1ZB9A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
141
Chain Sequence
NSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords organic hydroperoxide resistance protein
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
total genus 34
structure length 141
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb9A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb9A02
4DV6C 2KPIA 1K83I 4JI3C 3HOYI 3CQZI 3H3VJ 4A3MI 4JI2C 4BY7I 3GTPI 4DCTA 5C4XI 3GTLI 3H0GI 4B3MC 2E8EA 4X6AI 3GTGI 4X66C 4A3BI 5IT9D 4DUZC 2UXCC 2VUMI 3M3YI 4NOZA 1Y1VS 1X3ZA 2UUBC 4A3JI 4OX9C 2DE6A 2YU9I 2NVQI 4JI5C 3GTOI 3S14I 4BSZA 2KZFA 2PN2A 3S1NI 4LFBC 2CXCA 4DUYC 1XMQC 3Q87A 1ZB8A 2EGTA 2VQEC 1I50I 3M4OI 4NBBA 3S1RI 1USPB 2UXDC 1PA4A 4XX2A 5C4JI 4DV3C 3FKII 3S15I 1TFIA 1HR0C 2F4VC 4JI4C 5IWAC 4B3SC 3R9XA 3GKUA 2YCBA 3VMHA 3I4NI 3S1MI 4A3GI 5FLXD 1X3WA 1Y1WI 1PFTA 3VB9A 2E2II 4JV5C 4X65C 2DYJA 1XNRC 2DE7A 2R92I 1WH9A 4NB9A 3J81D 3GTMS 4NBFA 1JOSA 1TWCI 4A3CI 4GKJC 2PT7G 3GTKI 3PO2I 2UU9C 2JA8I 3I4MI 1WF3A 1TWAI 1L1OC 2NVTI 1Y1VI 4QTUA 2F4OA 1K0RA 2J6AA 2JA7I 2ATWA 2HF1A 5C44I 1IBMC 3S2DI 4JYAC 4A3KI 1HH2P 2E7GA 4Y52I 1NYEA 4JI1C 4NBEA 4LF5C 2E5LC 4NBGA 3IEVA 3PO3S 3U50C 2RBLA 3R9WA 4X62C 3S1QI 3GCFA 3AF5A 3S17I 3JAMD 4JI6C 4NBDA 3T1HC 2BJOA 1N32C 4BY1I 1UKKA 1HNXC 4BXXI 1HNWC 2DE5A 2F4MA 2E2HI 4NB8A 3GTMI 4NXMC 1RO4A 4LFAC 2ONFA 1I6HI 4DV1C 4JI8C 2UUAC 4DCSA 2NVXI 3S16I 4DR3C 4NBAA 4A3II 2B63I 1TWGI 3IEUA 4LF8C 2UXBC 4LFCC 2JR6A 1ML8A 2OPLB 2E8FA 1DL6A 4KHPC 3HOUI 4DV5C 4AQYC 1ZB9A 3EERA 5LMUC 3PO3I 3GKQA 5FLMI 4Y7NI 3HOZI 4DR2C 3RZDI 4DR7C 1I3QI 4DV4C 5IP7I 1MKYA 1IBKC 1XNQC 4LF9C 1N36C 4QTTA 3VMIA 1SFOI 1LQLA 2JA6I 1TWFI 3K7AI 2PK7A 4JI7C 4A3LI 1IBLC 3VMGA 3LUSA 5C3EI 4DR4C 1QWIA 4DCVA 2K5RA 4BBSI 4DV0C 5CM2M 4YHHC 2CY1A 4NXNC 4GKKC 4K0KC 4YY3C 2QL8A 3HOVI 3CJEA 2ASBA 1USPA 2D7VA 5BR8C 3S2HI 3HOXI 2ZM6C 1FJGC 4A3FI 4BBRI 1N34C 3D6WA 4JI0C 2P3YA 1XMOC 1EGAA 5IP9I 2OPLA 4LF4C 3GTJI 4DV2C 1WW9A 2JA5I 4LF7C 1N33C 2UUCC 1WCMI 1N2FA 2R7ZI 1RLYA 2E2JI 1YUAA 4MH4A 1R9TI 4DR5C 4B3RC 4A93I 4DCUA 2VQFC 5A2QD 2XR1A 4DR1C 1J5EC 4DV7C 2NVYI 1I94C 2R93I 3HOWI 1QYPA 3T1YC 1NUIA 1KKGA 5LMNC 4X64C 3OTOC 2HJGA 4A3DI 4B3TC 1L2FA 2E8CA 3ESWA 2JS4A 1TWHI 2JMPA 2JNYA 3I07A 3J80D 4NBHA 3GTQI 1VLAA 3AF6A 1HNZC 4DR6C 4LF6C 4NBCA 4MTNA 3RZOI 2HHHC 2AKLA 4A3EI
chains in the Genus database with same CATH superfamily
2V8KA 4DV6C 2KPIA 1WIIA 1K83I 1YHQ1 4JI3C 3HOYI 3CQZI 3H3VJ 1P4EC 2ZZMA 2VSQA 4A3MI 3CQ3A 4KTTA 4MONA 3EQ6A 3UZ0A 4JI2C 2K3RA 4BY7I 3GTPI 4DCTA 5C4XI 3G6E1 2QEX1 3LNOA 3GTLI 3DHVA 4RLFA 3H0GI 4B3MC 2E8EA 2MMAB 4X6AI 2PROA 3GTGI 4X66C 1VQ61 3CC41 1VQO1 2D1QA 4A3BI 3CD61 2JIMA 5IT9D 4DUZC 5D1OB 2UXCC 4NH1C 2VUMI 2Z51A 1JWHC 1MXAA 3M3YI 3PESA 4NOZA 3TE5B 1Y1VS 1X3ZA 2LEXA 2UUBC 2QA4Z 4S1TA 1RO0A 4A3JI 2DE6A 1RNIA 2GTHA 2O4HA 1S721 2YU9I 2NVQI 4JI5C 1YI2Z 3GTOI 5BSTA 5LCIA 1N8R1 4L7IA 2OTL1 2ZZNA 2V8IA 3CC2Z 1KQSZ 2IV2X 4DG8A 5E7QA 1LCIA 1Y8CA 3CCQ1 1KC81 3S14I 4BSZA 2KZFA 2PN2A 1YIJZ 3S1NI 4LFBC 2JIOA 3D9XA 2CXCA 3VNSA 4DUYC 3Q87A 1XMQC 1ZB8A 3J7A4 1M6XA 4PUHA 3I551 3I56Z 3A26A 1ULTA 2EGTA 2VQEC 5AE2A 1I50I 3M4OI 4NBBA 4RVOA 5KYTA 3S1RI 3R44A 1USPB 2UXDC 1X0TA 5KEIA 1PA4A 4XX2A 5C4JI 3ETCA 4DV3C 3FKII 3CPWY 1BA3A 3S15I 4DGLA 1TFIA 3FCCA 5T67A 5A2Qb 1VQKZ 1O90A 4HPVA 4RM2A 1HR0C 2F4VC 3LNVA 3G711 2JUBA 3L8CA 1QXFA 1Q821 4JI4C 5IWAC 4B3SC 1MXBA 5K85A 1VEHA 4R1MA 2LFUA 3TUFA 3R9XA 4NDNA 4RVDA 3GKUA 2KZ0A 1VQPZ 3IMLA 4R0MA 3CCSZ 2YCBA 3VMHA 3I4NI 3S1MI 2PM9A 1YJW1 1Q7Y1 4A3GI 1V26A 4ZJZA 4G37A 5FLXD 4E2XA 3CCMZ 3P5JB 1QVFZ 1X3WA 5LL6f 1Y1WI 2Y27A 1PFTA 3VB9A 2E2II 4JV5C 5ADZA 3CCR1 3VNRA 4X65C 1VQL1 2DYJA 1XNRC 2DE7A 2OOXB 2R92I 1WH9A 1FDOA 2O53A 4NB9A 1K731 4WV3A 2RT9A 3J81D 3GTMS 1FLOA 4NBFA 5DV9A 1JOSA 1YJ9Z 1T5HX 2P2MA 1TWCI 5T8SA 3A9UA 4A3CI 1YJ7A 2MCQA 1Z01A 3IFUA 4I9GA 4BBYA 4GS5A 1YJNZ 2PT7G 2VF1A 4OX9C 3CCJ1 3GTKI 4GKJC 2QVXX 3PO2I 2M48A 5BURA 2UU9C 1YHQZ 1Q861 1KRLA 2JA8I 3E7WA 3I4MI 1WF3A 1TWAI 1NP6A 2QR1B 2Q51A 2JIRA 4L4QA 1L1OC 3NDJA 3RG2A 5BUSA 2NVTI 1Y1VI 3J80b 3N2QA 1M1K1 4QTUA 2F4OA 2AYAA 1K0RA 3MZKB 2Y0SA 4MXUA 2J6AA 3G6EZ 2JA7I 2QEXZ 3OW2Z 3BG0B 2RPRA 2ATWA 1VQ91 1XS3A 4BCAA 4ODJA 2HF1A 3MONA 1M6XC 1VQ6Z 3CC4Z 1VQOZ 5C44I 1IB8A 3CD6Z 4E2YA 4R1LA 3NYQA 4E2WA 2RHBA 1IBMC 3S2DI 4HH4A 4RVNA 1Q7Y2 2W04A 3CXCZ 1MDBA 1FDIA 2RIQA 1S72Z 5IFIA 5BSVA 1T5DX 3AY0A 4JYAC 4A3KI 1V25A 5A2Qf 1HH2P 5D1OA 4D4GA 2E7GA 1AMUA 3GPCA 2OTLZ 1GPMA 4G36A 2VPYA 4Y52I 1NYEA 4PZPA 4NBEA 4JI1C 4LF5C 2E5LC 4NBGA 1Q16A 5T6BA 3CCQZ 3PO3S 2JNVA 3TQIA 3IEVA 3U50C 3FQMA 2RBLA 3J80D 2Q4ZA 1JJ2Z 1XRCA 3R9WA 4X62C 2PMZA 3KIFA 3I55Z 3S1QI 4RS4A 3GCFA 5FLXf 2Y4NA 5GTDA 4WS9A 3CCL1 2VUGA 2V8JA 3F3PC 3CMA1 2V7BA 3AF5A 5IT9b 4BC9A 5K8FA 3S17I 3JAMD 2VPWA 2D1TA 4JI6C 3JAMb 4FUTA 4NBDA 4IZ6A 4AYBA 5T8TA 3T1HC 2BJOA 1N32C 3J81f 4FTFA 4RV9A 4BY1I 3PBKA 1UKKA 1HNXC 3F3FC 2GTIA 2R6MA 3G4S1 4BXXI 2P2FA 1HNWC 2P2JA 2DE5A 2F4MA 1QVFY 2E2HI 1Q811 1K9M1 4NB8A 3IF8A 3G71Z 3GTMI 1VQ71 4NXMC 4PROC 4ISBA 3J80f 3IR7A 1RO4A 1M901 4LFAC 2ONFA 2YX1A 1YJWZ 4PUIA 3L95X 1I6HI 4DV1C 4ZLPA 3E7XA 4MD7A 2NAPA 3CCV1 2VZEA 3CCRZ 4JI8C 1VQLZ 2UUAC 4GXRA 3CQ2A 2V45A 5A1IA 3NH5A 4DCSA 3VNQA 2NVXI 1NJI1 3A25A 1W2BY 3A9VA 4RLQA 3S16I 4DR3C 4GXQA 4NBAA 4A3II 2B63I 1TWGI 2HU9A 2V3VA 3CCJZ 1VQM1 4E30A 3O2EA 3IEUA 4LF8C 2UXBC 4LFCC 2JR6A 2GU2A 4D56A 2Y4OA 1ML8A 4TNUA 3GR0A 1MD9A 2OPLB 3FQQA 4CL1A 4PUGA 2AYDA 2E8FA 2BH1X 5FLXb 1N8R2 1DL6A 1VQ41 3HOUI 2I3CA 2D27A 4KHPC 3UOWA 5BSMA 4DV5C 4AQYC 3CXCY 3UX2A 1KD11 1KC82 1Q812 1ZB9A 2QKDA 2VPZA 1VQ9Z 3J81b 2M6NA 3EERA 5IT9f 2WD9A 5AE1A 1MXCA 3NFZA 3JAMf 5LMUC 3PO3I 1ZH1A 3GKQA 4G1IA 1TH5A 4IR7A 2JMOA 5FLMI 1WCJA 1PU1A 1UWDA 2P2QA 3CCE1 3GR1A 3CC71 4HGYA 3C5EA 4Y7NI 1JJ2Y 2WB1A 3SO4A 1NY8A 3HOZI 2D1RA 4DR2C 3RZDI 1PG3A 4E33A 5AE3A 4DR7C 5D1PA 1I3QI 2OTJZ 2QVYX 3BG1B 1VQN1 4DV4C 2JIPA 5IP7I 1NJI2 4I9FA 1MKYA 1QM4A 1VQ51 3IX0A 1IBKC 4LF9C 5H9UA 1XNQC 3CMEZ 1Q822 4RVHA 1N36C 4EATA 2KDNA 4QTTA 3VMIA 1SFOI 2D1SA 1O92A 1LQLA 3NYRA 2JA6I 4PHTA 1KQSY 3TDEA 5BUQA 2IZ3A 1RY2A 3CCLZ 3ETOA 3S82A 3CMAZ 5BSRA 1TWFI 3K7AI 3UEBA 2PK7A 3CQ1A 4HGZA 4JI7C 4A3LI 1IBLC 4DG9A 3VMGA 3LUSA 3CCU1 2VPXA 3LGXA 2OTJ1 1Z03A 5C3EI 1K732 2P28A 3G4SZ 4DR4C 1MDFA 1QWIA 3FCEA 4DCVA 3VTNA 1XHJA 3CME1 2K5RA 1VQ7Z 4BBSI 4DV0C 1YIT1 2YADA 1O93A 5CM2M 1Q862 1RQFA 3RV2A 3CW8X 4OYCA 4YHHC 2CY1A 2OZKA 1QVGZ 4NXNC 5CZVA 1M1K2 4RVFA 4GKKC 1VQ81 3CCVZ 4K0KC 4YY3C 5T64A 1K8A1 2QL8A 3HOVI 1PG4A 2QREB 3CJEA 2ASBA 3T4NB 1USPA 2D7VA 2QVZX 4RMNA 5BR8C 4U5YD 1VQMZ 3S2HI 5AN9F 3HOXI 2YWBA 3N54B 2ZM6C 4BC7A 2DHMA 3TR3A 1FJGC 4MD9A 2ZAEB 2P2BA 4A3FI 2KI7B 5CZXA 4BBRI 2P20A 1Z02A 4JM1A 1VQ4Z 1N34C 3D6WA 2WP0C 4JI0C 2NCLA 2P3YA 3LAXA 1XMOC 1QF8A 1WZNA 1EGAA 5IP9I 1P4EA 2OPLA 4FUQA 4EWCA 4E32A 4LF4C 1SIWA 4MD8A 3GTJI 3B7WA 4LE5A 2OBVA 4DV2C 1WW9A 2QW0X 2JA5I 2IZ4A 4LF7C 1V60A 1N33C 2UUCC 1WCMI 3CCEZ 2W03A 3CC7Z 1N2FA 3OW2Y 3NH4A 3DAYA 5BSWA 2R7ZI 3K6RA 1RLYA 4K0BA 2E2JI 2QA41 3NH8A 1YUAA 4MH4A 1R9TI 1YI21 3A4IA 3QWUA 2P02A 3NI2A 4DR5C 1K8A2 1VQNZ 4A93I 4RVGA 4DQYB 4DCUA 4B3RC 2MM9A 3CC21 5A1GA 1P9NA 2QRCB 1P7LA 4D4IA 2VQFC 4TPSB 5A2QD 2XR1A 3IPLA 1K9M2 4DR1C 4D57A 1VQ5Z 1J5EC 2D28C 4DV7C 1YIJ1 2NVYI 5KYVA 1WJ2A 3UX3A 2G2KA 1I94C 4RM3A 2R93I 3HOWI 1QYPA 1M902 3T1YC 3I561 1FUGA 3D2LA 1NUIA 1S7MA 1KKGA 5LMNC 3H2TA 4KTVA 4X64C 1YUKA 3OTOC 2DPLA 2HJGA 4NFRA 2JIQA 4A3DI 3PROC 4B3TC 3EEDA 3CCUZ 3MZLB 1L2FA 4DK1A 2E8CA 3NPDA 2H85A 1XRAA 2E9HA 5JRHA 1QVGY 1RO2A 1VQK1 3G7SA 4L2ZA 3ESWA 2YWCA 4E31A 2JS4A 2E0GA 3NDIA 4MRIA 1YITZ 1TWHI 2JMPA 1XRBA 2M5OA 1VQP1 2JNYA 3CCS1 2M5HA 3CPWZ 3I08A 3I07A 2WAQA 3TDHB 1W2BZ 3KIHA 2CU6A 4NBHA 3CCM1 3GTQI 1RG9A 3CW9A 3DLPX 5BSUA 1VQ8Z 1VLAA 4E2ZA 1KD12 3AF6A 1HNZC 4DR6C 4LF6C 5A19A 4OXIA 2OOYB 1YJ91 4NBCA 2QLVB 4MTNA 2LIYA 2OO4A 3RZOI 2HHHC 2AKLA 2QRDB 4A3EI 1AA6A 2E7ZA 1O9TA 1YJN1 3HKZA 3KXWA
chains in the Genus database with same CATH topology
2V8KA 4DV6C 2KPIA 1WIIA 1K83I 1YHQ1 4JI3C 3HOYI 3CQZI 3H3VJ 2VSQA 4A3MI 4KTTA 4MONA 3EQ6A 3UZ0A 4JI2C 2K3RA 4BY7I 3GTPI 4DCTA 5C4XI 3G6E1 2QEX1 3GTLI 3DHVA 4RLFA 3H0GI 4B3MC 2E8EA 4X6AI 2PROA 3GTGI 4X66C 1VQ61 3CC41 1VQO1 2D1QA 4A3BI 3CD61 5IT9D 4DUZC 5D1OB 2UXCC 4NH1C 2VUMI 1JWHC 1MXAA 3M3YI 3PESA 4NOZA 3TE5B 1Y1VS 1X3ZA 2UUBC 2QA4Z 4S1TA 1RO0A 4A3JI 2DE6A 1RNIA 2GTHA 2O4HA 1S721 2YU9I 2NVQI 4JI5C 1YI2Z 3GTOI 5BSTA 1N8R1 4L7IA 2OTL1 2V8IA 3CC2Z 1KQSZ 4DG8A 5E7QA 1LCIA 3CCQ1 1KC81 3S14I 4BSZA 2KZFA 2PN2A 1YIJZ 3S1NI 4LFBC 3D9XA 2CXCA 3VNSA 4DUYC 1XMQC 3Q87A 1ZB8A 3J7A4 3I551 3I56Z 1ULTA 2EGTA 2VQEC 5AE2A 1I50I 3M4OI 4NBBA 4RVOA 5KYTA 3S1RI 3R44A 1USPB 2UXDC 1X0TA 5KEIA 1PA4A 4XX2A 5C4JI 3ETCA 4DV3C 3FKII 3CPWY 1BA3A 3S15I 4DGLA 1TFIA 3FCCA 5T67A 5A2Qb 1VQKZ 1O90A 4HPVA 4RM2A 1HR0C 2F4VC 3LNVA 3G711 2JUBA 3L8CA 1Q821 4JI4C 5IWAC 4B3SC 1MXBA 5K85A 4R1MA 2LFUA 3TUFA 3R9XA 4NDNA 4RVDA 3GKUA 1VQPZ 3IMLA 4R0MA 3CCSZ 2YCBA 3VMHA 3I4NI 3S1MI 2PM9A 1YJW1 1Q7Y1 4A3GI 1V26A 4ZJZA 4G37A 5FLXD 4E2XA 3CCMZ 3P5JB 1QVFZ 1X3WA 5LL6f 1Y1WI 2Y27A 1PFTA 3VB9A 2E2II 4JV5C 5ADZA 3CCR1 3VNRA 4X65C 1VQL1 2DYJA 1XNRC 2DE7A 2OOXB 2R92I 1WH9A 2O53A 4NB9A 1K731 4WV3A 2RT9A 3J81D 3GTMS 4NBFA 5DV9A 1JOSA 1YJ9Z 1T5HX 2P2MA 1TWCI 5T8SA 3A9UA 4A3CI 1YJ7A 1Z01A 3IFUA 4I9GA 4BBYA 4GS5A 1YJNZ 2PT7G 2VF1A 4OX9C 3CCJ1 3GTKI 4GKJC 2QVXX 3PO2I 2M48A 5BURA 2UU9C 1YHQZ 1Q861 1KRLA 2JA8I 3E7WA 3I4MI 1WF3A 1TWAI 1NP6A 2QR1B 2Q51A 4L4QA 1L1OC 3NDJA 3RG2A 5BUSA 2NVTI 1Y1VI 3J80b 3N2QA 1M1K1 4QTUA 2F4OA 2AYAA 1K0RA 3MZKB 2Y0SA 4MXUA 2J6AA 3G6EZ 2JA7I 2QEXZ 3OW2Z 3BG0B 2RPRA 2ATWA 1VQ91 4BCAA 4ODJA 2HF1A 3MONA 1VQ6Z 3CC4Z 1VQOZ 5C44I 3CD6Z 4E2YA 4R1LA 3NYQA 4E2WA 2RHBA 1IBMC 3S2DI 4HH4A 4RVNA 1Q7Y2 2W04A 3CXCZ 1MDBA 1S72Z 2RIQA 5IFIA 5BSVA 1T5DX 4JYAC 4A3KI 1V25A 5A2Qf 1HH2P 5D1OA 4D4GA 2E7GA 1AMUA 3GPCA 2OTLZ 1GPMA 4G36A 4Y52I 1NYEA 4PZPA 4NBEA 4JI1C 4LF5C 2E5LC 4NBGA 3CCQZ 5T6BA 3PO3S 3IEVA 3TQIA 3U50C 3FQMA 2RBLA 3J80D 2Q4ZA 1JJ2Z 1XRCA 3R9WA 4X62C 2PMZA 3KIFA 3I55Z 3S1QI 4RS4A 3GCFA 5FLXf 2Y4NA 5GTDA 4WS9A 3CCL1 2VUGA 2V8JA 3F3PC 3CMA1 2V7BA 3AF5A 5IT9b 4BC9A 5K8FA 3S17I 3JAMD 4JI6C 2D1TA 3JAMb 4FUTA 4NBDA 4IZ6A 4AYBA 5T8TA 3T1HC 2BJOA 1N32C 3J81f 4FTFA 4RV9A 4BY1I 3PBKA 1UKKA 1HNXC 3F3FC 2GTIA 2R6MA 3G4S1 4BXXI 2P2FA 1HNWC 2P2JA 2DE5A 2F4MA 1QVFY 2E2HI 1Q811 1K9M1 4NB8A 3IF8A 3G71Z 3GTMI 1VQ71 4NXMC 4PROC 4ISBA 3J80f 1RO4A 1M901 4LFAC 2ONFA 1YJWZ 3L95X 1I6HI 4DV1C 4ZLPA 3E7XA 4MD7A 3CCV1 2VZEA 3CCRZ 4JI8C 1VQLZ 2UUAC 4GXRA 5A1IA 3NH5A 4DCSA 3VNQA 2NVXI 1NJI1 1W2BY 3A9VA 4RLQA 3S16I 4DR3C 4GXQA 4NBAA 4A3II 2B63I 1TWGI 2HU9A 3CCJZ 1VQM1 4E30A 3IEUA 4LF8C 2UXBC 4LFCC 2JR6A 2GU2A 4D56A 2Y4OA 1ML8A 4TNUA 3GR0A 1MD9A 2OPLB 3FQQA 4CL1A 2E8FA 2BH1X 5FLXb 1N8R2 1DL6A 1VQ41 3HOUI 2I3CA 2D27A 4KHPC 3UOWA 5BSMA 4DV5C 4AQYC 3CXCY 1KD11 1KC82 1Q812 1ZB9A 2QKDA 1VQ9Z 3J81b 2M6NA 3EERA 5IT9f 2WD9A 5AE1A 1MXCA 3NFZA 3JAMf 5LMUC 3PO3I 1ZH1A 3GKQA 4G1IA 4IR7A 2JMOA 5FLMI 2P2QA 3CCE1 3GR1A 3CC71 4HGYA 3C5EA 4Y7NI 1JJ2Y 2WB1A 3SO4A 3HOZI 2D1RA 4DR2C 3RZDI 1PG3A 4E33A 5AE3A 4DR7C 5D1PA 1I3QI 2OTJZ 2QVYX 3BG1B 1VQN1 4DV4C 5IP7I 1NJI2 4I9FA 1MKYA 1QM4A 1VQ51 3IX0A 1IBKC 4LF9C 5H9UA 1XNQC 3CMEZ 1Q822 4RVHA 1N36C 4EATA 4QTTA 3VMIA 1SFOI 2D1SA 1O92A 1LQLA 3NYRA 2JA6I 4PHTA 1KQSY 3TDEA 5BUQA 2IZ3A 1RY2A 3CCLZ 3ETOA 3S82A 3CMAZ 5BSRA 1TWFI 3K7AI 2PK7A 4HGZA 4JI7C 4A3LI 1IBLC 4DG9A 3VMGA 3LUSA 3CCU1 3LGXA 2OTJ1 1Z03A 5C3EI 1K732 2P28A 3G4SZ 4DR4C 1MDFA 1QWIA 3FCEA 4DCVA 3VTNA 3CME1 2K5RA 1VQ7Z 4BBSI 4DV0C 1YIT1 2YADA 1O93A 5CM2M 1Q862 1RQFA 3RV2A 3CW8X 4OYCA 4YHHC 2CY1A 2OZKA 1QVGZ 4NXNC 5CZVA 1M1K2 4RVFA 4GKKC 1VQ81 3CCVZ 4K0KC 4YY3C 5T64A 1K8A1 2QL8A 3HOVI 1PG4A 2QREB 3CJEA 2ASBA 3T4NB 1USPA 2D7VA 2QVZX 4RMNA 5BR8C 4U5YD 1VQMZ 3S2HI 5AN9F 3HOXI 2YWBA 3N54B 2ZM6C 4BC7A 1FJGC 4MD9A 2ZAEB 2P2BA 4A3FI 2KI7B 5CZXA 4BBRI 2P20A 1Z02A 4JM1A 1VQ4Z 1N34C 3D6WA 2WP0C 4JI0C 2P3YA 3LAXA 1XMOC 1QF8A 1EGAA 5IP9I 2OPLA 4FUQA 4EWCA 4E32A 4LF4C 4MD8A 3GTJI 3B7WA 4LE5A 2OBVA 4DV2C 1WW9A 2QW0X 2JA5I 2IZ4A 4LF7C 1N33C 2UUCC 1WCMI 3CCEZ 2W03A 3CC7Z 1N2FA 3OW2Y 3NH4A 3DAYA 5BSWA 2R7ZI 1RLYA 4K0BA 2E2JI 2QA41 3NH8A 1YUAA 4MH4A 1R9TI 1YI21 3A4IA 3QWUA 2P02A 3NI2A 4DR5C 1K8A2 1VQNZ 4A93I 4RVGA 4DQYB 4DCUA 4B3RC 3CC21 5A1GA 1P9NA 2QRCB 1P7LA 4D4IA 2VQFC 4TPSB 5A2QD 2XR1A 3IPLA 1K9M2 4DR1C 4D57A 1VQ5Z 1J5EC 2D28C 4DV7C 1YIJ1 2NVYI 5KYVA 2G2KA 1I94C 4RM3A 2R93I 3HOWI 1QYPA 1M902 3T1YC 3I561 1FUGA 1NUIA 1S7MA 1KKGA 5LMNC 3H2TA 4KTVA 4X64C 1YUKA 3OTOC 2DPLA 2HJGA 4NFRA 4A3DI 3PROC 4B3TC 3EEDA 3CCUZ 3MZLB 1L2FA 4DK1A 2E8CA 3NPDA 2H85A 1XRAA 2E9HA 5JRHA 1QVGY 1RO2A 1VQK1 3G7SA 4L2ZA 3ESWA 2YWCA 4E31A 2JS4A 2E0GA 3NDIA 4MRIA 1YITZ 1TWHI 2JMPA 1XRBA 1VQP1 2JNYA 3CCS1 3CPWZ 3I08A 3I07A 2WAQA 3TDHB 1W2BZ 3KIHA 3DLPX 4NBHA 3CCM1 3GTQI 1RG9A 3CW9A 5BSUA 1VQ8Z 1VLAA 4E2ZA 1KD12 3AF6A 1HNZC 4DR6C 4LF6C 5A19A 4OXIA 2OOYB 1YJ91 4NBCA 2QLVB 4MTNA 2LIYA 2OO4A 3RZOI 2HHHC 2AKLA 2QRDB 4A3EI 1O9TA 1YJN1 3HKZA 3KXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 C;  2KPI A;  1K83 I;  4JI3 C;  3HOY I;  3CQZ I;  3H3V J;  4A3M I;  4JI2 C;  4BY7 I;  3GTP I;  4DCT A;  5C4X I;  3GTL I;  3H0G I;  4B3M C;  2E8E A;  4X6A I;  3GTG I;  4X66 C;  4A3B I;  5IT9 D;  4DUZ C;  2UXC C;  2VUM I;  3M3Y I;  4NOZ A;  1Y1V S;  1X3Z A;  2UUB C;  4A3J I;  4OX9 C;  2DE6 A;  2YU9 I;  2NVQ I;  4JI5 C;  3GTO I;  3S14 I;  4BSZ A;  2KZF A;  2PN2 A;  3S1N I;  4LFB C;  2CXC A;  4DUY C;  1XMQ C;  3Q87 A;  1ZB8 A;  2EGT A;  2VQE C;  1I50 I;  3M4O I;  4NBB A;  3S1R I;  1USP B;  2UXD C;  1PA4 A;  4XX2 A;  5C4J I;  4DV3 C;  3FKI I;  3S15 I;  1TFI A;  1HR0 C;  2F4V C;  4JI4 C;  5IWA C;  4B3S C;  3R9X A;  3GKU A;  2YCB A;  3VMH A;  3I4N I;  3S1M I;  4A3G I;  5FLX D;  1X3W A;  1Y1W I;  1PFT A;  3VB9 A;  2E2I I;  4JV5 C;  4X65 C;  2DYJ A;  1XNR C;  2DE7 A;  2R92 I;  1WH9 A;  4NB9 A;  3J81 D;  3GTM S;  4NBF A;  1JOS A;  1TWC I;  4A3C I;  4GKJ C;  2PT7 G;  3GTK I;  3PO2 I;  2UU9 C;  2JA8 I;  3I4M I;  1WF3 A;  1TWA I;  1L1O C;  2NVT I;  1Y1V I;  4QTU A;  2F4O A;  1K0R A;  2J6A A;  2JA7 I;  2ATW A;  2HF1 A;  5C44 I;  1IBM C;  3S2D I;  4JYA C;  4A3K I;  1HH2 P;  2E7G A;  4Y52 I;  1NYE A;  4JI1 C;  4NBE A;  4LF5 C;  2E5L C;  4NBG A;  3IEV A;  3PO3 S;  3U50 C;  2RBL A;  3R9W A;  4X62 C;  3S1Q I;  3GCF A;  3AF5 A;  3S17 I;  3JAM D;  4JI6 C;  4NBD A;  3T1H C;  2BJO A;  1N32 C;  4BY1 I;  1UKK A;  1HNX C;  4BXX I;  1HNW C;  2DE5 A;  2F4M A;  2E2H I;  4NB8 A;  3GTM I;  4NXM C;  1RO4 A;  4LFA C;  2ONF A;  1I6H I;  4DV1 C;  4JI8 C;  2UUA C;  4DCS A;  2NVX I;  3S16 I;  4DR3 C;  4NBA A;  4A3I I;  2B63 I;  1TWG I;  3IEU A;  4LF8 C;  2UXB C;  4LFC C;  2JR6 A;  1ML8 A;  2OPL B;  2E8F A;  1DL6 A;  4KHP C;  3HOU I;  4DV5 C;  4AQY C;  1ZB9 A;  3EER A;  5LMU C;  3PO3 I;  3GKQ A;  5FLM I;  4Y7N I;  3HOZ I;  4DR2 C;  3RZD I;  4DR7 C;  1I3Q I;  4DV4 C;  5IP7 I;  1MKY A;  1IBK C;  1XNQ C;  4LF9 C;  1N36 C;  4QTT A;  3VMI A;  1SFO I;  1LQL A;  2JA6 I;  1TWF I;  3K7A I;  2PK7 A;  4JI7 C;  4A3L I;  1IBL C;  3VMG A;  3LUS A;  5C3E I;  4DR4 C;  1QWI A;  4DCV A;  2K5R A;  4BBS I;  4DV0 C;  5CM2 M;  4YHH C;  2CY1 A;  4NXN C;  4GKK C;  4K0K C;  4YY3 C;  2QL8 A;  3HOV I;  3CJE A;  2ASB A;  1USP A;  2D7V A;  5BR8 C;  3S2H I;  3HOX I;  2ZM6 C;  1FJG C;  4A3F I;  4BBR I;  1N34 C;  3D6W A;  4JI0 C;  2P3Y A;  1XMO C;  1EGA A;  5IP9 I;  2OPL A;  4LF4 C;  3GTJ I;  4DV2 C;  1WW9 A;  2JA5 I;  4LF7 C;  1N33 C;  2UUC C;  1WCM I;  1N2F A;  2R7Z I;  1RLY A;  2E2J I;  1YUA A;  4MH4 A;  1R9T I;  4DR5 C;  4B3R C;  4A93 I;  4DCU A;  2VQF C;  5A2Q D;  2XR1 A;  4DR1 C;  1J5E C;  4DV7 C;  2NVY I;  1I94 C;  2R93 I;  3HOW I;  1QYP A;  3T1Y C;  1NUI A;  1KKG A;  5LMN C;  4X64 C;  3OTO C;  2HJG A;  4A3D I;  4B3T C;  1L2F A;  2E8C A;  3ESW A;  2JS4 A;  1TWH I;  2JMP A;  2JNY A;  3I07 A;  3J80 D;  4NBH A;  3GTQ I;  1VLA A;  3AF6 A;  1HNZ C;  4DR6 C;  4LF6 C;  4NBC A;  4MTN A;  3RZO I;  2HHH C;  2AKL A;  4A3E I; 
#chains in the Genus database with same CATH topology
 2V8K A;  4DV6 C;  2KPI A;  1WII A;  1K83 I;  1YHQ 1;  4JI3 C;  3HOY I;  3CQZ I;  3H3V J;  1P4E C;  2ZZM A;  2VSQ A;  4A3M I;  3CQ3 A;  4KTT A;  4MON A;  3EQ6 A;  3UZ0 A;  4JI2 C;  2K3R A;  4BY7 I;  3GTP I;  4DCT A;  5C4X I;  3G6E 1;  2QEX 1;  3LNO A;  3GTL I;  3DHV A;  4RLF A;  3H0G I;  4B3M C;  2E8E A;  2MMA B;  4X6A I;  2PRO A;  3GTG I;  4X66 C;  1VQ6 1;  3CC4 1;  1VQO 1;  2D1Q A;  4A3B I;  3CD6 1;  2JIM A;  5IT9 D;  4DUZ C;  5D1O B;  2UXC C;  4NH1 C;  2VUM I;  2Z51 A;  1JWH C;  1MXA A;  3M3Y I;  3PES A;  4NOZ A;  3TE5 B;  1Y1V S;  1X3Z A;  2LEX A;  2UUB C;  2QA4 Z;  4S1T A;  1RO0 A;  4A3J I;  2DE6 A;  1RNI A;  2GTH A;  2O4H A;  1S72 1;  2YU9 I;  2NVQ I;  4JI5 C;  1YI2 Z;  3GTO I;  5BST A;  5LCI A;  1N8R 1;  4L7I A;  2OTL 1;  2ZZN A;  2V8I A;  3CC2 Z;  1KQS Z;  2IV2 X;  4DG8 A;  5E7Q A;  1LCI A;  1Y8C A;  3CCQ 1;  1KC8 1;  3S14 I;  4BSZ A;  2KZF A;  2PN2 A;  1YIJ Z;  3S1N I;  4LFB C;  2JIO A;  3D9X A;  2CXC A;  3VNS A;  4DUY C;  3Q87 A;  1XMQ C;  1ZB8 A;  3J7A 4;  1M6X A;  4PUH A;  3I55 1;  3I56 Z;  3A26 A;  1ULT A;  2EGT A;  2VQE C;  5AE2 A;  1I50 I;  3M4O I;  4NBB A;  4RVO A;  5KYT A;  3S1R I;  3R44 A;  1USP B;  2UXD C;  1X0T A;  5KEI A;  1PA4 A;  4XX2 A;  5C4J I;  3ETC A;  4DV3 C;  3FKI I;  3CPW Y;  1BA3 A;  3S15 I;  4DGL A;  1TFI A;  3FCC A;  5T67 A;  5A2Q b;  1VQK Z;  1O90 A;  4HPV A;  4RM2 A;  1HR0 C;  2F4V C;  3LNV A;  3G71 1;  2JUB A;  3L8C A;  1QXF A;  1Q82 1;  4JI4 C;  5IWA C;  4B3S C;  1MXB A;  5K85 A;  1VEH A;  4R1M A;  2LFU A;  3TUF A;  3R9X A;  4NDN A;  4RVD A;  3GKU A;  2KZ0 A;  1VQP Z;  3IML A;  4R0M A;  3CCS Z;  2YCB A;  3VMH A;  3I4N I;  3S1M I;  2PM9 A;  1YJW 1;  1Q7Y 1;  4A3G I;  1V26 A;  4ZJZ A;  4G37 A;  5FLX D;  4E2X A;  3CCM Z;  3P5J B;  1QVF Z;  1X3W A;  5LL6 f;  1Y1W I;  2Y27 A;  1PFT A;  3VB9 A;  2E2I I;  4JV5 C;  5ADZ A;  3CCR 1;  3VNR A;  4X65 C;  1VQL 1;  2DYJ A;  1XNR C;  2DE7 A;  2OOX B;  2R92 I;  1WH9 A;  1FDO A;  2O53 A;  4NB9 A;  1K73 1;  4WV3 A;  2RT9 A;  3J81 D;  3GTM S;  1FLO A;  4NBF A;  5DV9 A;  1JOS A;  1YJ9 Z;  1T5H X;  2P2M A;  1TWC I;  5T8S A;  3A9U A;  4A3C I;  1YJ7 A;  2MCQ A;  1Z01 A;  3IFU A;  4I9G A;  4BBY A;  4GS5 A;  1YJN Z;  2PT7 G;  2VF1 A;  4OX9 C;  3CCJ 1;  3GTK I;  4GKJ C;  2QVX X;  3PO2 I;  2M48 A;  5BUR A;  2UU9 C;  1YHQ Z;  1Q86 1;  1KRL A;  2JA8 I;  3E7W A;  3I4M I;  1WF3 A;  1TWA I;  1NP6 A;  2QR1 B;  2Q51 A;  2JIR A;  4L4Q A;  1L1O C;  3NDJ A;  3RG2 A;  5BUS A;  2NVT I;  1Y1V I;  3J80 b;  3N2Q A;  1M1K 1;  4QTU A;  2F4O A;  2AYA A;  1K0R A;  3MZK B;  2Y0S A;  4MXU A;  2J6A A;  3G6E Z;  2JA7 I;  2QEX Z;  3OW2 Z;  3BG0 B;  2RPR A;  2ATW A;  1VQ9 1;  1XS3 A;  4BCA A;  4ODJ A;  2HF1 A;  3MON A;  1M6X C;  1VQ6 Z;  3CC4 Z;  1VQO Z;  5C44 I;  1IB8 A;  3CD6 Z;  4E2Y A;  4R1L A;  3NYQ A;  4E2W A;  2RHB A;  1IBM C;  3S2D I;  4HH4 A;  4RVN A;  1Q7Y 2;  2W04 A;  3CXC Z;  1MDB A;  1FDI A;  2RIQ A;  1S72 Z;  5IFI A;  5BSV A;  1T5D X;  3AY0 A;  4JYA C;  4A3K I;  1V25 A;  5A2Q f;  1HH2 P;  5D1O A;  4D4G A;  2E7G A;  1AMU A;  3GPC A;  2OTL Z;  1GPM A;  4G36 A;  2VPY A;  4Y52 I;  1NYE A;  4PZP A;  4NBE A;  4JI1 C;  4LF5 C;  2E5L C;  4NBG A;  1Q16 A;  5T6B A;  3CCQ Z;  3PO3 S;  2JNV A;  3TQI A;  3IEV A;  3U50 C;  3FQM A;  2RBL A;  3J80 D;  2Q4Z A;  1JJ2 Z;  1XRC A;  3R9W A;  4X62 C;  2PMZ A;  3KIF A;  3I55 Z;  3S1Q I;  4RS4 A;  3GCF A;  5FLX f;  2Y4N A;  5GTD A;  4WS9 A;  3CCL 1;  2VUG A;  2V8J A;  3F3P C;  3CMA 1;  2V7B A;  3AF5 A;  5IT9 b;  4BC9 A;  5K8F A;  3S17 I;  3JAM D;  2VPW A;  2D1T A;  4JI6 C;  3JAM b;  4FUT A;  4NBD A;  4IZ6 A;  4AYB A;  5T8T A;  3T1H C;  2BJO A;  1N32 C;  3J81 f;  4FTF A;  4RV9 A;  4BY1 I;  3PBK A;  1UKK A;  1HNX C;  3F3F C;  2GTI A;  2R6M A;  3G4S 1;  4BXX I;  2P2F A;  1HNW C;  2P2J A;  2DE5 A;  2F4M A;  1QVF Y;  2E2H I;  1Q81 1;  1K9M 1;  4NB8 A;  3IF8 A;  3G71 Z;  3GTM I;  1VQ7 1;  4NXM C;  4PRO C;  4ISB A;  3J80 f;  3IR7 A;  1RO4 A;  1M90 1;  4LFA C;  2ONF A;  2YX1 A;  1YJW Z;  4PUI A;  3L95 X;  1I6H I;  4DV1 C;  4ZLP A;  3E7X A;  4MD7 A;  2NAP A;  3CCV 1;  2VZE A;  3CCR Z;  4JI8 C;  1VQL Z;  2UUA C;  4GXR A;  3CQ2 A;  2V45 A;  5A1I A;  3NH5 A;  4DCS A;  3VNQ A;  2NVX I;  1NJI 1;  3A25 A;  1W2B Y;  3A9V A;  4RLQ A;  3S16 I;  4DR3 C;  4GXQ A;  4NBA A;  4A3I I;  2B63 I;  1TWG I;  2HU9 A;  2V3V A;  3CCJ Z;  1VQM 1;  4E30 A;  3O2E A;  3IEU A;  4LF8 C;  2UXB C;  4LFC C;  2JR6 A;  2GU2 A;  4D56 A;  2Y4O A;  1ML8 A;  4TNU A;  3GR0 A;  1MD9 A;  2OPL B;  3FQQ A;  4CL1 A;  4PUG A;  2AYD A;  2E8F A;  2BH1 X;  5FLX b;  1N8R 2;  1DL6 A;  1VQ4 1;  3HOU I;  2I3C A;  2D27 A;  4KHP C;  3UOW A;  5BSM A;  4DV5 C;  4AQY C;  3CXC Y;  3UX2 A;  1KD1 1;  1KC8 2;  1Q81 2;  1ZB9 A;  2QKD A;  2VPZ A;  1VQ9 Z;  3J81 b;  2M6N A;  3EER A;  5IT9 f;  2WD9 A;  5AE1 A;  1MXC A;  3NFZ A;  3JAM f;  5LMU C;  3PO3 I;  1ZH1 A;  3GKQ A;  4G1I A;  1TH5 A;  4IR7 A;  2JMO A;  5FLM I;  1WCJ A;  1PU1 A;  1UWD A;  2P2Q A;  3CCE 1;  3GR1 A;  3CC7 1;  4HGY A;  3C5E A;  4Y7N I;  1JJ2 Y;  2WB1 A;  3SO4 A;  1NY8 A;  3HOZ I;  2D1R A;  4DR2 C;  3RZD I;  1PG3 A;  4E33 A;  5AE3 A;  4DR7 C;  5D1P A;  1I3Q I;  2OTJ Z;  2QVY X;  3BG1 B;  1VQN 1;  4DV4 C;  2JIP A;  5IP7 I;  1NJI 2;  4I9F A;  1MKY A;  1QM4 A;  1VQ5 1;  3IX0 A;  1IBK C;  4LF9 C;  5H9U A;  1XNQ C;  3CME Z;  1Q82 2;  4RVH A;  1N36 C;  4EAT A;  2KDN A;  4QTT A;  3VMI A;  1SFO I;  2D1S A;  1O92 A;  1LQL A;  3NYR A;  2JA6 I;  4PHT A;  1KQS Y;  3TDE A;  5BUQ A;  2IZ3 A;  1RY2 A;  3CCL Z;  3ETO A;  3S82 A;  3CMA Z;  5BSR A;  1TWF I;  3K7A I;  3UEB A;  2PK7 A;  3CQ1 A;  4HGZ A;  4JI7 C;  4A3L I;  1IBL C;  4DG9 A;  3VMG A;  3LUS A;  3CCU 1;  2VPX A;  3LGX A;  2OTJ 1;  1Z03 A;  5C3E I;  1K73 2;  2P28 A;  3G4S Z;  4DR4 C;  1MDF A;  1QWI A;  3FCE A;  4DCV A;  3VTN A;  1XHJ A;  3CME 1;  2K5R A;  1VQ7 Z;  4BBS I;  4DV0 C;  1YIT 1;  2YAD A;  1O93 A;  5CM2 M;  1Q86 2;  1RQF A;  3RV2 A;  3CW8 X;  4OYC A;  4YHH C;  2CY1 A;  2OZK A;  1QVG Z;  4NXN C;  5CZV A;  1M1K 2;  4RVF A;  4GKK C;  1VQ8 1;  3CCV Z;  4K0K C;  4YY3 C;  5T64 A;  1K8A 1;  2QL8 A;  3HOV I;  1PG4 A;  2QRE B;  3CJE A;  2ASB A;  3T4N B;  1USP A;  2D7V A;  2QVZ X;  4RMN A;  5BR8 C;  4U5Y D;  1VQM Z;  3S2H I;  5AN9 F;  3HOX I;  2YWB A;  3N54 B;  2ZM6 C;  4BC7 A;  2DHM A;  3TR3 A;  1FJG C;  4MD9 A;  2ZAE B;  2P2B A;  4A3F I;  2KI7 B;  5CZX A;  4BBR I;  2P20 A;  1Z02 A;  4JM1 A;  1VQ4 Z;  1N34 C;  3D6W A;  2WP0 C;  4JI0 C;  2NCL A;  2P3Y A;  3LAX A;  1XMO C;  1QF8 A;  1WZN A;  1EGA A;  5IP9 I;  1P4E A;  2OPL A;  4FUQ A;  4EWC A;  4E32 A;  4LF4 C;  1SIW A;  4MD8 A;  3GTJ I;  3B7W A;  4LE5 A;  2OBV A;  4DV2 C;  1WW9 A;  2QW0 X;  2JA5 I;  2IZ4 A;  4LF7 C;  1V60 A;  1N33 C;  2UUC C;  1WCM I;  3CCE Z;  2W03 A;  3CC7 Z;  1N2F A;  3OW2 Y;  3NH4 A;  3DAY A;  5BSW A;  2R7Z I;  3K6R A;  1RLY A;  4K0B A;  2E2J I;  2QA4 1;  3NH8 A;  1YUA A;  4MH4 A;  1R9T I;  1YI2 1;  3A4I A;  3QWU A;  2P02 A;  3NI2 A;  4DR5 C;  1K8A 2;  1VQN Z;  4A93 I;  4RVG A;  4DQY B;  4DCU A;  4B3R C;  2MM9 A;  3CC2 1;  5A1G A;  1P9N A;  2QRC B;  1P7L A;  4D4I A;  2VQF C;  4TPS B;  5A2Q D;  2XR1 A;  3IPL A;  1K9M 2;  4DR1 C;  4D57 A;  1VQ5 Z;  1J5E C;  2D28 C;  4DV7 C;  1YIJ 1;  2NVY I;  5KYV A;  1WJ2 A;  3UX3 A;  2G2K A;  1I94 C;  4RM3 A;  2R93 I;  3HOW I;  1QYP A;  1M90 2;  3T1Y C;  3I56 1;  1FUG A;  3D2L A;  1NUI A;  1S7M A;  1KKG A;  5LMN C;  3H2T A;  4KTV A;  4X64 C;  1YUK A;  3OTO C;  2DPL A;  2HJG A;  4NFR A;  2JIQ A;  4A3D I;  3PRO C;  4B3T C;  3EED A;  3CCU Z;  3MZL B;  1L2F A;  4DK1 A;  2E8C A;  3NPD A;  2H85 A;  1XRA A;  2E9H A;  5JRH A;  1QVG Y;  1RO2 A;  1VQK 1;  3G7S A;  4L2Z A;  3ESW A;  2YWC A;  4E31 A;  2JS4 A;  2E0G A;  3NDI A;  4MRI A;  1YIT Z;  1TWH I;  2JMP A;  1XRB A;  2M5O A;  1VQP 1;  2JNY A;  3CCS 1;  2M5H A;  3CPW Z;  3I08 A;  3I07 A;  2WAQ A;  3TDH B;  1W2B Z;  3KIH A;  2CU6 A;  4NBH A;  3CCM 1;  3GTQ I;  1RG9 A;  3CW9 A;  3DLP X;  5BSU A;  1VQ8 Z;  1VLA A;  4E2Z A;  1KD1 2;  3AF6 A;  1HNZ C;  4DR6 C;  4LF6 C;  5A19 A;  4OXI A;  2OOY B;  1YJ9 1;  4NBC A;  2QLV B;  4MTN A;  2LIY A;  2OO4 A;  3RZO I;  2HHH C;  2AKL A;  2QRD B;  4A3E I;  1AA6 A;  2E7Z A;  1O9T A;  1YJN 1;  3HKZ A;  3KXW A; 
#chains in the Genus database with same CATH homology
 2V8K A;  4DV6 C;  2KPI A;  1WII A;  1K83 I;  1YHQ 1;  4JI3 C;  3HOY I;  3CQZ I;  3H3V J;  2VSQ A;  4A3M I;  4KTT A;  4MON A;  3EQ6 A;  3UZ0 A;  4JI2 C;  2K3R A;  4BY7 I;  3GTP I;  4DCT A;  5C4X I;  3G6E 1;  2QEX 1;  3GTL I;  3DHV A;  4RLF A;  3H0G I;  4B3M C;  2E8E A;  4X6A I;  2PRO A;  3GTG I;  4X66 C;  1VQ6 1;  3CC4 1;  1VQO 1;  2D1Q A;  4A3B I;  3CD6 1;  5IT9 D;  4DUZ C;  5D1O B;  2UXC C;  4NH1 C;  2VUM I;  1JWH C;  1MXA A;  3M3Y I;  3PES A;  4NOZ A;  3TE5 B;  1Y1V S;  1X3Z A;  2UUB C;  2QA4 Z;  4S1T A;  1RO0 A;  4A3J I;  2DE6 A;  1RNI A;  2GTH A;  2O4H A;  1S72 1;  2YU9 I;  2NVQ I;  4JI5 C;  1YI2 Z;  3GTO I;  5BST A;  1N8R 1;  4L7I A;  2OTL 1;  2V8I A;  3CC2 Z;  1KQS Z;  4DG8 A;  5E7Q A;  1LCI A;  3CCQ 1;  1KC8 1;  3S14 I;  4BSZ A;  2KZF A;  2PN2 A;  1YIJ Z;  3S1N I;  4LFB C;  3D9X A;  2CXC A;  3VNS A;  4DUY C;  1XMQ C;  3Q87 A;  1ZB8 A;  3J7A 4;  3I55 1;  3I56 Z;  1ULT A;  2EGT A;  2VQE C;  5AE2 A;  1I50 I;  3M4O I;  4NBB A;  4RVO A;  5KYT A;  3S1R I;  3R44 A;  1USP B;  2UXD C;  1X0T A;  5KEI A;  1PA4 A;  4XX2 A;  5C4J I;  3ETC A;  4DV3 C;  3FKI I;  3CPW Y;  1BA3 A;  3S15 I;  4DGL A;  1TFI A;  3FCC A;  5T67 A;  5A2Q b;  1VQK Z;  1O90 A;  4HPV A;  4RM2 A;  1HR0 C;  2F4V C;  3LNV A;  3G71 1;  2JUB A;  3L8C A;  1Q82 1;  4JI4 C;  5IWA C;  4B3S C;  1MXB A;  5K85 A;  4R1M A;  2LFU A;  3TUF A;  3R9X A;  4NDN A;  4RVD A;  3GKU A;  1VQP Z;  3IML A;  4R0M A;  3CCS Z;  2YCB A;  3VMH A;  3I4N I;  3S1M I;  2PM9 A;  1YJW 1;  1Q7Y 1;  4A3G I;  1V26 A;  4ZJZ A;  4G37 A;  5FLX D;  4E2X A;  3CCM Z;  3P5J B;  1QVF Z;  1X3W A;  5LL6 f;  1Y1W I;  2Y27 A;  1PFT A;  3VB9 A;  2E2I I;  4JV5 C;  5ADZ A;  3CCR 1;  3VNR A;  4X65 C;  1VQL 1;  2DYJ A;  1XNR C;  2DE7 A;  2OOX B;  2R92 I;  1WH9 A;  2O53 A;  4NB9 A;  1K73 1;  4WV3 A;  2RT9 A;  3J81 D;  3GTM S;  4NBF A;  5DV9 A;  1JOS A;  1YJ9 Z;  1T5H X;  2P2M A;  1TWC I;  5T8S A;  3A9U A;  4A3C I;  1YJ7 A;  1Z01 A;  3IFU A;  4I9G A;  4BBY A;  4GS5 A;  1YJN Z;  2PT7 G;  2VF1 A;  4OX9 C;  3CCJ 1;  3GTK I;  4GKJ C;  2QVX X;  3PO2 I;  2M48 A;  5BUR A;  2UU9 C;  1YHQ Z;  1Q86 1;  1KRL A;  2JA8 I;  3E7W A;  3I4M I;  1WF3 A;  1TWA I;  1NP6 A;  2QR1 B;  2Q51 A;  4L4Q A;  1L1O C;  3NDJ A;  3RG2 A;  5BUS A;  2NVT I;  1Y1V I;  3J80 b;  3N2Q A;  1M1K 1;  4QTU A;  2F4O A;  2AYA A;  1K0R A;  3MZK B;  2Y0S A;  4MXU A;  2J6A A;  3G6E Z;  2JA7 I;  2QEX Z;  3OW2 Z;  3BG0 B;  2RPR A;  2ATW A;  1VQ9 1;  4BCA A;  4ODJ A;  2HF1 A;  3MON A;  1VQ6 Z;  3CC4 Z;  1VQO Z;  5C44 I;  3CD6 Z;  4E2Y A;  4R1L A;  3NYQ A;  4E2W A;  2RHB A;  1IBM C;  3S2D I;  4HH4 A;  4RVN A;  1Q7Y 2;  2W04 A;  3CXC Z;  1MDB A;  1S72 Z;  2RIQ A;  5IFI A;  5BSV A;  1T5D X;  4JYA C;  4A3K I;  1V25 A;  5A2Q f;  1HH2 P;  5D1O A;  4D4G A;  2E7G A;  1AMU A;  3GPC A;  2OTL Z;  1GPM A;  4G36 A;  4Y52 I;  1NYE A;  4PZP A;  4NBE A;  4JI1 C;  4LF5 C;  2E5L C;  4NBG A;  3CCQ Z;  5T6B A;  3PO3 S;  3IEV A;  3TQI A;  3U50 C;  3FQM A;  2RBL A;  3J80 D;  2Q4Z A;  1JJ2 Z;  1XRC A;  3R9W A;  4X62 C;  2PMZ A;  3KIF A;  3I55 Z;  3S1Q I;  4RS4 A;  3GCF A;  5FLX f;  2Y4N A;  5GTD A;  4WS9 A;  3CCL 1;  2VUG A;  2V8J A;  3F3P C;  3CMA 1;  2V7B A;  3AF5 A;  5IT9 b;  4BC9 A;  5K8F A;  3S17 I;  3JAM D;  4JI6 C;  2D1T A;  3JAM b;  4FUT A;  4NBD A;  4IZ6 A;  4AYB A;  5T8T A;  3T1H C;  2BJO A;  1N32 C;  3J81 f;  4FTF A;  4RV9 A;  4BY1 I;  3PBK A;  1UKK A;  1HNX C;  3F3F C;  2GTI A;  2R6M A;  3G4S 1;  4BXX I;  2P2F A;  1HNW C;  2P2J A;  2DE5 A;  2F4M A;  1QVF Y;  2E2H I;  1Q81 1;  1K9M 1;  4NB8 A;  3IF8 A;  3G71 Z;  3GTM I;  1VQ7 1;  4NXM C;  4PRO C;  4ISB A;  3J80 f;  1RO4 A;  1M90 1;  4LFA C;  2ONF A;  1YJW Z;  3L95 X;  1I6H I;  4DV1 C;  4ZLP A;  3E7X A;  4MD7 A;  3CCV 1;  2VZE A;  3CCR Z;  4JI8 C;  1VQL Z;  2UUA C;  4GXR A;  5A1I A;  3NH5 A;  4DCS A;  3VNQ A;  2NVX I;  1NJI 1;  1W2B Y;  3A9V A;  4RLQ A;  3S16 I;  4DR3 C;  4GXQ A;  4NBA A;  4A3I I;  2B63 I;  1TWG I;  2HU9 A;  3CCJ Z;  1VQM 1;  4E30 A;  3IEU A;  4LF8 C;  2UXB C;  4LFC C;  2JR6 A;  2GU2 A;  4D56 A;  2Y4O A;  1ML8 A;  4TNU A;  3GR0 A;  1MD9 A;  2OPL B;  3FQQ A;  4CL1 A;  2E8F A;  2BH1 X;  5FLX b;  1N8R 2;  1DL6 A;  1VQ4 1;  3HOU I;  2I3C A;  2D27 A;  4KHP C;  3UOW A;  5BSM A;  4DV5 C;  4AQY C;  3CXC Y;  1KD1 1;  1KC8 2;  1Q81 2;  1ZB9 A;  2QKD A;  1VQ9 Z;  3J81 b;  2M6N A;  3EER A;  5IT9 f;  2WD9 A;  5AE1 A;  1MXC A;  3NFZ A;  3JAM f;  5LMU C;  3PO3 I;  1ZH1 A;  3GKQ A;  4G1I A;  4IR7 A;  2JMO A;  5FLM I;  2P2Q A;  3CCE 1;  3GR1 A;  3CC7 1;  4HGY A;  3C5E A;  4Y7N I;  1JJ2 Y;  2WB1 A;  3SO4 A;  3HOZ I;  2D1R A;  4DR2 C;  3RZD I;  1PG3 A;  4E33 A;  5AE3 A;  4DR7 C;  5D1P A;  1I3Q I;  2OTJ Z;  2QVY X;  3BG1 B;  1VQN 1;  4DV4 C;  5IP7 I;  1NJI 2;  4I9F A;  1MKY A;  1QM4 A;  1VQ5 1;  3IX0 A;  1IBK C;  4LF9 C;  5H9U A;  1XNQ C;  3CME Z;  1Q82 2;  4RVH A;  1N36 C;  4EAT A;  4QTT A;  3VMI A;  1SFO I;  2D1S A;  1O92 A;  1LQL A;  3NYR A;  2JA6 I;  4PHT A;  1KQS Y;  3TDE A;  5BUQ A;  2IZ3 A;  1RY2 A;  3CCL Z;  3ETO A;  3S82 A;  3CMA Z;  5BSR A;  1TWF I;  3K7A I;  2PK7 A;  4HGZ A;  4JI7 C;  4A3L I;  1IBL C;  4DG9 A;  3VMG A;  3LUS A;  3CCU 1;  3LGX A;  2OTJ 1;  1Z03 A;  5C3E I;  1K73 2;  2P28 A;  3G4S Z;  4DR4 C;  1MDF A;  1QWI A;  3FCE A;  4DCV A;  3VTN A;  3CME 1;  2K5R A;  1VQ7 Z;  4BBS I;  4DV0 C;  1YIT 1;  2YAD A;  1O93 A;  5CM2 M;  1Q86 2;  1RQF A;  3RV2 A;  3CW8 X;  4OYC A;  4YHH C;  2CY1 A;  2OZK A;  1QVG Z;  4NXN C;  5CZV A;  1M1K 2;  4RVF A;  4GKK C;  1VQ8 1;  3CCV Z;  4K0K C;  4YY3 C;  5T64 A;  1K8A 1;  2QL8 A;  3HOV I;  1PG4 A;  2QRE B;  3CJE A;  2ASB A;  3T4N B;  1USP A;  2D7V A;  2QVZ X;  4RMN A;  5BR8 C;  4U5Y D;  1VQM Z;  3S2H I;  5AN9 F;  3HOX I;  2YWB A;  3N54 B;  2ZM6 C;  4BC7 A;  1FJG C;  4MD9 A;  2ZAE B;  2P2B A;  4A3F I;  2KI7 B;  5CZX A;  4BBR I;  2P20 A;  1Z02 A;  4JM1 A;  1VQ4 Z;  1N34 C;  3D6W A;  2WP0 C;  4JI0 C;  2P3Y A;  3LAX A;  1XMO C;  1QF8 A;  1EGA A;  5IP9 I;  2OPL A;  4FUQ A;  4EWC A;  4E32 A;  4LF4 C;  4MD8 A;  3GTJ I;  3B7W A;  4LE5 A;  2OBV A;  4DV2 C;  1WW9 A;  2QW0 X;  2JA5 I;  2IZ4 A;  4LF7 C;  1N33 C;  2UUC C;  1WCM I;  3CCE Z;  2W03 A;  3CC7 Z;  1N2F A;  3OW2 Y;  3NH4 A;  3DAY A;  5BSW A;  2R7Z I;  1RLY A;  4K0B A;  2E2J I;  2QA4 1;  3NH8 A;  1YUA A;  4MH4 A;  1R9T I;  1YI2 1;  3A4I A;  3QWU A;  2P02 A;  3NI2 A;  4DR5 C;  1K8A 2;  1VQN Z;  4A93 I;  4RVG A;  4DQY B;  4DCU A;  4B3R C;  3CC2 1;  5A1G A;  1P9N A;  2QRC B;  1P7L A;  4D4I A;  2VQF C;  4TPS B;  5A2Q D;  2XR1 A;  3IPL A;  1K9M 2;  4DR1 C;  4D57 A;  1VQ5 Z;  1J5E C;  2D28 C;  4DV7 C;  1YIJ 1;  2NVY I;  5KYV A;  2G2K A;  1I94 C;  4RM3 A;  2R93 I;  3HOW I;  1QYP A;  1M90 2;  3T1Y C;  3I56 1;  1FUG A;  1NUI A;  1S7M A;  1KKG A;  5LMN C;  3H2T A;  4KTV A;  4X64 C;  1YUK A;  3OTO C;  2DPL A;  2HJG A;  4NFR A;  4A3D I;  3PRO C;  4B3T C;  3EED A;  3CCU Z;  3MZL B;  1L2F A;  4DK1 A;  2E8C A;  3NPD A;  2H85 A;  1XRA A;  2E9H A;  5JRH A;  1QVG Y;  1RO2 A;  1VQK 1;  3G7S A;  4L2Z A;  3ESW A;  2YWC A;  4E31 A;  2JS4 A;  2E0G A;  3NDI A;  4MRI A;  1YIT Z;  1TWH I;  2JMP A;  1XRB A;  1VQP 1;  2JNY A;  3CCS 1;  3CPW Z;  3I08 A;  3I07 A;  2WAQ A;  3TDH B;  1W2B Z;  3KIH A;  3DLP X;  4NBH A;  3CCM 1;  3GTQ I;  1RG9 A;  3CW9 A;  5BSU A;  1VQ8 Z;  1VLA A;  4E2Z A;  1KD1 2;  3AF6 A;  1HNZ C;  4DR6 C;  4LF6 C;  5A19 A;  4OXI A;  2OOY B;  1YJ9 1;  4NBC A;  2QLV B;  4MTN A;  2LIY A;  2OO4 A;  3RZO I;  2HHH C;  2AKL A;  2QRD B;  4A3E I;  1O9T A;  1YJN 1;  3HKZ A;  3KXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...