1ZB9A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
141
Chain Sequence
NSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
molecule keywords organic hydroperoxide resistance protein
total genus 34
structure length 141
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb9A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb9A02
1HR0C 1RLYA 2ASBA 2F4MA 1Y1VS 4X64C 4NB9A 3J81D 2E5LC 4LFAC 4DV0C 1ZB9A 4GKKC 2PK7A 2VUMI 2HF1A 4LF5C 4A3EI 2JA8I 3S1NI 4A3DI 5IT9D 3I4NI 1NUIA 3IEUA 1HH2P 4KHPC 4B3SC 1HNXC 2NVXI 3FKII 2R93I 3GTMI 1RO4A 1DL6A 2UUCC 2UUBC 3T1YC 4NOZA 4YHHC 4NXMC 4MH4A 4A3KI 4A93I 2VQEC 1YUAA 4LFCC 3Q87A 2OPLA 1ML8A 2YCBA 4JI7C 2VQFC 2UXDC 4QTUA 2J6AA 4A3GI 3I4MI 3GKUA 1Y1WI 4NB8A 2AKLA 4JYAC 4JI4C 2CY1A 4X65C 4DCUA 4LF7C 3GTMS 3T1HC 3GCFA 4JV5C 4LF6C 4X62C 4X6AI 4DUYC 4XX2A 4BXXI 1TWAI 3S14I 1PFTA 1ZB8A 4A3LI 1PA4A 3VMHA 2CXCA 3VB9A 4MTNA 4YY3C 3OTOC 2UUAC 5IP9I 1JOSA 1N34C 3IEVA 3VMIA 4LFBC 2F4OA 3GTJI 4NBFA 4BBRI 2YU9I 1WW9A 2DYJA 4NBCA 1WF3A 2EGTA 4JI2C 2UXBC 3J80D 3S1RI 4B3TC 4GKJC 3H3VJ 2ATWA 2D7VA 3VMGA 4JI5C 5CM2M 4NBGA 1TWHI 3ESWA 4JI3C 5FLXD 2KPIA 2XR1A 3EERA 5LMNC 1L2FA 1J5EC 2UU9C 3M3YI 1K83I 2JR6A 2KZFA 3GTKI 2HHHC 4NXNC 2UXCC 5IP7I 3RZDI 5A2QD 2NVYI 4A3FI 2BJOA 4B3RC 1USPA 3HOXI 4NBDA 1R9TI 5C4XI 2E7GA 4BY1I 3PO2I 4A3MI 2HJGA 2ONFA 1IBLC 3HOUI 1VLAA 3R9XA 2NVQI 4BSZA 4DR1C 3GTPI 3S2DI 3GKQA 2E2JI 1QYPA 5FLMI 5C44I 2R92I 2DE6A 1MKYA 4BY7I 3HOYI 1I3QI 3S17I 4DR4C 2ZM6C 4DR2C 1UKKA 4LF4C 1N33C 3GTGI 3S16I 2NVTI 5C4JI 3S1QI 4A3JI 4NBHA 3GTLI 4A3CI 1N36C 3GTOI 4B3MC 1TWCI 1IBMC 5BR8C 2JS4A 2R7ZI 2OPLB 2JA7I 3K7AI 1HNWC 3S15I 1SFOI 3LUSA 3I07A 1NYEA 4BBSI 2QL8A 4JI8C 4DCSA 2JNYA 4NBAA 3RZOI 1XNRC 3PO3I 2DE7A 4DCVA 4JI0C 4DV4C 4LF8C 3AF6A 1I50I 3S1MI 1N32C 1I94C 2JMPA 1WH9A 2E2II 3HOWI 4Y7NI 1I6HI 2PT7G 4DR6C 1KKGA 1WCMI 2K5RA 1USPB 2DE5A 4NBEA 1K0RA 1XMOC 3CJEA 4DR7C 5C3EI 2JA6I 3AF5A 1X3WA 2E2HI 2RBLA 2JA5I 1Y1VI 4DV1C 4Y52I 1HNZC 1LQLA 1TWGI 3PO3S 1TFIA 1TWFI 2F4VC 4DR5C 3M4OI 2PN2A 4JI6C 4A3II 3D6WA 4K0KC 1QWIA 4DUZC 1FJGC 4DV3C 2B63I 4A3BI 3CQZI 2E8FA 2E8EA 3HOVI 3R9WA 4QTTA 3GTQI 4NBBA 2P3YA 3JAMD 4DV2C 4DV5C 4LF9C 1L1OC 4OX9C 1XNQC 3H0GI 4DR3C 4JI1C 1XMQC 1EGAA 1IBKC 2E8CA 5IWAC 4DCTA 5LMUC 4DV6C 3S2HI 4DV7C 3U50C 4X66C 3HOZI 1N2FA 4AQYC 1X3ZA
chains in the Genus database with same CATH superfamily
3SO4A 2F4MA 5AE1A 3G6E1 4GKKC 2PK7A 3CXCY 2VUMI 5BSVA 1Z02A 5IT9D 1M901 4TNUA 1HNXC 3CC4Z 3KXWA 5D1OA 2YWCA 2UUCC 4RM3A 1NJI1 1FDOA 4NXMC 3UX2A 3G6EZ 1YUAA 1O92A 4PUGA 2QA41 3TQIA 1IB8A 2YCBA 3S82A 4JI7C 1UWDA 4QTUA 1Z03A 2J6AA 3I4MI 4NB8A 2AKLA 1K8A1 4LF7C 4BBYA 3T1HC 3GCFA 2K3RA 4X6AI 4DUYC 4BXXI 1VQ81 1PFTA 1ZB8A 3P5JB 1KD12 3VMHA 1PA4A 2D27A 1M6XC 3CCQ1 1YIJ1 2PMZA 4R1MA 3GTJI 4EWCA 1YIJZ 2OTL1 1WF3A 3A9VA 2P20A 3CCV1 4B3TC 3G71Z 1VQ7Z 2ATWA 1QVFY 3ESWA 2XR1A 5LMNC 1L2FA 1J5EC 5T8TA 3FQQA 2KZFA 2P02A 4DG9A 5BUQA 4DQYB 1RO0A 1YJWZ 4A3FI 4NBDA 5C4XI 3H2TA 4E2XA 3PO2I 2LIYA 2HJGA 1IBLC 1VLAA 2ZAEB 4BSZA 3S2DI 2BH1X 4PROC 3UZ0A 5FLMI 5C44I 1XRAA 2MM9A 3CC71 1VQ4Z 2DE6A 3OW2Y 2OOXB 1I3QI 1JJ2Y 3S17I 4DR4C 4MXUA 2ZM6C 4DR2C 3CQ3A 3MZKB 5ADZA 3CME1 5C4JI 2RIQA 1VQ8Z 4RM2A 1N36C 4B3MC 4PZPA 5D1OB 1RQFA 3R44A 2QVZX 4RV9A 3CW9A 3GR0A 1Q862 1SFOI 1AMUA 1JJ2Z 3CD61 1NYEA 4I9FA 3CMA1 3E7WA 4DCSA 2ZZNA 2YX1A 1M1K2 4LF8C 1N8R1 4PUIA 2E2II 2WD9A 1KD11 1WCMI 5BSTA 5BUSA 1XMOC 4RVGA 2QVXX 1MXCA 4D57A 3G7SA 4RVDA 3TDEA 1KQSY 4NFRA 2GTIA 2UUAC 4Y52I 3LAXA 2KDNA 1TWGI 1Q7Y1 2OTJ1 4FUTA 5IFIA 4JI6C 4A3II 4KTVA 2PROA 3D6WA 4HH4A 1VQMZ 4DUZC 2O53A 2M48A 1X0TA 2DHMA 3IPLA 4DV5C 5A1GA 1XNQC 2V8JA 3H0GI 3J81f 3D9XA 1MDBA 5CZVA 2QRCB 2E8CA 2P2FA 4DV6C 4DV7C 3S2HI 3U50C 3AY0A 5T8SA 3F3FC 4DCTA 4RVOA 1N33C 5T6BA 2RPRA 1O90A 2KI7B 1HR0C 2ASBA 2QKDA 1Y1VS 4ISBA 2JIPA 4NB9A 1YIT1 1WCJA 2HF1A 4LF5C 3JAMb 2JA8I 3CCVZ 5K8FA 1T5DX 4KHPC 1YJ9Z 4E31A 3VNSA 3LGXA 5A2Qb 2Q51A 2YWBA 2R93I 3GTMI 1WZNA 5KYTA 1K9M2 3T1YC 1VQM1 1P4EA 4A3KI 4LFCC 2OPLA 1ML8A 5IT9f 3CCR1 3F3PC 3IR7A 3CCQZ 4RVNA 3J80b 1Y1WI 2MMAB 2QVYX 3QWUA 4HGYA 2CY1A 4FTFA 4DCUA 1YHQ1 3GTMS 4LF6C 3RV2A 4XX2A 4A3LI 1XRCA 1WJ2A 1M902 1GPMA 1IBKC 4LFBC 2D1RA 5IP9I 2IV2X 3VMIA 2F4OA 4NBFA 4BBRI 3GPCA 2DYJA 3GR1A 3CMAZ 4JI2C 2QLVB 1Y8CA 1AA6A 4I9GA 1YJN1 3I55Z 1VQKZ 5AN9F 1W2BY 1PG4A 4JI5C 5CM2M 5T67A 1TWHI 1XHJA 2KZ0A 3CCM1 1N8R2 2KPIA 1P7LA 4JI3C 2GTHA 3EERA 1M1K1 4OXIA 2UU9C 2JR6A 2HHHC 4NXNC 1YI21 3NYRA 5A2QD 4R0MA 1VQLZ 4AYBA 1USPA 2YADA 1R9TI 3CCLZ 3R9XA 2ONFA 2ZZMA 2PM9A 3HOUI 4HPVA 3CCL1 1S72Z 3GKQA 5FLXb 2E2JI 4CL1A 3ETCA 2VZEA 1YI2Z 2QEXZ 5BURA 1JWHC 3GTGI 1V25A 4G36A 1FDIA 4DG8A 2UXDC 4NH1C 4A3CI 3FCCA 3GTOI 4KTTA 2JS4A 2R7ZI 3CCU1 3G711 1VQ71 1HNWC 3S15I 4BBSI 4IZ6A 1VQ5Z 4DGLA 1PG3A 4NBAA 1Q861 2D1TA 2Z51A 4HGZA 3EEDA 3CPWZ 3IMLA 2WAQA 3C5EA 1K731 4D4IA 1ZH1A 2VPWA 3NH4A 1I50I 3AF6A 4DV4C 1N32C 2LEXA 1NP6A 2K5RA 4NBEA 1K0RA 3E7XA 3NDJA 3CPWY 1RNIA 3CCJ1 4DV1C 2AYDA 1Y1VI 3CCRZ 3CC7Z 2JIQA 3PO3S 1TFIA 1TWFI 2G2KA 3IFUA 1QVFZ 4G37A 4DR5C 3BG0B 3M4OI 2Y4NA 3CCS1 1QF8A 1QXFA 2IZ4A 1M6XA 1QWIA 3ETOA 1RG9A 3CCMZ 1Q822 4A3BI 3CQZI 2WB1A 4QTTA 3GTQI 3CQ2A 2GU2A 3JAMD 1L1OC 3D2LA 4RVFA 4DR3C 5AE3A 1YITZ 4MD9A 2OBVA 1QM4A 4MONA 4RS4A 4A3MI 1K9M1 2OOYB 2P2QA 4AQYC 3I551 2E7ZA 1VQK1 5LL6f 2JIMA 4GXQA 1RLYA 3J81D 2E5LC 1ULTA 3LNOA 4DV0C 2O4HA 4LFAC 1PU1A 2Q4ZA 4A3DI 3S1NI 3NDIA 3I4NI 1NUIA 1XRBA 4B3SC 1VQPZ 1T5HX 3FKII 5A1IA 4PUHA 2M6NA 4PHTA 3CCE1 3UX3A 2VPYA 3TDHB 4MH4A 3B7WA 4A93I 2VQEC 3IF8A 3Q87A 3CCJZ 4DK1A 1Z01A 2MCQA 3VTNA 2RHBA 3NI2A 1FUGA 4GXRA 3I08A 4TPSB 1VQNZ 3DHVA 3GKUA 4EATA 1TH5A 4JI4C 4X65C 3DAYA 3KIFA 5H9UA 1KQSZ 1TWAI 4MD7A 2CXCA 5DV9A 3KIHA 3VB9A 1MD9A 2M5HA 3FCEA 4G1IA 1V60A 1JOSA 2P2MA 5BSMA 1N34C 1WIIA 3IEVA 2Y4OA 3LNVA 2YU9I 1WW9A 4NBCA 2EGTA 2W04A 3J80D 3CCSZ 3S1RI 1KC82 4RMNA 4GKJC 3H3VJ 1VQ61 3CQ1A 1VQOZ 5FLXD 3N54B 5BSUA 4YY3C 3BG1B 4D56A 4FUQA 4ODJA 1K83I 3G4SZ 1YJW1 2V45A 3RZDI 1YUKA 2NVYI 4WS9A 2BJOA 3NH5A 5A19A 4B3RC 3TR3A 3MONA 4BY1I 1Q7Y2 3GTPI 1QYPA 3CCUZ 2JNVA 5A2Qf 2R92I 2OZKA 3DLPX 3CC41 4LF4C 1UKKA 3CXCZ 3S16I 3S1QI 4A3JI 4NBHA 3GTLI 4BC7A 4NDNA 3A4IA 5BR8C 2OPLB 3L95X 5CZXA 1S7MA 2E0GA 1VQ91 2QL8A 4JI8C 2AYAA 3RZOI 3PROC 4L2ZA 4LE5A 4DCVA 2H85A 4JI0C 3S1MI 3A25A 1P4EC 2JMPA 1WH9A 1I6HI 4JM1A 4DR6C 1Q811 4GS5A 5BSRA 4ZJZA 3NYQA 1USPB 2DE5A 4DR7C 3CJEA 1VQ9Z 2JA6I 2QRDB 2E2HI 2RBLA 4L7IA 1VQ41 1HNZC 1W2BZ 4BCAA 2F4VC 1QVGZ 4K0BA 2HU9A 4E32A 5AE2A 2OTJZ 2JIOA 4K0KC 2B63I 2E8EA 3HOVI 4U5YD 3J81b 4S1TA 4RLFA 1VQN1 3R9WA 4NBBA 1MXAA 2P3YA 4DV2C 4OX9C 4MRIA 2VSQA 2VUGA 1YJ7A 1EGAA 5BSWA 5IWAC 4R1LA 2QW0X 4OYCA 4X66C 3A26A 3HOZI 1N2FA 1X3ZA 3HOYI 2OO4A 3JAMf 4X64C 1Q16A 3I561 3TE5B 1K8A2 1MXBA 4IR7A 5JRHA 1ZB9A 4JYAC 4E2WA 4A3EI 3J7A4 3IEUA 1HH2P 3CMEZ 1VQ6Z 2NVXI 1YJ91 1RO4A 1DL6A 4L4QA 2UUBC 1NJI2 4NOZA 4YHHC 2P28A 2V3VA 2JMOA 1MDFA 2QREB 4E30A 2V8KA 3CC2Z 2D1SA 5E7QA 2VQFC 4A3GI 1P9NA 1VQ51 2D1QA 5IT9b 2NAPA 4JV5C 4X62C 1S721 3PBKA 4E2YA 3S14I 4MTNA 3MZLB 1SIWA 2Y0SA 3OTOC 1VQO1 1RY2A 5LCIA 3IX0A 4E33A 2UXBC 1KRLA 3L8CA 3G4S1 1NY8A 2W03A 1Q821 1VQP1 3I56Z 3VMGA 2D7VA 4NBGA 3K6RA 3CCEZ 4D4GA 1K732 3CW8X 2R6MA 3RG2A 3M3YI 4MD8A 3J80f 2UXCC 3GTKI 2QR1B 5IP7I 3NPDA 4BC9A 3T4NB 5FLXf 3HOXI 1V26A 2DPLA 1Q812 2E7GA 3TUFA 3HKZA 2NVQI 3CC21 4DR1C 3PESA 1QVGY 2V7BA 4RVHA 2P2BA 5T64A 1MKYA 4BY7I 3VNRA 4WV3A 2OTLZ 2CU6A 2I3CA 2NVTI 1TWCI 1IBMC 2E9HA 2JA7I 3K7AI 3LUSA 3I07A 5KEIA 5K85A 3FQMA 2Y27A 2JNYA 3PO3I 2DE7A 1RO2A 3OW2Z 1VQL1 1I94C 1O9TA 3HOWI 4Y7NI 2PT7G 1KKGA 2VPZA 2JUBA 1LCIA 2V8IA 3UEBA 2LFUA 5D1PA 3NFZA 2RT9A 5C3EI 2P2JA 4RLQA 5GTDA 3AF5A 1X3WA 3UOWA 2NCLA 2QA4Z 2VPXA 2JA5I 3NH8A 1LQLA 3VNQA 1YJNZ 2QEX1 2PN2A 1FLOA 2JIRA 1FJGC 4DV3C 3N2QA 2E8FA 1BA3A 1O93A 4ZLPA 1XNRC 1KC81 2VF1A 2IZ3A 1XS3A 4LF9C 3EQ6A 3CD6Z 4JI1C 3O2EA 3A9UA 1YHQZ 1XMQC 2D28C 2WP0C 4E2ZA 5LMUC 1VEHA 2M5OA 5KYVA
chains in the Genus database with same CATH topology
3SO4A 2F4MA 5AE1A 3G6E1 4GKKC 2PK7A 3CXCY 2VUMI 5BSVA 1Z02A 5IT9D 1M901 4TNUA 1HNXC 3CC4Z 3KXWA 5D1OA 2YWCA 2UUCC 4RM3A 1NJI1 4NXMC 3G6EZ 1YUAA 1O92A 2QA41 3TQIA 2YCBA 3S82A 4JI7C 4QTUA 1Z03A 2J6AA 3I4MI 4NB8A 2AKLA 1K8A1 4LF7C 4BBYA 3T1HC 3GCFA 2K3RA 4X6AI 4DUYC 4BXXI 1VQ81 1PFTA 1ZB8A 3P5JB 1KD12 3VMHA 1PA4A 2D27A 3CCQ1 1YIJ1 2PMZA 4R1MA 3GTJI 4EWCA 1YIJZ 2OTL1 1WF3A 3A9VA 2P20A 3CCV1 4B3TC 3G71Z 1VQ7Z 2ATWA 1QVFY 3ESWA 2XR1A 5LMNC 1L2FA 1J5EC 5T8TA 3FQQA 2KZFA 2P02A 4DG9A 5BUQA 4DQYB 1RO0A 1YJWZ 4A3FI 4NBDA 5C4XI 3H2TA 4E2XA 3PO2I 2LIYA 2HJGA 1IBLC 1VLAA 2ZAEB 4BSZA 3S2DI 2BH1X 4PROC 3UZ0A 5FLMI 5C44I 1XRAA 3CC71 1VQ4Z 2DE6A 3OW2Y 2OOXB 1I3QI 1JJ2Y 3S17I 4DR4C 4MXUA 2ZM6C 4DR2C 3MZKB 5ADZA 3CME1 5C4JI 2RIQA 1VQ8Z 4RM2A 1N36C 4B3MC 4PZPA 5D1OB 1RQFA 3R44A 2QVZX 4RV9A 3CW9A 3GR0A 1Q862 1SFOI 1AMUA 1JJ2Z 3CD61 1NYEA 4I9FA 3CMA1 3E7WA 4DCSA 1M1K2 4LF8C 1N8R1 2E2II 2WD9A 1KD11 1WCMI 5BSTA 5BUSA 1XMOC 4RVGA 2QVXX 1MXCA 4D57A 3G7SA 4RVDA 3TDEA 1KQSY 4NFRA 2GTIA 4Y52I 3LAXA 4FUTA 1TWGI 1Q7Y1 2OTJ1 5IFIA 4JI6C 4A3II 4KTVA 2PROA 3D6WA 4HH4A 1VQMZ 4DUZC 2O53A 2M48A 1X0TA 3IPLA 4DV5C 5A1GA 1XNQC 2V8JA 3H0GI 3J81f 3D9XA 1MDBA 5CZVA 2QRCB 2E8CA 2P2FA 4DV6C 4DV7C 3S2HI 3U50C 5T8SA 3F3FC 4DCTA 4RVOA 1N33C 5T6BA 2RPRA 1O90A 2KI7B 1HR0C 2ASBA 2QKDA 1Y1VS 4ISBA 4NB9A 1YIT1 2HF1A 4LF5C 3JAMb 2JA8I 3CCVZ 5K8FA 1T5DX 4KHPC 1YJ9Z 4E31A 3VNSA 3LGXA 5A2Qb 2Q51A 2YWBA 2R93I 3GTMI 5KYTA 1K9M2 3T1YC 1VQM1 4A3KI 4LFCC 2OPLA 1ML8A 5IT9f 3CCR1 3F3PC 3CCQZ 4RVNA 3J80b 1Y1WI 2QVYX 3QWUA 4HGYA 2CY1A 4FTFA 4DCUA 1YHQ1 3GTMS 4LF6C 3RV2A 4XX2A 4A3LI 1XRCA 1M902 1GPMA 1IBKC 4LFBC 2D1RA 5IP9I 3VMIA 2F4OA 4NBFA 4BBRI 3GPCA 2DYJA 3GR1A 3CMAZ 4JI2C 2QLVB 4I9GA 1YJN1 3I55Z 1VQKZ 5AN9F 1W2BY 1PG4A 4JI5C 5CM2M 5T67A 1TWHI 4JI3C 3CCM1 1N8R2 2KPIA 1P7LA 2GTHA 3EERA 1M1K1 4OXIA 2UU9C 2JR6A 2HHHC 4NXNC 1YI21 3NYRA 5A2QD 4R0MA 1VQLZ 4AYBA 1USPA 2YADA 1R9TI 3CCLZ 3R9XA 2ONFA 2PM9A 3HOUI 4HPVA 3CCL1 1S72Z 3GKQA 5FLXb 2E2JI 4CL1A 3ETCA 2VZEA 1YI2Z 2QEXZ 5BURA 1JWHC 3GTGI 1V25A 4G36A 4DG8A 2UXDC 4NH1C 4A3CI 3FCCA 3GTOI 4KTTA 2JS4A 2R7ZI 3CCU1 3G711 1VQ71 1HNWC 3S15I 4BBSI 4IZ6A 1VQ5Z 4DGLA 1PG3A 4NBAA 1Q861 2D1TA 3IMLA 4HGZA 3EEDA 3CPWZ 4D4IA 2WAQA 3C5EA 1K731 4DV4C 1ZH1A 3NH4A 3AF6A 1I50I 1N32C 1NP6A 2K5RA 4NBEA 1K0RA 3E7XA 3NDJA 3CPWY 1RNIA 3CCJ1 4DV1C 1Y1VI 3CCRZ 3CC7Z 3PO3S 1TFIA 1TWFI 2G2KA 3IFUA 1QVFZ 4G37A 4DR5C 3BG0B 3M4OI 2Y4NA 3CCS1 1QF8A 2IZ4A 1QWIA 3ETOA 1RG9A 3CCMZ 1Q822 4A3BI 3CQZI 2WB1A 4QTTA 3GTQI 2GU2A 3JAMD 1L1OC 4RVFA 4DR3C 5AE3A 1YITZ 4MD9A 2OBVA 1QM4A 4MONA 4RS4A 4A3MI 1K9M1 2OOYB 2P2QA 4AQYC 3I551 1VQK1 5LL6f 4GXQA 1RLYA 3J81D 2E5LC 1ULTA 4DV0C 4LFAC 2O4HA 2Q4ZA 4A3DI 3S1NI 3NDIA 3I4NI 1NUIA 1XRBA 4B3SC 1VQPZ 1T5HX 3FKII 5A1IA 2M6NA 4PHTA 3CCE1 3TDHB 4MH4A 3B7WA 4A93I 2VQEC 3IF8A 3Q87A 3CCJZ 4DK1A 1Z01A 3VTNA 2RHBA 3NI2A 1FUGA 4GXRA 3I08A 4TPSB 1VQNZ 3DHVA 3GKUA 4EATA 4JI4C 4X65C 3DAYA 3KIFA 5H9UA 1KQSZ 1TWAI 4MD7A 2CXCA 5DV9A 3KIHA 3VB9A 1MD9A 3FCEA 4G1IA 4YY3C 2UUAC 1JOSA 2P2MA 5BSMA 1N34C 1WIIA 3IEVA 2Y4OA 3LNVA 2YU9I 1WW9A 4NBCA 2EGTA 2W04A 3J80D 3CCSZ 3S1RI 1KC82 4RMNA 4GKJC 3H3VJ 1VQ61 1VQOZ 5FLXD 3N54B 5BSUA 3BG1B 4D56A 4FUQA 4ODJA 1K83I 3G4SZ 1YJW1 3RZDI 1YUKA 2NVYI 4WS9A 2BJOA 3NH5A 5A19A 4B3RC 3MONA 4BY1I 1Q7Y2 3GTPI 1QYPA 3CCUZ 5A2Qf 2R92I 2OZKA 3DLPX 3CC41 4LF4C 1UKKA 3CXCZ 3S16I 3S1QI 4A3JI 4NBHA 3GTLI 4BC7A 4NDNA 3A4IA 5BR8C 2OPLB 3L95X 5CZXA 1S7MA 2E0GA 1VQ91 2QL8A 4JI8C 2AYAA 3RZOI 3PROC 4L2ZA 4LE5A 4DCVA 2H85A 4JI0C 3S1MI 2JMPA 1WH9A 1I6HI 4JM1A 4DR6C 1Q811 4GS5A 5BSRA 4ZJZA 3NYQA 1USPB 2DE5A 4DR7C 3CJEA 1VQ9Z 2JA6I 2QRDB 2E2HI 2RBLA 4L7IA 1VQ41 1HNZC 1W2BZ 4BCAA 2F4VC 1QVGZ 4K0BA 2HU9A 4E32A 5AE2A 2OTJZ 4K0KC 2B63I 2E8EA 3HOVI 4U5YD 3J81b 4S1TA 4RLFA 1VQN1 3R9WA 4NBBA 1MXAA 2P3YA 4DV2C 4OX9C 4MRIA 2VSQA 2VUGA 1YJ7A 1EGAA 5BSWA 5IWAC 4R1LA 2QW0X 4OYCA 4X66C 3HOZI 1N2FA 1X3ZA 3HOYI 2OO4A 3JAMf 4X64C 1MXBA 3I561 3TE5B 1K8A2 4IR7A 5JRHA 4JYAC 1ZB9A 4E2WA 4A3EI 3J7A4 3IEUA 1HH2P 3CMEZ 1VQ6Z 2NVXI 1YJ91 1RO4A 1DL6A 4L4QA 2UUBC 1NJI2 4NOZA 4YHHC 2P28A 2JMOA 1MDFA 2QREB 4E30A 2V8KA 3CC2Z 2D1SA 5E7QA 2VQFC 4A3GI 1P9NA 1VQ51 2D1QA 5IT9b 4JV5C 4X62C 1S721 3PBKA 4E2YA 3S14I 4MTNA 3MZLB 2Y0SA 3OTOC 1VQO1 1RY2A 3IX0A 4E33A 2UXBC 1KRLA 3L8CA 3G4S1 2W03A 1Q821 1VQP1 3I56Z 3VMGA 2D7VA 4NBGA 3CCEZ 4D4GA 1K732 3CW8X 2R6MA 3RG2A 3M3YI 4MD8A 3J80f 2UXCC 3GTKI 2QR1B 5IP7I 3NPDA 4BC9A 3T4NB 5FLXf 3HOXI 1V26A 2DPLA 1Q812 2E7GA 3TUFA 3HKZA 2NVQI 3CC21 4DR1C 3PESA 1QVGY 2V7BA 4RVHA 2P2BA 5T64A 1MKYA 4BY7I 3VNRA 4WV3A 2OTLZ 2I3CA 2NVTI 1TWCI 1IBMC 2E9HA 2JA7I 3K7AI 3LUSA 3I07A 5KEIA 5K85A 3FQMA 2Y27A 2JNYA 3PO3I 2DE7A 1RO2A 3OW2Z 1VQL1 1I94C 1O9TA 3HOWI 4Y7NI 2PT7G 1KKGA 2JUBA 1LCIA 2V8IA 5GTDA 2LFUA 5D1PA 3NFZA 2RT9A 5C3EI 2P2JA 4RLQA 3AF5A 1X3WA 3UOWA 2QA4Z 2JA5I 3NH8A 1LQLA 3VNQA 1YJNZ 2QEX1 2PN2A 1FJGC 4DV3C 3N2QA 2E8FA 1BA3A 1O93A 4ZLPA 1XNRC 1KC81 2VF1A 2IZ3A 4LF9C 3EQ6A 3CD6Z 4JI1C 3A9UA 1YHQZ 1XMQC 2D28C 2WP0C 4E2ZA 5LMUC 5KYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 C;  1RLY A;  2ASB A;  2F4M A;  1Y1V S;  4X64 C;  4NB9 A;  3J81 D;  2E5L C;  4LFA C;  4DV0 C;  1ZB9 A;  4GKK C;  2PK7 A;  2VUM I;  2HF1 A;  4LF5 C;  4A3E I;  2JA8 I;  3S1N I;  4A3D I;  5IT9 D;  3I4N I;  1NUI A;  3IEU A;  1HH2 P;  4KHP C;  4B3S C;  1HNX C;  2NVX I;  3FKI I;  2R93 I;  3GTM I;  1RO4 A;  1DL6 A;  2UUC C;  2UUB C;  3T1Y C;  4NOZ A;  4YHH C;  4NXM C;  4MH4 A;  4A3K I;  4A93 I;  2VQE C;  1YUA A;  4LFC C;  3Q87 A;  2OPL A;  1ML8 A;  2YCB A;  4JI7 C;  2VQF C;  2UXD C;  4QTU A;  2J6A A;  4A3G I;  3I4M I;  3GKU A;  1Y1W I;  4NB8 A;  2AKL A;  4JYA C;  4JI4 C;  2CY1 A;  4X65 C;  4DCU A;  4LF7 C;  3GTM S;  3T1H C;  3GCF A;  4JV5 C;  4LF6 C;  4X62 C;  4X6A I;  4DUY C;  4XX2 A;  4BXX I;  1TWA I;  3S14 I;  1PFT A;  1ZB8 A;  4A3L I;  1PA4 A;  3VMH A;  2CXC A;  3VB9 A;  4MTN A;  4YY3 C;  3OTO C;  2UUA C;  5IP9 I;  1JOS A;  1N34 C;  3IEV A;  3VMI A;  4LFB C;  2F4O A;  3GTJ I;  4NBF A;  4BBR I;  2YU9 I;  1WW9 A;  2DYJ A;  4NBC A;  1WF3 A;  2EGT A;  4JI2 C;  2UXB C;  3J80 D;  3S1R I;  4B3T C;  4GKJ C;  3H3V J;  2ATW A;  2D7V A;  3VMG A;  4JI5 C;  5CM2 M;  4NBG A;  1TWH I;  3ESW A;  4JI3 C;  5FLX D;  2KPI A;  2XR1 A;  3EER A;  5LMN C;  1L2F A;  1J5E C;  2UU9 C;  3M3Y I;  1K83 I;  2JR6 A;  2KZF A;  3GTK I;  2HHH C;  4NXN C;  2UXC C;  5IP7 I;  3RZD I;  5A2Q D;  2NVY I;  4A3F I;  2BJO A;  4B3R C;  1USP A;  3HOX I;  4NBD A;  1R9T I;  5C4X I;  2E7G A;  4BY1 I;  3PO2 I;  4A3M I;  2HJG A;  2ONF A;  1IBL C;  3HOU I;  1VLA A;  3R9X A;  2NVQ I;  4BSZ A;  4DR1 C;  3GTP I;  3S2D I;  3GKQ A;  2E2J I;  1QYP A;  5FLM I;  5C44 I;  2R92 I;  2DE6 A;  1MKY A;  4BY7 I;  3HOY I;  1I3Q I;  3S17 I;  4DR4 C;  2ZM6 C;  4DR2 C;  1UKK A;  4LF4 C;  1N33 C;  3GTG I;  3S16 I;  2NVT I;  5C4J I;  3S1Q I;  4A3J I;  4NBH A;  3GTL I;  4A3C I;  1N36 C;  3GTO I;  4B3M C;  1TWC I;  1IBM C;  5BR8 C;  2JS4 A;  2R7Z I;  2OPL B;  2JA7 I;  3K7A I;  1HNW C;  3S15 I;  1SFO I;  3LUS A;  3I07 A;  1NYE A;  4BBS I;  2QL8 A;  4JI8 C;  4DCS A;  2JNY A;  4NBA A;  3RZO I;  1XNR C;  3PO3 I;  2DE7 A;  4DCV A;  4JI0 C;  4DV4 C;  4LF8 C;  3AF6 A;  1I50 I;  3S1M I;  1N32 C;  1I94 C;  2JMP A;  1WH9 A;  2E2I I;  3HOW I;  4Y7N I;  1I6H I;  2PT7 G;  4DR6 C;  1KKG A;  1WCM I;  2K5R A;  1USP B;  2DE5 A;  4NBE A;  1K0R A;  1XMO C;  3CJE A;  4DR7 C;  5C3E I;  2JA6 I;  3AF5 A;  1X3W A;  2E2H I;  2RBL A;  2JA5 I;  1Y1V I;  4DV1 C;  4Y52 I;  1HNZ C;  1LQL A;  1TWG I;  3PO3 S;  1TFI A;  1TWF I;  2F4V C;  4DR5 C;  3M4O I;  2PN2 A;  4JI6 C;  4A3I I;  3D6W A;  4K0K C;  1QWI A;  4DUZ C;  1FJG C;  4DV3 C;  2B63 I;  4A3B I;  3CQZ I;  2E8F A;  2E8E A;  3HOV I;  3R9W A;  4QTT A;  3GTQ I;  4NBB A;  2P3Y A;  3JAM D;  4DV2 C;  4DV5 C;  4LF9 C;  1L1O C;  4OX9 C;  1XNQ C;  3H0G I;  4DR3 C;  4JI1 C;  1XMQ C;  1EGA A;  1IBK C;  2E8C A;  5IWA C;  4DCT A;  5LMU C;  4DV6 C;  3S2H I;  4DV7 C;  3U50 C;  4X66 C;  3HOZ I;  1N2F A;  4AQY C;  1X3Z A; 
#chains in the Genus database with same CATH topology
 3SO4 A;  2F4M A;  5AE1 A;  3G6E 1;  4GKK C;  2PK7 A;  3CXC Y;  2VUM I;  5BSV A;  1Z02 A;  5IT9 D;  1M90 1;  4TNU A;  1HNX C;  3CC4 Z;  3KXW A;  5D1O A;  2YWC A;  2UUC C;  4RM3 A;  1NJI 1;  1FDO A;  4NXM C;  3UX2 A;  3G6E Z;  1YUA A;  1O92 A;  4PUG A;  2QA4 1;  3TQI A;  1IB8 A;  2YCB A;  3S82 A;  4JI7 C;  1UWD A;  4QTU A;  1Z03 A;  2J6A A;  3I4M I;  4NB8 A;  2AKL A;  1K8A 1;  4LF7 C;  4BBY A;  3T1H C;  3GCF A;  2K3R A;  4X6A I;  4DUY C;  4BXX I;  1VQ8 1;  1PFT A;  1ZB8 A;  3P5J B;  1KD1 2;  3VMH A;  1PA4 A;  2D27 A;  1M6X C;  3CCQ 1;  1YIJ 1;  2PMZ A;  4R1M A;  3GTJ I;  4EWC A;  1YIJ Z;  2OTL 1;  1WF3 A;  3A9V A;  2P20 A;  3CCV 1;  4B3T C;  3G71 Z;  1VQ7 Z;  2ATW A;  1QVF Y;  3ESW A;  2XR1 A;  5LMN C;  1L2F A;  1J5E C;  5T8T A;  3FQQ A;  2KZF A;  2P02 A;  4DG9 A;  5BUQ A;  4DQY B;  1RO0 A;  1YJW Z;  4A3F I;  4NBD A;  5C4X I;  3H2T A;  4E2X A;  3PO2 I;  2LIY A;  2HJG A;  1IBL C;  1VLA A;  2ZAE B;  4BSZ A;  3S2D I;  2BH1 X;  4PRO C;  3UZ0 A;  5FLM I;  5C44 I;  1XRA A;  2MM9 A;  3CC7 1;  1VQ4 Z;  2DE6 A;  3OW2 Y;  2OOX B;  1I3Q I;  1JJ2 Y;  3S17 I;  4DR4 C;  4MXU A;  2ZM6 C;  4DR2 C;  3CQ3 A;  3MZK B;  5ADZ A;  3CME 1;  5C4J I;  2RIQ A;  1VQ8 Z;  4RM2 A;  1N36 C;  4B3M C;  4PZP A;  5D1O B;  1RQF A;  3R44 A;  2QVZ X;  4RV9 A;  3CW9 A;  3GR0 A;  1Q86 2;  1SFO I;  1AMU A;  1JJ2 Z;  3CD6 1;  1NYE A;  4I9F A;  3CMA 1;  3E7W A;  4DCS A;  2ZZN A;  2YX1 A;  1M1K 2;  4LF8 C;  1N8R 1;  4PUI A;  2E2I I;  2WD9 A;  1KD1 1;  1WCM I;  5BST A;  5BUS A;  1XMO C;  4RVG A;  2QVX X;  1MXC A;  4D57 A;  3G7S A;  4RVD A;  3TDE A;  1KQS Y;  4NFR A;  2GTI A;  2UUA C;  4Y52 I;  3LAX A;  2KDN A;  1TWG I;  1Q7Y 1;  2OTJ 1;  4FUT A;  5IFI A;  4JI6 C;  4A3I I;  4KTV A;  2PRO A;  3D6W A;  4HH4 A;  1VQM Z;  4DUZ C;  2O53 A;  2M48 A;  1X0T A;  2DHM A;  3IPL A;  4DV5 C;  5A1G A;  1XNQ C;  2V8J A;  3H0G I;  3J81 f;  3D9X A;  1MDB A;  5CZV A;  2QRC B;  2E8C A;  2P2F A;  4DV6 C;  4DV7 C;  3S2H I;  3U50 C;  3AY0 A;  5T8S A;  3F3F C;  4DCT A;  4RVO A;  1N33 C;  5T6B A;  2RPR A;  1O90 A;  2KI7 B;  1HR0 C;  2ASB A;  2QKD A;  1Y1V S;  4ISB A;  2JIP A;  4NB9 A;  1YIT 1;  1WCJ A;  2HF1 A;  4LF5 C;  3JAM b;  2JA8 I;  3CCV Z;  5K8F A;  1T5D X;  4KHP C;  1YJ9 Z;  4E31 A;  3VNS A;  3LGX A;  5A2Q b;  2Q51 A;  2YWB A;  2R93 I;  3GTM I;  1WZN A;  5KYT A;  1K9M 2;  3T1Y C;  1VQM 1;  1P4E A;  4A3K I;  4LFC C;  2OPL A;  1ML8 A;  5IT9 f;  3CCR 1;  3F3P C;  3IR7 A;  3CCQ Z;  4RVN A;  3J80 b;  1Y1W I;  2MMA B;  2QVY X;  3QWU A;  4HGY A;  2CY1 A;  4FTF A;  4DCU A;  1YHQ 1;  3GTM S;  4LF6 C;  3RV2 A;  4XX2 A;  4A3L I;  1XRC A;  1WJ2 A;  1M90 2;  1GPM A;  1IBK C;  4LFB C;  2D1R A;  5IP9 I;  2IV2 X;  3VMI A;  2F4O A;  4NBF A;  4BBR I;  3GPC A;  2DYJ A;  3GR1 A;  3CMA Z;  4JI2 C;  2QLV B;  1Y8C A;  1AA6 A;  4I9G A;  1YJN 1;  3I55 Z;  1VQK Z;  5AN9 F;  1W2B Y;  1PG4 A;  4JI5 C;  5CM2 M;  5T67 A;  1TWH I;  1XHJ A;  2KZ0 A;  3CCM 1;  1N8R 2;  2KPI A;  1P7L A;  4JI3 C;  2GTH A;  3EER A;  1M1K 1;  4OXI A;  2UU9 C;  2JR6 A;  2HHH C;  4NXN C;  1YI2 1;  3NYR A;  5A2Q D;  4R0M A;  1VQL Z;  4AYB A;  1USP A;  2YAD A;  1R9T I;  3CCL Z;  3R9X A;  2ONF A;  2ZZM A;  2PM9 A;  3HOU I;  4HPV A;  3CCL 1;  1S72 Z;  3GKQ A;  5FLX b;  2E2J I;  4CL1 A;  3ETC A;  2VZE A;  1YI2 Z;  2QEX Z;  5BUR A;  1JWH C;  3GTG I;  1V25 A;  4G36 A;  1FDI A;  4DG8 A;  2UXD C;  4NH1 C;  4A3C I;  3FCC A;  3GTO I;  4KTT A;  2JS4 A;  2R7Z I;  3CCU 1;  3G71 1;  1VQ7 1;  1HNW C;  3S15 I;  4BBS I;  4IZ6 A;  1VQ5 Z;  4DGL A;  1PG3 A;  4NBA A;  1Q86 1;  2D1T A;  2Z51 A;  4HGZ A;  3EED A;  3CPW Z;  3IML A;  2WAQ A;  3C5E A;  1K73 1;  4D4I A;  1ZH1 A;  2VPW A;  3NH4 A;  1I50 I;  3AF6 A;  4DV4 C;  1N32 C;  2LEX A;  1NP6 A;  2K5R A;  4NBE A;  1K0R A;  3E7X A;  3NDJ A;  3CPW Y;  1RNI A;  3CCJ 1;  4DV1 C;  2AYD A;  1Y1V I;  3CCR Z;  3CC7 Z;  2JIQ A;  3PO3 S;  1TFI A;  1TWF I;  2G2K A;  3IFU A;  1QVF Z;  4G37 A;  4DR5 C;  3BG0 B;  3M4O I;  2Y4N A;  3CCS 1;  1QF8 A;  1QXF A;  2IZ4 A;  1M6X A;  1QWI A;  3ETO A;  1RG9 A;  3CCM Z;  1Q82 2;  4A3B I;  3CQZ I;  2WB1 A;  4QTT A;  3GTQ I;  3CQ2 A;  2GU2 A;  3JAM D;  1L1O C;  3D2L A;  4RVF A;  4DR3 C;  5AE3 A;  1YIT Z;  4MD9 A;  2OBV A;  1QM4 A;  4MON A;  4RS4 A;  4A3M I;  1K9M 1;  2OOY B;  2P2Q A;  4AQY C;  3I55 1;  2E7Z A;  1VQK 1;  5LL6 f;  2JIM A;  4GXQ A;  1RLY A;  3J81 D;  2E5L C;  1ULT A;  3LNO A;  4DV0 C;  2O4H A;  4LFA C;  1PU1 A;  2Q4Z A;  4A3D I;  3S1N I;  3NDI A;  3I4N I;  1NUI A;  1XRB A;  4B3S C;  1VQP Z;  1T5H X;  3FKI I;  5A1I A;  4PUH A;  2M6N A;  4PHT A;  3CCE 1;  3UX3 A;  2VPY A;  3TDH B;  4MH4 A;  3B7W A;  4A93 I;  2VQE C;  3IF8 A;  3Q87 A;  3CCJ Z;  4DK1 A;  1Z01 A;  2MCQ A;  3VTN A;  2RHB A;  3NI2 A;  1FUG A;  4GXR A;  3I08 A;  4TPS B;  1VQN Z;  3DHV A;  3GKU A;  4EAT A;  1TH5 A;  4JI4 C;  4X65 C;  3DAY A;  3KIF A;  5H9U A;  1KQS Z;  1TWA I;  4MD7 A;  2CXC A;  5DV9 A;  3KIH A;  3VB9 A;  1MD9 A;  2M5H A;  3FCE A;  4G1I A;  1V60 A;  1JOS A;  2P2M A;  5BSM A;  1N34 C;  1WII A;  3IEV A;  2Y4O A;  3LNV A;  2YU9 I;  1WW9 A;  4NBC A;  2EGT A;  2W04 A;  3J80 D;  3CCS Z;  3S1R I;  1KC8 2;  4RMN A;  4GKJ C;  3H3V J;  1VQ6 1;  3CQ1 A;  1VQO Z;  5FLX D;  3N54 B;  5BSU A;  4YY3 C;  3BG1 B;  4D56 A;  4FUQ A;  4ODJ A;  1K83 I;  3G4S Z;  1YJW 1;  2V45 A;  3RZD I;  1YUK A;  2NVY I;  4WS9 A;  2BJO A;  3NH5 A;  5A19 A;  4B3R C;  3TR3 A;  3MON A;  4BY1 I;  1Q7Y 2;  3GTP I;  1QYP A;  3CCU Z;  2JNV A;  5A2Q f;  2R92 I;  2OZK A;  3DLP X;  3CC4 1;  4LF4 C;  1UKK A;  3CXC Z;  3S16 I;  3S1Q I;  4A3J I;  4NBH A;  3GTL I;  4BC7 A;  4NDN A;  3A4I A;  5BR8 C;  2OPL B;  3L95 X;  5CZX A;  1S7M A;  2E0G A;  1VQ9 1;  2QL8 A;  4JI8 C;  2AYA A;  3RZO I;  3PRO C;  4L2Z A;  4LE5 A;  4DCV A;  2H85 A;  4JI0 C;  3S1M I;  3A25 A;  1P4E C;  2JMP A;  1WH9 A;  1I6H I;  4JM1 A;  4DR6 C;  1Q81 1;  4GS5 A;  5BSR A;  4ZJZ A;  3NYQ A;  1USP B;  2DE5 A;  4DR7 C;  3CJE A;  1VQ9 Z;  2JA6 I;  2QRD B;  2E2H I;  2RBL A;  4L7I A;  1VQ4 1;  1HNZ C;  1W2B Z;  4BCA A;  2F4V C;  1QVG Z;  4K0B A;  2HU9 A;  4E32 A;  5AE2 A;  2OTJ Z;  2JIO A;  4K0K C;  2B63 I;  2E8E A;  3HOV I;  4U5Y D;  3J81 b;  4S1T A;  4RLF A;  1VQN 1;  3R9W A;  4NBB A;  1MXA A;  2P3Y A;  4DV2 C;  4OX9 C;  4MRI A;  2VSQ A;  2VUG A;  1YJ7 A;  1EGA A;  5BSW A;  5IWA C;  4R1L A;  2QW0 X;  4OYC A;  4X66 C;  3A26 A;  3HOZ I;  1N2F A;  1X3Z A;  3HOY I;  2OO4 A;  3JAM f;  4X64 C;  1Q16 A;  3I56 1;  3TE5 B;  1K8A 2;  1MXB A;  4IR7 A;  5JRH A;  1ZB9 A;  4JYA C;  4E2W A;  4A3E I;  3J7A 4;  3IEU A;  1HH2 P;  3CME Z;  1VQ6 Z;  2NVX I;  1YJ9 1;  1RO4 A;  1DL6 A;  4L4Q A;  2UUB C;  1NJI 2;  4NOZ A;  4YHH C;  2P28 A;  2V3V A;  2JMO A;  1MDF A;  2QRE B;  4E30 A;  2V8K A;  3CC2 Z;  2D1S A;  5E7Q A;  2VQF C;  4A3G I;  1P9N A;  1VQ5 1;  2D1Q A;  5IT9 b;  2NAP A;  4JV5 C;  4X62 C;  1S72 1;  3PBK A;  4E2Y A;  3S14 I;  4MTN A;  3MZL B;  1SIW A;  2Y0S A;  3OTO C;  1VQO 1;  1RY2 A;  5LCI A;  3IX0 A;  4E33 A;  2UXB C;  1KRL A;  3L8C A;  3G4S 1;  1NY8 A;  2W03 A;  1Q82 1;  1VQP 1;  3I56 Z;  3VMG A;  2D7V A;  4NBG A;  3K6R A;  3CCE Z;  4D4G A;  1K73 2;  3CW8 X;  2R6M A;  3RG2 A;  3M3Y I;  4MD8 A;  3J80 f;  2UXC C;  3GTK I;  2QR1 B;  5IP7 I;  3NPD A;  4BC9 A;  3T4N B;  5FLX f;  3HOX I;  1V26 A;  2DPL A;  1Q81 2;  2E7G A;  3TUF A;  3HKZ A;  2NVQ I;  3CC2 1;  4DR1 C;  3PES A;  1QVG Y;  2V7B A;  4RVH A;  2P2B A;  5T64 A;  1MKY A;  4BY7 I;  3VNR A;  4WV3 A;  2OTL Z;  2CU6 A;  2I3C A;  2NVT I;  1TWC I;  1IBM C;  2E9H A;  2JA7 I;  3K7A I;  3LUS A;  3I07 A;  5KEI A;  5K85 A;  3FQM A;  2Y27 A;  2JNY A;  3PO3 I;  2DE7 A;  1RO2 A;  3OW2 Z;  1VQL 1;  1I94 C;  1O9T A;  3HOW I;  4Y7N I;  2PT7 G;  1KKG A;  2VPZ A;  2JUB A;  1LCI A;  2V8I A;  3UEB A;  2LFU A;  5D1P A;  3NFZ A;  2RT9 A;  5C3E I;  2P2J A;  4RLQ A;  5GTD A;  3AF5 A;  1X3W A;  3UOW A;  2NCL A;  2QA4 Z;  2VPX A;  2JA5 I;  3NH8 A;  1LQL A;  3VNQ A;  1YJN Z;  2QEX 1;  2PN2 A;  1FLO A;  2JIR A;  1FJG C;  4DV3 C;  3N2Q A;  2E8F A;  1BA3 A;  1O93 A;  4ZLP A;  1XNR C;  1KC8 1;  2VF1 A;  2IZ3 A;  1XS3 A;  4LF9 C;  3EQ6 A;  3CD6 Z;  4JI1 C;  3O2E A;  3A9U A;  1YHQ Z;  1XMQ C;  2D28 C;  2WP0 C;  4E2Z A;  5LMU C;  1VEH A;  2M5O A;  5KYV A; 
#chains in the Genus database with same CATH homology
 3SO4 A;  2F4M A;  5AE1 A;  3G6E 1;  4GKK C;  2PK7 A;  3CXC Y;  2VUM I;  5BSV A;  1Z02 A;  5IT9 D;  1M90 1;  4TNU A;  1HNX C;  3CC4 Z;  3KXW A;  5D1O A;  2YWC A;  2UUC C;  4RM3 A;  1NJI 1;  4NXM C;  3G6E Z;  1YUA A;  1O92 A;  2QA4 1;  3TQI A;  2YCB A;  3S82 A;  4JI7 C;  4QTU A;  1Z03 A;  2J6A A;  3I4M I;  4NB8 A;  2AKL A;  1K8A 1;  4LF7 C;  4BBY A;  3T1H C;  3GCF A;  2K3R A;  4X6A I;  4DUY C;  4BXX I;  1VQ8 1;  1PFT A;  1ZB8 A;  3P5J B;  1KD1 2;  3VMH A;  1PA4 A;  2D27 A;  3CCQ 1;  1YIJ 1;  2PMZ A;  4R1M A;  3GTJ I;  4EWC A;  1YIJ Z;  2OTL 1;  1WF3 A;  3A9V A;  2P20 A;  3CCV 1;  4B3T C;  3G71 Z;  1VQ7 Z;  2ATW A;  1QVF Y;  3ESW A;  2XR1 A;  5LMN C;  1L2F A;  1J5E C;  5T8T A;  3FQQ A;  2KZF A;  2P02 A;  4DG9 A;  5BUQ A;  4DQY B;  1RO0 A;  1YJW Z;  4A3F I;  4NBD A;  5C4X I;  3H2T A;  4E2X A;  3PO2 I;  2LIY A;  2HJG A;  1IBL C;  1VLA A;  2ZAE B;  4BSZ A;  3S2D I;  2BH1 X;  4PRO C;  3UZ0 A;  5FLM I;  5C44 I;  1XRA A;  3CC7 1;  1VQ4 Z;  2DE6 A;  3OW2 Y;  2OOX B;  1I3Q I;  1JJ2 Y;  3S17 I;  4DR4 C;  4MXU A;  2ZM6 C;  4DR2 C;  3MZK B;  5ADZ A;  3CME 1;  5C4J I;  2RIQ A;  1VQ8 Z;  4RM2 A;  1N36 C;  4B3M C;  4PZP A;  5D1O B;  1RQF A;  3R44 A;  2QVZ X;  4RV9 A;  3CW9 A;  3GR0 A;  1Q86 2;  1SFO I;  1AMU A;  1JJ2 Z;  3CD6 1;  1NYE A;  4I9F A;  3CMA 1;  3E7W A;  4DCS A;  1M1K 2;  4LF8 C;  1N8R 1;  2E2I I;  2WD9 A;  1KD1 1;  1WCM I;  5BST A;  5BUS A;  1XMO C;  4RVG A;  2QVX X;  1MXC A;  4D57 A;  3G7S A;  4RVD A;  3TDE A;  1KQS Y;  4NFR A;  2GTI A;  4Y52 I;  3LAX A;  4FUT A;  1TWG I;  1Q7Y 1;  2OTJ 1;  5IFI A;  4JI6 C;  4A3I I;  4KTV A;  2PRO A;  3D6W A;  4HH4 A;  1VQM Z;  4DUZ C;  2O53 A;  2M48 A;  1X0T A;  3IPL A;  4DV5 C;  5A1G A;  1XNQ C;  2V8J A;  3H0G I;  3J81 f;  3D9X A;  1MDB A;  5CZV A;  2QRC B;  2E8C A;  2P2F A;  4DV6 C;  4DV7 C;  3S2H I;  3U50 C;  5T8S A;  3F3F C;  4DCT A;  4RVO A;  1N33 C;  5T6B A;  2RPR A;  1O90 A;  2KI7 B;  1HR0 C;  2ASB A;  2QKD A;  1Y1V S;  4ISB A;  4NB9 A;  1YIT 1;  2HF1 A;  4LF5 C;  3JAM b;  2JA8 I;  3CCV Z;  5K8F A;  1T5D X;  4KHP C;  1YJ9 Z;  4E31 A;  3VNS A;  3LGX A;  5A2Q b;  2Q51 A;  2YWB A;  2R93 I;  3GTM I;  5KYT A;  1K9M 2;  3T1Y C;  1VQM 1;  4A3K I;  4LFC C;  2OPL A;  1ML8 A;  5IT9 f;  3CCR 1;  3F3P C;  3CCQ Z;  4RVN A;  3J80 b;  1Y1W I;  2QVY X;  3QWU A;  4HGY A;  2CY1 A;  4FTF A;  4DCU A;  1YHQ 1;  3GTM S;  4LF6 C;  3RV2 A;  4XX2 A;  4A3L I;  1XRC A;  1M90 2;  1GPM A;  1IBK C;  4LFB C;  2D1R A;  5IP9 I;  3VMI A;  2F4O A;  4NBF A;  4BBR I;  3GPC A;  2DYJ A;  3GR1 A;  3CMA Z;  4JI2 C;  2QLV B;  4I9G A;  1YJN 1;  3I55 Z;  1VQK Z;  5AN9 F;  1W2B Y;  1PG4 A;  4JI5 C;  5CM2 M;  5T67 A;  1TWH I;  4JI3 C;  3CCM 1;  1N8R 2;  2KPI A;  1P7L A;  2GTH A;  3EER A;  1M1K 1;  4OXI A;  2UU9 C;  2JR6 A;  2HHH C;  4NXN C;  1YI2 1;  3NYR A;  5A2Q D;  4R0M A;  1VQL Z;  4AYB A;  1USP A;  2YAD A;  1R9T I;  3CCL Z;  3R9X A;  2ONF A;  2PM9 A;  3HOU I;  4HPV A;  3CCL 1;  1S72 Z;  3GKQ A;  5FLX b;  2E2J I;  4CL1 A;  3ETC A;  2VZE A;  1YI2 Z;  2QEX Z;  5BUR A;  1JWH C;  3GTG I;  1V25 A;  4G36 A;  4DG8 A;  2UXD C;  4NH1 C;  4A3C I;  3FCC A;  3GTO I;  4KTT A;  2JS4 A;  2R7Z I;  3CCU 1;  3G71 1;  1VQ7 1;  1HNW C;  3S15 I;  4BBS I;  4IZ6 A;  1VQ5 Z;  4DGL A;  1PG3 A;  4NBA A;  1Q86 1;  2D1T A;  3IML A;  4HGZ A;  3EED A;  3CPW Z;  4D4I A;  2WAQ A;  3C5E A;  1K73 1;  4DV4 C;  1ZH1 A;  3NH4 A;  3AF6 A;  1I50 I;  1N32 C;  1NP6 A;  2K5R A;  4NBE A;  1K0R A;  3E7X A;  3NDJ A;  3CPW Y;  1RNI A;  3CCJ 1;  4DV1 C;  1Y1V I;  3CCR Z;  3CC7 Z;  3PO3 S;  1TFI A;  1TWF I;  2G2K A;  3IFU A;  1QVF Z;  4G37 A;  4DR5 C;  3BG0 B;  3M4O I;  2Y4N A;  3CCS 1;  1QF8 A;  2IZ4 A;  1QWI A;  3ETO A;  1RG9 A;  3CCM Z;  1Q82 2;  4A3B I;  3CQZ I;  2WB1 A;  4QTT A;  3GTQ I;  2GU2 A;  3JAM D;  1L1O C;  4RVF A;  4DR3 C;  5AE3 A;  1YIT Z;  4MD9 A;  2OBV A;  1QM4 A;  4MON A;  4RS4 A;  4A3M I;  1K9M 1;  2OOY B;  2P2Q A;  4AQY C;  3I55 1;  1VQK 1;  5LL6 f;  4GXQ A;  1RLY A;  3J81 D;  2E5L C;  1ULT A;  4DV0 C;  4LFA C;  2O4H A;  2Q4Z A;  4A3D I;  3S1N I;  3NDI A;  3I4N I;  1NUI A;  1XRB A;  4B3S C;  1VQP Z;  1T5H X;  3FKI I;  5A1I A;  2M6N A;  4PHT A;  3CCE 1;  3TDH B;  4MH4 A;  3B7W A;  4A93 I;  2VQE C;  3IF8 A;  3Q87 A;  3CCJ Z;  4DK1 A;  1Z01 A;  3VTN A;  2RHB A;  3NI2 A;  1FUG A;  4GXR A;  3I08 A;  4TPS B;  1VQN Z;  3DHV A;  3GKU A;  4EAT A;  4JI4 C;  4X65 C;  3DAY A;  3KIF A;  5H9U A;  1KQS Z;  1TWA I;  4MD7 A;  2CXC A;  5DV9 A;  3KIH A;  3VB9 A;  1MD9 A;  3FCE A;  4G1I A;  4YY3 C;  2UUA C;  1JOS A;  2P2M A;  5BSM A;  1N34 C;  1WII A;  3IEV A;  2Y4O A;  3LNV A;  2YU9 I;  1WW9 A;  4NBC A;  2EGT A;  2W04 A;  3J80 D;  3CCS Z;  3S1R I;  1KC8 2;  4RMN A;  4GKJ C;  3H3V J;  1VQ6 1;  1VQO Z;  5FLX D;  3N54 B;  5BSU A;  3BG1 B;  4D56 A;  4FUQ A;  4ODJ A;  1K83 I;  3G4S Z;  1YJW 1;  3RZD I;  1YUK A;  2NVY I;  4WS9 A;  2BJO A;  3NH5 A;  5A19 A;  4B3R C;  3MON A;  4BY1 I;  1Q7Y 2;  3GTP I;  1QYP A;  3CCU Z;  5A2Q f;  2R92 I;  2OZK A;  3DLP X;  3CC4 1;  4LF4 C;  1UKK A;  3CXC Z;  3S16 I;  3S1Q I;  4A3J I;  4NBH A;  3GTL I;  4BC7 A;  4NDN A;  3A4I A;  5BR8 C;  2OPL B;  3L95 X;  5CZX A;  1S7M A;  2E0G A;  1VQ9 1;  2QL8 A;  4JI8 C;  2AYA A;  3RZO I;  3PRO C;  4L2Z A;  4LE5 A;  4DCV A;  2H85 A;  4JI0 C;  3S1M I;  2JMP A;  1WH9 A;  1I6H I;  4JM1 A;  4DR6 C;  1Q81 1;  4GS5 A;  5BSR A;  4ZJZ A;  3NYQ A;  1USP B;  2DE5 A;  4DR7 C;  3CJE A;  1VQ9 Z;  2JA6 I;  2QRD B;  2E2H I;  2RBL A;  4L7I A;  1VQ4 1;  1HNZ C;  1W2B Z;  4BCA A;  2F4V C;  1QVG Z;  4K0B A;  2HU9 A;  4E32 A;  5AE2 A;  2OTJ Z;  4K0K C;  2B63 I;  2E8E A;  3HOV I;  4U5Y D;  3J81 b;  4S1T A;  4RLF A;  1VQN 1;  3R9W A;  4NBB A;  1MXA A;  2P3Y A;  4DV2 C;  4OX9 C;  4MRI A;  2VSQ A;  2VUG A;  1YJ7 A;  1EGA A;  5BSW A;  5IWA C;  4R1L A;  2QW0 X;  4OYC A;  4X66 C;  3HOZ I;  1N2F A;  1X3Z A;  3HOY I;  2OO4 A;  3JAM f;  4X64 C;  1MXB A;  3I56 1;  3TE5 B;  1K8A 2;  4IR7 A;  5JRH A;  4JYA C;  1ZB9 A;  4E2W A;  4A3E I;  3J7A 4;  3IEU A;  1HH2 P;  3CME Z;  1VQ6 Z;  2NVX I;  1YJ9 1;  1RO4 A;  1DL6 A;  4L4Q A;  2UUB C;  1NJI 2;  4NOZ A;  4YHH C;  2P28 A;  2JMO A;  1MDF A;  2QRE B;  4E30 A;  2V8K A;  3CC2 Z;  2D1S A;  5E7Q A;  2VQF C;  4A3G I;  1P9N A;  1VQ5 1;  2D1Q A;  5IT9 b;  4JV5 C;  4X62 C;  1S72 1;  3PBK A;  4E2Y A;  3S14 I;  4MTN A;  3MZL B;  2Y0S A;  3OTO C;  1VQO 1;  1RY2 A;  3IX0 A;  4E33 A;  2UXB C;  1KRL A;  3L8C A;  3G4S 1;  2W03 A;  1Q82 1;  1VQP 1;  3I56 Z;  3VMG A;  2D7V A;  4NBG A;  3CCE Z;  4D4G A;  1K73 2;  3CW8 X;  2R6M A;  3RG2 A;  3M3Y I;  4MD8 A;  3J80 f;  2UXC C;  3GTK I;  2QR1 B;  5IP7 I;  3NPD A;  4BC9 A;  3T4N B;  5FLX f;  3HOX I;  1V26 A;  2DPL A;  1Q81 2;  2E7G A;  3TUF A;  3HKZ A;  2NVQ I;  3CC2 1;  4DR1 C;  3PES A;  1QVG Y;  2V7B A;  4RVH A;  2P2B A;  5T64 A;  1MKY A;  4BY7 I;  3VNR A;  4WV3 A;  2OTL Z;  2I3C A;  2NVT I;  1TWC I;  1IBM C;  2E9H A;  2JA7 I;  3K7A I;  3LUS A;  3I07 A;  5KEI A;  5K85 A;  3FQM A;  2Y27 A;  2JNY A;  3PO3 I;  2DE7 A;  1RO2 A;  3OW2 Z;  1VQL 1;  1I94 C;  1O9T A;  3HOW I;  4Y7N I;  2PT7 G;  1KKG A;  2JUB A;  1LCI A;  2V8I A;  5GTD A;  2LFU A;  5D1P A;  3NFZ A;  2RT9 A;  5C3E I;  2P2J A;  4RLQ A;  3AF5 A;  1X3W A;  3UOW A;  2QA4 Z;  2JA5 I;  3NH8 A;  1LQL A;  3VNQ A;  1YJN Z;  2QEX 1;  2PN2 A;  1FJG C;  4DV3 C;  3N2Q A;  2E8F A;  1BA3 A;  1O93 A;  4ZLP A;  1XNR C;  1KC8 1;  2VF1 A;  2IZ3 A;  4LF9 C;  3EQ6 A;  3CD6 Z;  4JI1 C;  3A9U A;  1YHQ Z;  1XMQ C;  2D28 C;  2WP0 C;  4E2Z A;  5LMU C;  5KYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...