  2P02 A;  1VLA A;  1PA4 A;  4ZLP A;  2V7B A;  4RVG A;  2PT7 G;  3HOY I;  3CME 1;  4U5Y D;  3FQM A;  1TFI A;  3NH8 A;  1YJ9 1;  2XR1 A;  3GR0 A;  1XMQ C;  2OTL Z;  4DR5 C;  1VQ6 Z;  5BUQ A;  4G36 A;  5FLX f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...