1ZB9A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
142
structure length
141
Chain Sequence
NSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
molecule keywords organic hydroperoxide resistance protein
total genus 34
structure length 141
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb9A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb9A02
3CQZI 1JOSA 1Y1WI 1UKKA 4JYAC 2JA7I 1K0RA 2UXCC 2OPLA 1Y1VI 4JI5C 4K0KC 4GKJC 2ATWA 5BR8C 3RZOI 1TWHI 1TWFI 3GCFA 4QTUA 5IP9I 3PO3S 4A3CI 2E8FA 4MTNA 1VLAA 4DV6C 3T1HC 3S16I 3FKII 1IBMC 1XNRC 1LQLA 4BY7I 1WH9A 1QYPA 4NBEA 2HHHC 2UUBC 1X3WA 1HNXC 1HNZC 2ONFA 3R9XA 2DE6A 2NVYI 4DV2C 1NYEA 4BSZA 4NBDA 3GTJI 4MH4A 3HOYI 2HF1A 1I94C 4LF9C 1J5EC 2R92I 2CXCA 3J80D 4DV5C 3GTMI 5FLXD 1WW9A 3VMIA 4LFAC 1WCMI 4NXNC 4DR4C 2UXDC 3S14I 1QWIA 2YCBA 4Y52I 2PN2A 4LFCC 5C3EI 3GTOI 1NUIA 3GTMS 3GTKI 4NBBA 4QTTA 4X64C 1SFOI 2UXBC 4JI4C 1RO4A 4DCUA 4YY3C 5LMUC 3GTQI 4A3FI 2QL8A 4X66C 1N36C 4A3GI 4OX9C 4NBCA 4GKKC 4DCVA 5IP7I 2E8CA 5C4JI 1KKGA 2E8EA 4DV7C 2D7VA 2B63I 4DR1C 3PO3I 4DV4C 4KHPC 1HNWC 3LUSA 4A93I 2E7GA 3AF6A 2VUMI 1ZB8A 4NB9A 2E2HI 5C4XI 5IT9D 4X62C 1IBLC 2JNYA 4LF6C 3VMHA 2E2II 1I6HI 4X6AI 3IEUA 1L2FA 2XR1A 4JI8C 3D6WA 3R9WA 4DV0C 4NB8A 4A3MI 4A3LI 4LFBC 1USPA 2F4MA 2UUCC 3M3YI 2E2JI 1USPB 3I4NI 3HOWI 2EGTA 2F4OA 4LF4C 3Q87A 3S2HI 2JA5I 3GTPI 3T1YC 1TWAI 4DV1C 2KPIA 4JI2C 3VMGA 2NVQI 2J6AA 4JI1C 1XMOC 3CJEA 5C44I 4A3BI 2VQEC 1L1OC 2ASBA 4BBRI 4AQYC 4DR5C 1HH2P 4DR6C 2PK7A 3JAMD 1XNQC 2NVXI 3GKUA 3H3VJ 4JI0C 1FJGC 1R9TI 1MKYA 5CM2M 3GKQA 2JS4A 4BBSI 4NBAA 1TWCI 2HJGA 2JA8I 4NBHA 1EGAA 3AF5A 4YHHC 4A3JI 1K83I 1PFTA 3OTOC 5LMNC 4B3TC 4LF5C 1TFIA 4B3MC 1X3ZA 1I50I 2VQFC 1YUAA 3RZDI 3HOVI 2DE5A 1I3QI 4BXXI 3VB9A 3M4OI 1PA4A 2PT7G 4JI3C 2JR6A 3HOUI 2YU9I 2ZM6C 2BJOA 2JMPA 1IBKC 4JI6C 1N32C 2K5RA 2NVTI 2DE7A 4A3DI 4A3KI 3S1MI 4A3II 4A3EI 2F4VC 5FLMI 4X65C 3K7AI 3S1NI 4DR2C 4BY1I 1N33C 2UUAC 4DUYC 2JA6I 4LF7C 4NOZA 2R7ZI 4B3SC 4JI7C 3GTGI 2RBLA 3HOXI 1HR0C 4B3RC 1ZB9A 3PO2I 3HOZI 4DV3C 4NBGA 3S2DI 3H0GI 1WF3A 4DUZC 4JV5C 2AKLA 2OPLB 3EERA 3J81D 4DR7C 2UU9C 1ML8A 4NXMC 1N2FA 3S17I 1DL6A 4DCSA 1Y1VS 5A2QD 4NBFA 4DR3C 1TWGI 1XMQC 2CY1A 2KZFA 4Y7NI 3S15I 3S1RI 4LF8C 3IEVA 2P3YA 1N34C 3U50C 2DYJA 1RLYA 3GTLI 3S1QI 4DCTA 2E5LC 2R93I 4XX2A 3I4MI 5IWAC 3I07A 3ESWA
chains in the Genus database with same CATH superfamily
1QXFA 2JA7I 2V8KA 2OPLA 2DPLA 1VQ9Z 2V3VA 5BR8C 2ATWA 1RO0A 1TWFI 3GCFA 3CCUZ 3PO3S 2E8FA 5BSWA 3S16I 3TE5B 1VQOZ 1VQMZ 2UUBC 4NBEA 2P02A 2QREB 1HNZC 2DE6A 4K0BA 2OTJZ 4NBDA 1WZNA 3GTJI 1Q7Y2 1QVGY 1VQ8Z 1RO2A 5LL6f 3J80D 3CCM1 5FLXD 4BBYA 1WW9A 4ZLPA 4LFAC 1Y8CA 1MD9A 1QWIA 4S1TA 4HGYA 2V7BA 4Y52I 5C3EI 3CPWY 1NUIA 2Q4ZA 1FDIA 4TNUA 2IV2X 4ZJZA 3UX3A 2UXBC 2OTL1 4OX9C 4GKKC 3J80f 3TDEA 4DCVA 1P9NA 2KDNA 2E8CA 5C4JI 4G36A 5IT9f 1V60A 1VQPZ 2Y4OA 2B63I 1JWHC 4DR1C 1XRBA 1Q16A 3L95X 4U5YD 1VQKZ 2E7GA 1IBLC 2E2HI 1N8R1 1K731 4X62C 2JNYA 3VMHA 1YJWZ 3G6E1 1QM4A 1QVGZ 1RY2A 1T5DX 3D6WA 3ETOA 3IEUA 1YITZ 3F3PC 4A3LI 3A25A 3KIHA 3HKZA 4RVFA 2PM9A 2V45A 3P5JB 2E2JI 3B7WA 2EGTA 2ZZNA 2F4OA 4HGZA 1KC81 1VQ51 3GTPI 4FUTA 5T6BA 4JI2C 4JI1C 2CU6A 5C44I 4RLFA 3S82A 1L1OC 5GTDA 4BBRI 3CW9A 3I55Z 4OXIA 5A1GA 1QVFZ 4EATA 1R9TI 1Z02A 1XRCA 2W04A 2E0GA 3MZKB 3A9UA 2JS4A 3T4NB 2HJGA 4DK1A 3NYQA 1VQ71 3G711 4ISBA 1TFIA 3CQ1A 3I551 2GTIA 5IT9b 3VNRA 3RZDI 2QLVB 1RQFA 3CCR1 1YJN1 2D1SA 4DV1C 1VQ6Z 4TPSB 5BUQA 2JMPA 2M5OA 5D1OA 3N54B 4GXRA 2NVTI 4E2ZA 4A3KI 2F4VC 3CD6Z 3BG1B 4CL1A 2MMAB 2R6MA 1MDBA 1VQ4Z 1O93A 4RVOA 3GTGI 4EWCA 2WB1A 1VQ41 2PMZA 2D28C 3PO2I 3H2TA 2JMOA 3OW2Y 1KC82 1YJW1 4FUQA 3O2EA 3CQ2A 1Q812 1ULTA 1N2FA 3S17I 1YUKA 2AYDA 4NBFA 4DR3C 2QR1B 3CCRZ 2JIOA 4Y7NI 1YJNZ 2CY1A 4LF8C 1Q861 5AE3A 2K3RA 2DYJA 3FQQA 3UX2A 1O92A 2E7ZA 3KIFA 4XX2A 3I4MI 5BSTA 3I07A 2YWCA 4D56A 1Y1WI 4E31A 2UXCC 1Y1VI 4K0KC 3DHVA 2NCLA 3I08A 1TWHI 3IEVA 1XNRC 4DV6C 3DLPX 3OW2Z 2OTJ1 3CQ3A 3A26A 2ONFA 2Q51A 4BSZA 4RV9A 1VQM1 4MH4A 3HOYI 4HPVA 1I94C 2P2JA 3CC7Z 4DV5C 3J81b 3CCJZ 2D27A 1RG9A 1VQ91 4I9GA 3CPWZ 3S14I 2JNVA 4E2YA 2P2MA 1FDOA 2QVZX 2M48A 3K6RA 5BSRA 3UOWA 4WS9A 4X64C 2P2QA 1SFOI 1W2BZ 5LMUC 1Q822 1MDFA 1VQP1 4E2WA 4E30A 3J81f 4D4GA 2OOXB 2D7VA 1PG4A 2VF1A 1XS3A 3PO3I 3NI2A 4IR7A 5ADZA 5A1IA 1HNWC 1N32C 3F3FC 5T67A 2VUMI 4NB9A 3AF6A 5IT9D 4LF6C 3DAYA 1YIJ1 1I6HI 3G7SA 2XR1A 4BCAA 1PG3A 4DV0C 3R9WA 2I3CA 3VNQA 1N36C 2F4MA 2UUCC 3M3YI 4MD9A 4RVGA 2QW0X 3GPCA 2RT9A 2KZ0A 4RVHA 3Q87A 3S2HI 1QF8A 2JA5I 5FLXb 4PUHA 1S7MA 1ZH1A 2KPIA 5FLXf 2NVQI 3CMAZ 1XMOC 1VQO1 2VQEC 4AQYC 3CCU1 4MD7A 1XNQC 1Q862 4JI0C 1FJGC 1X0TA 4E2XA 1PU1A 5T8TA 5CZVA 4BBSI 1YI21 1TWCI 1EGAA 4NBHA 3MONA 4RM2A 4RVNA 1IB8A 1PFTA 3NH5A 3OTOC 2MCQA 5LMNC 4D4IA 1Z03A 4JI3C 2DE5A 1I3QI 2OO4A 3VB9A 3M4OI 3VNSA 2ZM6C 4JI6C 3JAMf 3HOUI 3I56Z 3PESA 2K5RA 3CCV1 2RHBA 4NFRA 4A3DI 3NDJA 3S1MI 4WV3A 5AE2A 1K9M2 2WD9A 3CC41 1Q7Y1 2LIYA 2QA41 5D1PA 2MM9A 1M1K2 4DR2C 1YJ7A 4BY1I 3LGXA 2QVYX 3CCQ1 2E9HA 1GPMA 4JI7C 2JIPA 5H9UA 2JIRA 2QRCB 3LNOA 3S2DI 3H0GI 4AYBA 4FTFA 4PZPA 4JV5C 3UEBA 1YHQZ 3EERA 5BSUA 1Q821 1TH5A 1UWDA 1M902 2P20A 4DR7C 1M6XC 5JRHA 4LF4C 1Y1VS 2M5HA 5CZXA 2KZFA 1KRLA 3S1RI 4NH1C 3IPLA 3U50C 3GTLI 2QA4Z 4DCTA 3D2LA 2Z51A 5IWAC 1S721 2YWBA 1UKKA 2Y4NA 4MRIA 3UZ0A 1T5HX 4OYCA 1K0RA 1K8A1 3CW8X 1KD12 3RZOI 4QTUA 1KD11 5IP9I 3CCSZ 1VLAA 4MTNA 1LQLA 2VUGA 1WH9A 1HNXC 1S72Z 3R9XA 3CXCY 4DV2C 2NVYI 2VPXA 3ETCA 3IX0A 1M901 1JJ2Y 3FCCA 2HF1A 4LF9C 3IF8A 1NP6A 2R92I 1NY8A 2V8IA 2CXCA 2NAPA 2HU9A 3CCEZ 2P2BA 3GTMI 3VMIA 1WCMI 4NXNC 4RMNA 2BH1X 2PN2A 4LFCC 3GTOI 1WIIA 1XHJA 3GTKI 4NBBA 4JI4C 4DCUA 4E32A 4A3FI 2QL8A 2JUBA 3LAXA 4A3GI 4X66C 3E7XA 3G4S1 3C5EA 4D57A 3NFZA 1VQLZ 1LCIA 5BUSA 3RV2A 4BC7A 3CCQZ 4DV7C 5K8FA 3CC4Z 5BSMA 4JYAC 5A19A 4GKJC 1P4EA 3CCVZ 3TDHB 1JJ2Z 1MXAA 4RVDA 3L8CA 3CXCZ 1USPA 3A9VA 2OOYB 1VQN1 3EQ6A 4G37A 3NDIA 3IMLA 4RS4A 1N8R2 1WJ2A 3I4NI 5IFIA 1YI2Z 2WP0C 3T1YC 1TWAI 2V8JA 1Q811 3CJEA 2Y0SA 3IR7A 1NJI2 2ASBA 2RPRA 4DR5C 3CCJ1 1HH2P 4NDNA 3E7WA 3JAMD 2QEXZ 2NVXI 4GXQA 3H3VJ 3IFUA 2RIQA 3CME1 3CMA1 1MKYA 3A4IA 4KTTA 4PUIA 3GR1A 2QRDB 1V25A 4NBAA 3CMEZ 3AF5A 3AY0A 2QEX1 1I50I 1XRAA 3R44A 1QVFY 1IBKC 2YU9I 2BJOA 1YJ91 2D1QA 2DE7A 4IZ6A 3CC2Z 4A3EI 3PBKA 4DGLA 1AMUA 2DHMA 5FLMI 4X65C 4MD8A 2D1TA 1NJI1 1WCJA 4L2ZA 4JM1A 4NOZA 1MXCA 2VZEA 4PROC 2VPWA 4RLQA 4MONA 3HOXI 4B3RC 3HOZI 1WF3A 4DUZC 5AE1A 4RM3A 2AKLA 1M1K1 3CC21 2OPLB 5KEIA 2OZKA 2M6NA 1BA3A 3RG2A 2UU9C 4HH4A 1YJ9Z 3PROC 4NXMC 1DL6A 4DCSA 5A2QD 2QVXX 1TWGI 4L7IA 3S15I 3CC71 2P3YA 5BSVA 1VQL1 3CD61 2R93I 2G2KA 4DG9A 1HR0C 3CQZI 1JOSA 2WAQA 4DQYB 4JI5C 1VQ61 3NH4A 1FLOA 1VEHA 1W2BY 4A3CI 3CCE1 2LFUA 3T1HC 1IBMC 3FKII 4BY7I 3NPDA 1QYPA 2HHHC 1X3WA 2P2FA 1NYEA 5E7QA 1P7LA 1J5EC 2KI7B 1VQNZ 1V26A 2UXDC 4DR4C 2YCBA 4R1MA 1KQSZ 3GTMS 5T8SA 4QTTA 2D1RA 3D9XA 1RO4A 4YY3C 3GTQI 4E33A 1O90A 2IZ3A 4NBCA 1K8A2 5IP7I 3GR0A 2VSQA 3LNVA 3SO4A 2E8EA 1KKGA 3G4SZ 5LCIA 4DV4C 3G6EZ 4KHPC 3LUSA 3NH8A 4A93I 1ZB8A 4MXUA 1YHQ1 5AN9F 5C4XI 1VQK1 1K732 2E2II 4X6AI 2AYAA 1L2FA 2W03A 4R1LA 2H85A 1P4EC 4I9FA 1Z01A 4NB8A 4A3MI 1SIWA 4LFBC 2GTHA 3G71Z 1VQ7Z 2VPZA 1KQSY 1USPB 3HOWI 3J80b 5A2Qf 2VPYA 3VMGA 2J6AA 3QWUA 3MZLB 4LE5A 2PROA 2YADA 4A3BI 5DV9A 4BC9A 2O4HA 3CCS1 1M6XA 5D1OB 2IZ4A 1O9TA 4DR6C 2PK7A 2GU2A 3BG0B 3EEDA 1K9M1 3GKUA 5A2Qb 5KYVA 5CM2M 1AA6A 3J7A4 3GKQA 1VQ5Z 1MXBA 2JA8I 4YHHC 4DG8A 4A3JI 1K83I 4L4QA 4B3TC 4LF5C 4B3MC 1X3ZA 2VQFC 5KYTA 1YUAA 3TQIA 3HOVI 4BXXI 4PUGA 1PA4A 1RNIA 2PT7G 2JR6A 3FQMA 1YIT1 5K85A 4A3II 3VTNA 2O53A 3K7AI 3S1NI 4GS5A 1N33C 2QKDA 4R0MA 4DUYC 2JA6I 2UUAC 4LF7C 2R7ZI 4KTVA 4B3SC 4PHTA 2ZZMA 2RBLA 4ODJA 1ZB9A 4DV3C 4NBGA 3CCL1 1YIJZ 2OTLZ 2OBVA 3JAMb 2JIQA 2P28A 3J81D 3TR3A 3CCLZ 3I561 3FCEA 1ML8A 3KXWA 4JI8C 2JIMA 5T64A 1XMQC 4G1IA 3CCMZ 2LEXA 2Y27A 2YX1A 1VQ81 3N2QA 1N34C 1RLYA 5BURA 3S1QI 2E5LC 3NYRA 3TUFA 1FUGA 2ZAEB 3ESWA
chains in the Genus database with same CATH topology
2JA7I 2V8KA 2OPLA 2DPLA 1VQ9Z 2ATWA 5BR8C 1RO0A 1TWFI 3GCFA 3CCUZ 3PO3S 2E8FA 5BSWA 3S16I 3TE5B 1VQOZ 1VQMZ 2UUBC 4NBEA 2P02A 2QREB 1HNZC 2DE6A 4K0BA 2OTJZ 4NBDA 3GTJI 1Q7Y2 1QVGY 1VQ8Z 1RO2A 5LL6f 3J80D 3CCM1 5FLXD 4BBYA 1WW9A 4ZLPA 4LFAC 1MD9A 1QWIA 4S1TA 4HGYA 2V7BA 4Y52I 5C3EI 3CPWY 1NUIA 2Q4ZA 4TNUA 4ZJZA 2UXBC 2OTL1 4OX9C 4GKKC 3J80f 3TDEA 4DCVA 1P9NA 2E8CA 5C4JI 4G36A 5IT9f 1VQPZ 2Y4OA 2B63I 1JWHC 4DR1C 1XRBA 3L95X 4U5YD 1VQKZ 2E7GA 1IBLC 2E2HI 1N8R1 1K731 4X62C 2JNYA 3VMHA 1YJWZ 3G6E1 1QM4A 1QVGZ 1RY2A 1T5DX 3D6WA 3ETOA 3IEUA 1YITZ 3F3PC 4A3LI 3KIHA 3HKZA 4RVFA 2PM9A 3P5JB 2E2JI 3B7WA 2EGTA 2F4OA 4HGZA 1KC81 1VQ51 3GTPI 4FUTA 5T6BA 4JI2C 4JI1C 5C44I 4RLFA 3S82A 1L1OC 5GTDA 4BBRI 3CW9A 3I55Z 4OXIA 5A1GA 1QVFZ 4EATA 1R9TI 1Z02A 1XRCA 2W04A 2E0GA 3MZKB 3A9UA 2JS4A 3T4NB 2HJGA 4DK1A 3NYQA 1VQ71 3G711 4ISBA 1TFIA 3I551 2GTIA 5IT9b 3VNRA 3RZDI 2QLVB 1RQFA 3CCR1 1YJN1 2D1SA 4DV1C 1VQ6Z 4TPSB 5BUQA 2JMPA 5D1OA 3N54B 4GXRA 2NVTI 4E2ZA 4A3KI 2F4VC 3CD6Z 3BG1B 4CL1A 2R6MA 1MDBA 1VQ4Z 1O93A 4RVOA 3GTGI 4EWCA 2WB1A 1VQ41 2PMZA 2D28C 3PO2I 3H2TA 2JMOA 3OW2Y 1KC82 1YJW1 4FUQA 1Q812 1ULTA 1N2FA 3S17I 1YUKA 4DR3C 4NBFA 2QR1B 3CCRZ 1YJNZ 4Y7NI 2CY1A 4LF8C 1Q861 5AE3A 2K3RA 2DYJA 3FQQA 1O92A 3KIFA 4XX2A 3I4MI 5BSTA 3I07A 2YWCA 4D56A 1Y1WI 4E31A 2UXCC 1Y1VI 4K0KC 3DHVA 3I08A 1TWHI 3IEVA 1XNRC 4DV6C 3DLPX 3OW2Z 2OTJ1 2ONFA 2Q51A 4BSZA 4RV9A 1VQM1 4MH4A 3HOYI 4HPVA 1I94C 2P2JA 3CC7Z 4DV5C 3J81b 3CCJZ 2D27A 1RG9A 1VQ91 4I9GA 3CPWZ 3S14I 2QVZX 4E2YA 2P2MA 2M48A 5BSRA 3UOWA 4WS9A 4X64C 2P2QA 1SFOI 1W2BZ 5LMUC 1Q822 1MDFA 1VQP1 4E2WA 4E30A 3J81f 4D4GA 2OOXB 2D7VA 1PG4A 2VF1A 3PO3I 3NI2A 4IR7A 5ADZA 5A1IA 1HNWC 1N32C 3F3FC 5T67A 2VUMI 4NB9A 3AF6A 5IT9D 4LF6C 3DAYA 1YIJ1 1I6HI 3G7SA 2XR1A 4BCAA 1PG3A 4DV0C 3R9WA 2I3CA 3VNQA 1N36C 2F4MA 2UUCC 3M3YI 4MD9A 4RVGA 2QW0X 3GPCA 2RT9A 4RVHA 3Q87A 3S2HI 1QF8A 2JA5I 5FLXb 1S7MA 1ZH1A 2KPIA 5FLXf 2NVQI 3CMAZ 1XMOC 1VQO1 2VQEC 4AQYC 3CCU1 4MD7A 1XNQC 1Q862 4JI0C 1FJGC 1X0TA 4E2XA 5T8TA 5CZVA 4BBSI 1YI21 1TWCI 1EGAA 4NBHA 3MONA 4RM2A 4RVNA 1PFTA 3NH5A 3OTOC 5LMNC 4D4IA 1Z03A 4JI3C 2DE5A 1I3QI 2OO4A 3VB9A 3M4OI 3VNSA 2ZM6C 4JI6C 3JAMf 3HOUI 3I56Z 3PESA 2K5RA 3CCV1 2RHBA 4NFRA 4A3DI 3NDJA 3S1MI 4WV3A 5AE2A 1K9M2 2WD9A 3CC41 1Q7Y1 2LIYA 2QA41 5D1PA 1M1K2 4DR2C 1YJ7A 4BY1I 3LGXA 2QVYX 3CCQ1 2E9HA 1GPMA 4JI7C 5H9UA 2QRCB 3S2DI 3H0GI 4AYBA 4FTFA 4PZPA 4JV5C 1YHQZ 3EERA 5BSUA 1Q821 2P20A 1M902 4DR7C 5JRHA 4LF4C 1Y1VS 5CZXA 2KZFA 1KRLA 3S1RI 4NH1C 3IPLA 3U50C 3GTLI 2QA4Z 4DCTA 5IWAC 1S721 2YWBA 1UKKA 4MRIA 3UZ0A 1T5HX 4OYCA 1K0RA 1K8A1 3CW8X 1KD12 3RZOI 4QTUA 1KD11 5IP9I 3CCSZ 1VLAA 4MTNA 1LQLA 2VUGA 1WH9A 1HNXC 1S72Z 3R9XA 3CXCY 4DV2C 2NVYI 3ETCA 3IX0A 1M901 1JJ2Y 3FCCA 2HF1A 4LF9C 3IF8A 1NP6A 2R92I 2Y4NA 2V8IA 2CXCA 2P2BA 2HU9A 3CCEZ 3GTMI 3VMIA 1WCMI 4NXNC 4RMNA 2BH1X 2PN2A 4LFCC 3GTOI 1WIIA 3GTKI 4NBBA 4JI4C 4DCUA 4E32A 4A3FI 2QL8A 2JUBA 3LAXA 4A3GI 4X66C 3E7XA 3G4S1 3C5EA 4D57A 3NFZA 1VQLZ 1LCIA 5BUSA 3RV2A 4BC7A 3CCQZ 4DV7C 5K8FA 3CC4Z 5BSMA 4JYAC 5A19A 4GKJC 3CCVZ 3TDHB 1JJ2Z 1MXAA 4RVDA 3L8CA 3CXCZ 1USPA 3A9VA 2OOYB 1VQN1 3EQ6A 4G37A 3NDIA 3IMLA 4RS4A 1N8R2 3I4NI 5IFIA 1YI2Z 2WP0C 3T1YC 1TWAI 2V8JA 1Q811 3CJEA 2Y0SA 1NJI2 2ASBA 2RPRA 4DR5C 3CCJ1 1HH2P 4NDNA 3E7WA 3JAMD 2QEXZ 2NVXI 4GXQA 3H3VJ 3IFUA 2RIQA 3CME1 3CMA1 1MKYA 3A4IA 4KTTA 3GR1A 2QRDB 1V25A 4NBAA 3CMEZ 3AF5A 2QEX1 1I50I 1XRAA 3R44A 1QVFY 1IBKC 2YU9I 2BJOA 1YJ91 2D1QA 2DE7A 4IZ6A 3CC2Z 4A3EI 3PBKA 4DGLA 1AMUA 5FLMI 4X65C 4MD8A 2D1TA 1NJI1 4PROC 4L2ZA 4JM1A 4NOZA 1MXCA 2VZEA 4RLQA 4MONA 3HOXI 4B3RC 3HOZI 1WF3A 4DUZC 5AE1A 4RM3A 2AKLA 1M1K1 3CC21 2OPLB 5KEIA 2OZKA 2M6NA 1BA3A 3RG2A 2UU9C 4HH4A 1YJ9Z 3PROC 4NXMC 1DL6A 4DCSA 5A2QD 2QVXX 1TWGI 4L7IA 3S15I 3CC71 2P3YA 5BSVA 1VQL1 3CD61 2R93I 2G2KA 4DG9A 1HR0C 3CQZI 1JOSA 2WAQA 4DQYB 4JI5C 1VQ61 3NH4A 1W2BY 4A3CI 3CCE1 2LFUA 3T1HC 1IBMC 3FKII 4BY7I 3NPDA 1QYPA 2HHHC 1X3WA 2P2FA 1NYEA 5E7QA 1P7LA 1J5EC 2KI7B 1VQNZ 1V26A 2UXDC 4DR4C 2YCBA 4R1MA 1KQSZ 3GTMS 5T8SA 4QTTA 2D1RA 3D9XA 1RO4A 4YY3C 3GTQI 4E33A 1O90A 2IZ3A 4NBCA 1K8A2 5IP7I 3GR0A 2VSQA 3LNVA 3SO4A 2E8EA 1KKGA 3G4SZ 4DV4C 3G6EZ 4KHPC 3LUSA 3NH8A 4A93I 1ZB8A 4MXUA 1YHQ1 5AN9F 5C4XI 1VQK1 1K732 2E2II 4X6AI 2AYAA 1L2FA 2W03A 4R1LA 2H85A 4I9FA 1Z01A 4NB8A 4A3MI 4LFBC 2GTHA 3G71Z 1VQ7Z 1KQSY 1USPB 3HOWI 3J80b 5A2Qf 3VMGA 2J6AA 3QWUA 3MZLB 4LE5A 2PROA 2YADA 4A3BI 5DV9A 4BC9A 2O4HA 3CCS1 5D1OB 2IZ4A 1O9TA 4DR6C 2PK7A 2GU2A 3BG0B 3EEDA 1K9M1 3GKUA 5A2Qb 5KYVA 5CM2M 3J7A4 3GKQA 1VQ5Z 1MXBA 2JA8I 4YHHC 4DG8A 4A3JI 1K83I 4L4QA 4B3TC 4LF5C 4B3MC 1X3ZA 2VQFC 5KYTA 1YUAA 3TQIA 3HOVI 4BXXI 1PA4A 1RNIA 2PT7G 2JR6A 3FQMA 1YIT1 5K85A 4A3II 3VTNA 2O53A 3K7AI 3S1NI 4GS5A 1N33C 2QKDA 4R0MA 4DUYC 2JA6I 2UUAC 4LF7C 2R7ZI 4KTVA 4B3SC 4PHTA 2RBLA 4ODJA 1ZB9A 4DV3C 4NBGA 3CCL1 1YIJZ 2OTLZ 2OBVA 3JAMb 2P28A 3J81D 3CCLZ 3I561 3FCEA 1ML8A 3KXWA 4JI8C 5T64A 1XMQC 4G1IA 3CCMZ 2Y27A 1VQ81 3N2QA 1N34C 1RLYA 5BURA 3S1QI 2E5LC 3NYRA 3TUFA 1FUGA 2ZAEB 3ESWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ I;  1JOS A;  1Y1W I;  1UKK A;  4JYA C;  2JA7 I;  1K0R A;  2UXC C;  2OPL A;  1Y1V I;  4JI5 C;  4K0K C;  4GKJ C;  2ATW A;  5BR8 C;  3RZO I;  1TWH I;  1TWF I;  3GCF A;  4QTU A;  5IP9 I;  3PO3 S;  4A3C I;  2E8F A;  4MTN A;  1VLA A;  4DV6 C;  3T1H C;  3S16 I;  3FKI I;  1IBM C;  1XNR C;  1LQL A;  4BY7 I;  1WH9 A;  1QYP A;  4NBE A;  2HHH C;  2UUB C;  1X3W A;  1HNX C;  1HNZ C;  2ONF A;  3R9X A;  2DE6 A;  2NVY I;  4DV2 C;  1NYE A;  4BSZ A;  4NBD A;  3GTJ I;  4MH4 A;  3HOY I;  2HF1 A;  1I94 C;  4LF9 C;  1J5E C;  2R92 I;  2CXC A;  3J80 D;  4DV5 C;  3GTM I;  5FLX D;  1WW9 A;  3VMI A;  4LFA C;  1WCM I;  4NXN C;  4DR4 C;  2UXD C;  3S14 I;  1QWI A;  2YCB A;  4Y52 I;  2PN2 A;  4LFC C;  5C3E I;  3GTO I;  1NUI A;  3GTM S;  3GTK I;  4NBB A;  4QTT A;  4X64 C;  1SFO I;  2UXB C;  4JI4 C;  1RO4 A;  4DCU A;  4YY3 C;  5LMU C;  3GTQ I;  4A3F I;  2QL8 A;  4X66 C;  1N36 C;  4A3G I;  4OX9 C;  4NBC A;  4GKK C;  4DCV A;  5IP7 I;  2E8C A;  5C4J I;  1KKG A;  2E8E A;  4DV7 C;  2D7V A;  2B63 I;  4DR1 C;  3PO3 I;  4DV4 C;  4KHP C;  1HNW C;  3LUS A;  4A93 I;  2E7G A;  3AF6 A;  2VUM I;  1ZB8 A;  4NB9 A;  2E2H I;  5C4X I;  5IT9 D;  4X62 C;  1IBL C;  2JNY A;  4LF6 C;  3VMH A;  2E2I I;  1I6H I;  4X6A I;  3IEU A;  1L2F A;  2XR1 A;  4JI8 C;  3D6W A;  3R9W A;  4DV0 C;  4NB8 A;  4A3M I;  4A3L I;  4LFB C;  1USP A;  2F4M A;  2UUC C;  3M3Y I;  2E2J I;  1USP B;  3I4N I;  3HOW I;  2EGT A;  2F4O A;  4LF4 C;  3Q87 A;  3S2H I;  2JA5 I;  3GTP I;  3T1Y C;  1TWA I;  4DV1 C;  2KPI A;  4JI2 C;  3VMG A;  2NVQ I;  2J6A A;  4JI1 C;  1XMO C;  3CJE A;  5C44 I;  4A3B I;  2VQE C;  1L1O C;  2ASB A;  4BBR I;  4AQY C;  4DR5 C;  1HH2 P;  4DR6 C;  2PK7 A;  3JAM D;  1XNQ C;  2NVX I;  3GKU A;  3H3V J;  4JI0 C;  1FJG C;  1R9T I;  1MKY A;  5CM2 M;  3GKQ A;  2JS4 A;  4BBS I;  4NBA A;  1TWC I;  2HJG A;  2JA8 I;  4NBH A;  1EGA A;  3AF5 A;  4YHH C;  4A3J I;  1K83 I;  1PFT A;  3OTO C;  5LMN C;  4B3T C;  4LF5 C;  1TFI A;  4B3M C;  1X3Z A;  1I50 I;  2VQF C;  1YUA A;  3RZD I;  3HOV I;  2DE5 A;  1I3Q I;  4BXX I;  3VB9 A;  3M4O I;  1PA4 A;  2PT7 G;  4JI3 C;  2JR6 A;  3HOU I;  2YU9 I;  2ZM6 C;  2BJO A;  2JMP A;  1IBK C;  4JI6 C;  1N32 C;  2K5R A;  2NVT I;  2DE7 A;  4A3D I;  4A3K I;  3S1M I;  4A3I I;  4A3E I;  2F4V C;  5FLM I;  4X65 C;  3K7A I;  3S1N I;  4DR2 C;  4BY1 I;  1N33 C;  2UUA C;  4DUY C;  2JA6 I;  4LF7 C;  4NOZ A;  2R7Z I;  4B3S C;  4JI7 C;  3GTG I;  2RBL A;  3HOX I;  1HR0 C;  4B3R C;  1ZB9 A;  3PO2 I;  3HOZ I;  4DV3 C;  4NBG A;  3S2D I;  3H0G I;  1WF3 A;  4DUZ C;  4JV5 C;  2AKL A;  2OPL B;  3EER A;  3J81 D;  4DR7 C;  2UU9 C;  1ML8 A;  4NXM C;  1N2F A;  3S17 I;  1DL6 A;  4DCS A;  1Y1V S;  5A2Q D;  4NBF A;  4DR3 C;  1TWG I;  1XMQ C;  2CY1 A;  2KZF A;  4Y7N I;  3S15 I;  3S1R I;  4LF8 C;  3IEV A;  2P3Y A;  1N34 C;  3U50 C;  2DYJ A;  1RLY A;  3GTL I;  3S1Q I;  4DCT A;  2E5L C;  2R93 I;  4XX2 A;  3I4M I;  5IWA C;  3I07 A;  3ESW A; 
#chains in the Genus database with same CATH topology
 1QXF A;  2JA7 I;  2V8K A;  2OPL A;  2DPL A;  1VQ9 Z;  2V3V A;  5BR8 C;  2ATW A;  1RO0 A;  1TWF I;  3GCF A;  3CCU Z;  3PO3 S;  2E8F A;  5BSW A;  3S16 I;  3TE5 B;  1VQO Z;  1VQM Z;  2UUB C;  4NBE A;  2P02 A;  2QRE B;  1HNZ C;  2DE6 A;  4K0B A;  2OTJ Z;  4NBD A;  1WZN A;  3GTJ I;  1Q7Y 2;  1QVG Y;  1VQ8 Z;  1RO2 A;  5LL6 f;  3J80 D;  3CCM 1;  5FLX D;  4BBY A;  1WW9 A;  4ZLP A;  4LFA C;  1Y8C A;  1MD9 A;  1QWI A;  4S1T A;  4HGY A;  2V7B A;  4Y52 I;  5C3E I;  3CPW Y;  1NUI A;  2Q4Z A;  1FDI A;  4TNU A;  2IV2 X;  4ZJZ A;  3UX3 A;  2UXB C;  2OTL 1;  4OX9 C;  4GKK C;  3J80 f;  3TDE A;  4DCV A;  1P9N A;  2KDN A;  2E8C A;  5C4J I;  4G36 A;  5IT9 f;  1V60 A;  1VQP Z;  2Y4O A;  2B63 I;  1JWH C;  4DR1 C;  1XRB A;  1Q16 A;  3L95 X;  4U5Y D;  1VQK Z;  2E7G A;  1IBL C;  2E2H I;  1N8R 1;  1K73 1;  4X62 C;  2JNY A;  3VMH A;  1YJW Z;  3G6E 1;  1QM4 A;  1QVG Z;  1RY2 A;  1T5D X;  3D6W A;  3ETO A;  3IEU A;  1YIT Z;  3F3P C;  4A3L I;  3A25 A;  3KIH A;  3HKZ A;  4RVF A;  2PM9 A;  2V45 A;  3P5J B;  2E2J I;  3B7W A;  2EGT A;  2ZZN A;  2F4O A;  4HGZ A;  1KC8 1;  1VQ5 1;  3GTP I;  4FUT A;  5T6B A;  4JI2 C;  4JI1 C;  2CU6 A;  5C44 I;  4RLF A;  3S82 A;  1L1O C;  5GTD A;  4BBR I;  3CW9 A;  3I55 Z;  4OXI A;  5A1G A;  1QVF Z;  4EAT A;  1R9T I;  1Z02 A;  1XRC A;  2W04 A;  2E0G A;  3MZK B;  3A9U A;  2JS4 A;  3T4N B;  2HJG A;  4DK1 A;  3NYQ A;  1VQ7 1;  3G71 1;  4ISB A;  1TFI A;  3CQ1 A;  3I55 1;  2GTI A;  5IT9 b;  3VNR A;  3RZD I;  2QLV B;  1RQF A;  3CCR 1;  1YJN 1;  2D1S A;  4DV1 C;  1VQ6 Z;  4TPS B;  5BUQ A;  2JMP A;  2M5O A;  5D1O A;  3N54 B;  4GXR A;  2NVT I;  4E2Z A;  4A3K I;  2F4V C;  3CD6 Z;  3BG1 B;  4CL1 A;  2MMA B;  2R6M A;  1MDB A;  1VQ4 Z;  1O93 A;  4RVO A;  3GTG I;  4EWC A;  2WB1 A;  1VQ4 1;  2PMZ A;  2D28 C;  3PO2 I;  3H2T A;  2JMO A;  3OW2 Y;  1KC8 2;  1YJW 1;  4FUQ A;  3O2E A;  3CQ2 A;  1Q81 2;  1ULT A;  1N2F A;  3S17 I;  1YUK A;  2AYD A;  4NBF A;  4DR3 C;  2QR1 B;  3CCR Z;  2JIO A;  4Y7N I;  1YJN Z;  2CY1 A;  4LF8 C;  1Q86 1;  5AE3 A;  2K3R A;  2DYJ A;  3FQQ A;  3UX2 A;  1O92 A;  2E7Z A;  3KIF A;  4XX2 A;  3I4M I;  5BST A;  3I07 A;  2YWC A;  4D56 A;  1Y1W I;  4E31 A;  2UXC C;  1Y1V I;  4K0K C;  3DHV A;  2NCL A;  3I08 A;  1TWH I;  3IEV A;  1XNR C;  4DV6 C;  3DLP X;  3OW2 Z;  2OTJ 1;  3CQ3 A;  3A26 A;  2ONF A;  2Q51 A;  4BSZ A;  4RV9 A;  1VQM 1;  4MH4 A;  3HOY I;  4HPV A;  1I94 C;  2P2J A;  3CC7 Z;  4DV5 C;  3J81 b;  3CCJ Z;  2D27 A;  1RG9 A;  1VQ9 1;  4I9G A;  3CPW Z;  3S14 I;  2JNV A;  4E2Y A;  2P2M A;  1FDO A;  2QVZ X;  2M48 A;  3K6R A;  5BSR A;  3UOW A;  4WS9 A;  4X64 C;  2P2Q A;  1SFO I;  1W2B Z;  5LMU C;  1Q82 2;  1MDF A;  1VQP 1;  4E2W A;  4E30 A;  3J81 f;  4D4G A;  2OOX B;  2D7V A;  1PG4 A;  2VF1 A;  1XS3 A;  3PO3 I;  3NI2 A;  4IR7 A;  5ADZ A;  5A1I A;  1HNW C;  1N32 C;  3F3F C;  5T67 A;  2VUM I;  4NB9 A;  3AF6 A;  5IT9 D;  4LF6 C;  3DAY A;  1YIJ 1;  1I6H I;  3G7S A;  2XR1 A;  4BCA A;  1PG3 A;  4DV0 C;  3R9W A;  2I3C A;  3VNQ A;  1N36 C;  2F4M A;  2UUC C;  3M3Y I;  4MD9 A;  4RVG A;  2QW0 X;  3GPC A;  2RT9 A;  2KZ0 A;  4RVH A;  3Q87 A;  3S2H I;  1QF8 A;  2JA5 I;  5FLX b;  4PUH A;  1S7M A;  1ZH1 A;  2KPI A;  5FLX f;  2NVQ I;  3CMA Z;  1XMO C;  1VQO 1;  2VQE C;  4AQY C;  3CCU 1;  4MD7 A;  1XNQ C;  1Q86 2;  4JI0 C;  1FJG C;  1X0T A;  4E2X A;  1PU1 A;  5T8T A;  5CZV A;  4BBS I;  1YI2 1;  1TWC I;  1EGA A;  4NBH A;  3MON A;  4RM2 A;  4RVN A;  1IB8 A;  1PFT A;  3NH5 A;  3OTO C;  2MCQ A;  5LMN C;  4D4I A;  1Z03 A;  4JI3 C;  2DE5 A;  1I3Q I;  2OO4 A;  3VB9 A;  3M4O I;  3VNS A;  2ZM6 C;  4JI6 C;  3JAM f;  3HOU I;  3I56 Z;  3PES A;  2K5R A;  3CCV 1;  2RHB A;  4NFR A;  4A3D I;  3NDJ A;  3S1M I;  4WV3 A;  5AE2 A;  1K9M 2;  2WD9 A;  3CC4 1;  1Q7Y 1;  2LIY A;  2QA4 1;  5D1P A;  2MM9 A;  1M1K 2;  4DR2 C;  1YJ7 A;  4BY1 I;  3LGX A;  2QVY X;  3CCQ 1;  2E9H A;  1GPM A;  4JI7 C;  2JIP A;  5H9U A;  2JIR A;  2QRC B;  3LNO A;  3S2D I;  3H0G I;  4AYB A;  4FTF A;  4PZP A;  4JV5 C;  3UEB A;  1YHQ Z;  3EER A;  5BSU A;  1Q82 1;  1TH5 A;  1UWD A;  1M90 2;  2P20 A;  4DR7 C;  1M6X C;  5JRH A;  4LF4 C;  1Y1V S;  2M5H A;  5CZX A;  2KZF A;  1KRL A;  3S1R I;  4NH1 C;  3IPL A;  3U50 C;  3GTL I;  2QA4 Z;  4DCT A;  3D2L A;  2Z51 A;  5IWA C;  1S72 1;  2YWB A;  1UKK A;  2Y4N A;  4MRI A;  3UZ0 A;  1T5H X;  4OYC A;  1K0R A;  1K8A 1;  3CW8 X;  1KD1 2;  3RZO I;  4QTU A;  1KD1 1;  5IP9 I;  3CCS Z;  1VLA A;  4MTN A;  1LQL A;  2VUG A;  1WH9 A;  1HNX C;  1S72 Z;  3R9X A;  3CXC Y;  4DV2 C;  2NVY I;  2VPX A;  3ETC A;  3IX0 A;  1M90 1;  1JJ2 Y;  3FCC A;  2HF1 A;  4LF9 C;  3IF8 A;  1NP6 A;  2R92 I;  1NY8 A;  2V8I A;  2CXC A;  2NAP A;  2HU9 A;  3CCE Z;  2P2B A;  3GTM I;  3VMI A;  1WCM I;  4NXN C;  4RMN A;  2BH1 X;  2PN2 A;  4LFC C;  3GTO I;  1WII A;  1XHJ A;  3GTK I;  4NBB A;  4JI4 C;  4DCU A;  4E32 A;  4A3F I;  2QL8 A;  2JUB A;  3LAX A;  4A3G I;  4X66 C;  3E7X A;  3G4S 1;  3C5E A;  4D57 A;  3NFZ A;  1VQL Z;  1LCI A;  5BUS A;  3RV2 A;  4BC7 A;  3CCQ Z;  4DV7 C;  5K8F A;  3CC4 Z;  5BSM A;  4JYA C;  5A19 A;  4GKJ C;  1P4E A;  3CCV Z;  3TDH B;  1JJ2 Z;  1MXA A;  4RVD A;  3L8C A;  3CXC Z;  1USP A;  3A9V A;  2OOY B;  1VQN 1;  3EQ6 A;  4G37 A;  3NDI A;  3IML A;  4RS4 A;  1N8R 2;  1WJ2 A;  3I4N I;  5IFI A;  1YI2 Z;  2WP0 C;  3T1Y C;  1TWA I;  2V8J A;  1Q81 1;  3CJE A;  2Y0S A;  3IR7 A;  1NJI 2;  2ASB A;  2RPR A;  4DR5 C;  3CCJ 1;  1HH2 P;  4NDN A;  3E7W A;  3JAM D;  2QEX Z;  2NVX I;  4GXQ A;  3H3V J;  3IFU A;  2RIQ A;  3CME 1;  3CMA 1;  1MKY A;  3A4I A;  4KTT A;  4PUI A;  3GR1 A;  2QRD B;  1V25 A;  4NBA A;  3CME Z;  3AF5 A;  3AY0 A;  2QEX 1;  1I50 I;  1XRA A;  3R44 A;  1QVF Y;  1IBK C;  2YU9 I;  2BJO A;  1YJ9 1;  2D1Q A;  2DE7 A;  4IZ6 A;  3CC2 Z;  4A3E I;  3PBK A;  4DGL A;  1AMU A;  2DHM A;  5FLM I;  4X65 C;  4MD8 A;  2D1T A;  1NJI 1;  1WCJ A;  4L2Z A;  4JM1 A;  4NOZ A;  1MXC A;  2VZE A;  4PRO C;  2VPW A;  4RLQ A;  4MON A;  3HOX I;  4B3R C;  3HOZ I;  1WF3 A;  4DUZ C;  5AE1 A;  4RM3 A;  2AKL A;  1M1K 1;  3CC2 1;  2OPL B;  5KEI A;  2OZK A;  2M6N A;  1BA3 A;  3RG2 A;  2UU9 C;  4HH4 A;  1YJ9 Z;  3PRO C;  4NXM C;  1DL6 A;  4DCS A;  5A2Q D;  2QVX X;  1TWG I;  4L7I A;  3S15 I;  3CC7 1;  2P3Y A;  5BSV A;  1VQL 1;  3CD6 1;  2R93 I;  2G2K A;  4DG9 A;  1HR0 C;  3CQZ I;  1JOS A;  2WAQ A;  4DQY B;  4JI5 C;  1VQ6 1;  3NH4 A;  1FLO A;  1VEH A;  1W2B Y;  4A3C I;  3CCE 1;  2LFU A;  3T1H C;  1IBM C;  3FKI I;  4BY7 I;  3NPD A;  1QYP A;  2HHH C;  1X3W A;  2P2F A;  1NYE A;  5E7Q A;  1P7L A;  1J5E C;  2KI7 B;  1VQN Z;  1V26 A;  2UXD C;  4DR4 C;  2YCB A;  4R1M A;  1KQS Z;  3GTM S;  5T8S A;  4QTT A;  2D1R A;  3D9X A;  1RO4 A;  4YY3 C;  3GTQ I;  4E33 A;  1O90 A;  2IZ3 A;  4NBC A;  1K8A 2;  5IP7 I;  3GR0 A;  2VSQ A;  3LNV A;  3SO4 A;  2E8E A;  1KKG A;  3G4S Z;  5LCI A;  4DV4 C;  3G6E Z;  4KHP C;  3LUS A;  3NH8 A;  4A93 I;  1ZB8 A;  4MXU A;  1YHQ 1;  5AN9 F;  5C4X I;  1VQK 1;  1K73 2;  2E2I I;  4X6A I;  2AYA A;  1L2F A;  2W03 A;  4R1L A;  2H85 A;  1P4E C;  4I9F A;  1Z01 A;  4NB8 A;  4A3M I;  1SIW A;  4LFB C;  2GTH A;  3G71 Z;  1VQ7 Z;  2VPZ A;  1KQS Y;  1USP B;  3HOW I;  3J80 b;  5A2Q f;  2VPY A;  3VMG A;  2J6A A;  3QWU A;  3MZL B;  4LE5 A;  2PRO A;  2YAD A;  4A3B I;  5DV9 A;  4BC9 A;  2O4H A;  3CCS 1;  1M6X A;  5D1O B;  2IZ4 A;  1O9T A;  4DR6 C;  2PK7 A;  2GU2 A;  3BG0 B;  3EED A;  1K9M 1;  3GKU A;  5A2Q b;  5KYV A;  5CM2 M;  1AA6 A;  3J7A 4;  3GKQ A;  1VQ5 Z;  1MXB A;  2JA8 I;  4YHH C;  4DG8 A;  4A3J I;  1K83 I;  4L4Q A;  4B3T C;  4LF5 C;  4B3M C;  1X3Z A;  2VQF C;  5KYT A;  1YUA A;  3TQI A;  3HOV I;  4BXX I;  4PUG A;  1PA4 A;  1RNI A;  2PT7 G;  2JR6 A;  3FQM A;  1YIT 1;  5K85 A;  4A3I I;  3VTN A;  2O53 A;  3K7A I;  3S1N I;  4GS5 A;  1N33 C;  2QKD A;  4R0M A;  4DUY C;  2JA6 I;  2UUA C;  4LF7 C;  2R7Z I;  4KTV A;  4B3S C;  4PHT A;  2ZZM A;  2RBL A;  4ODJ A;  1ZB9 A;  4DV3 C;  4NBG A;  3CCL 1;  1YIJ Z;  2OTL Z;  2OBV A;  3JAM b;  2JIQ A;  2P28 A;  3J81 D;  3TR3 A;  3CCL Z;  3I56 1;  3FCE A;  1ML8 A;  3KXW A;  4JI8 C;  2JIM A;  5T64 A;  1XMQ C;  4G1I A;  3CCM Z;  2LEX A;  2Y27 A;  2YX1 A;  1VQ8 1;  3N2Q A;  1N34 C;  1RLY A;  5BUR A;  3S1Q I;  2E5L C;  3NYR A;  3TUF A;  1FUG A;  2ZAE B;  3ESW A; 
#chains in the Genus database with same CATH homology
 2JA7 I;  2V8K A;  2OPL A;  2DPL A;  1VQ9 Z;  2ATW A;  5BR8 C;  1RO0 A;  1TWF I;  3GCF A;  3CCU Z;  3PO3 S;  2E8F A;  5BSW A;  3S16 I;  3TE5 B;  1VQO Z;  1VQM Z;  2UUB C;  4NBE A;  2P02 A;  2QRE B;  1HNZ C;  2DE6 A;  4K0B A;  2OTJ Z;  4NBD A;  3GTJ I;  1Q7Y 2;  1QVG Y;  1VQ8 Z;  1RO2 A;  5LL6 f;  3J80 D;  3CCM 1;  5FLX D;  4BBY A;  1WW9 A;  4ZLP A;  4LFA C;  1MD9 A;  1QWI A;  4S1T A;  4HGY A;  2V7B A;  4Y52 I;  5C3E I;  3CPW Y;  1NUI A;  2Q4Z A;  4TNU A;  4ZJZ A;  2UXB C;  2OTL 1;  4OX9 C;  4GKK C;  3J80 f;  3TDE A;  4DCV A;  1P9N A;  2E8C A;  5C4J I;  4G36 A;  5IT9 f;  1VQP Z;  2Y4O A;  2B63 I;  1JWH C;  4DR1 C;  1XRB A;  3L95 X;  4U5Y D;  1VQK Z;  2E7G A;  1IBL C;  2E2H I;  1N8R 1;  1K73 1;  4X62 C;  2JNY A;  3VMH A;  1YJW Z;  3G6E 1;  1QM4 A;  1QVG Z;  1RY2 A;  1T5D X;  3D6W A;  3ETO A;  3IEU A;  1YIT Z;  3F3P C;  4A3L I;  3KIH A;  3HKZ A;  4RVF A;  2PM9 A;  3P5J B;  2E2J I;  3B7W A;  2EGT A;  2F4O A;  4HGZ A;  1KC8 1;  1VQ5 1;  3GTP I;  4FUT A;  5T6B A;  4JI2 C;  4JI1 C;  5C44 I;  4RLF A;  3S82 A;  1L1O C;  5GTD A;  4BBR I;  3CW9 A;  3I55 Z;  4OXI A;  5A1G A;  1QVF Z;  4EAT A;  1R9T I;  1Z02 A;  1XRC A;  2W04 A;  2E0G A;  3MZK B;  3A9U A;  2JS4 A;  3T4N B;  2HJG A;  4DK1 A;  3NYQ A;  1VQ7 1;  3G71 1;  4ISB A;  1TFI A;  3I55 1;  2GTI A;  5IT9 b;  3VNR A;  3RZD I;  2QLV B;  1RQF A;  3CCR 1;  1YJN 1;  2D1S A;  4DV1 C;  1VQ6 Z;  4TPS B;  5BUQ A;  2JMP A;  5D1O A;  3N54 B;  4GXR A;  2NVT I;  4E2Z A;  4A3K I;  2F4V C;  3CD6 Z;  3BG1 B;  4CL1 A;  2R6M A;  1MDB A;  1VQ4 Z;  1O93 A;  4RVO A;  3GTG I;  4EWC A;  2WB1 A;  1VQ4 1;  2PMZ A;  2D28 C;  3PO2 I;  3H2T A;  2JMO A;  3OW2 Y;  1KC8 2;  1YJW 1;  4FUQ A;  1Q81 2;  1ULT A;  1N2F A;  3S17 I;  1YUK A;  4DR3 C;  4NBF A;  2QR1 B;  3CCR Z;  1YJN Z;  4Y7N I;  2CY1 A;  4LF8 C;  1Q86 1;  5AE3 A;  2K3R A;  2DYJ A;  3FQQ A;  1O92 A;  3KIF A;  4XX2 A;  3I4M I;  5BST A;  3I07 A;  2YWC A;  4D56 A;  1Y1W I;  4E31 A;  2UXC C;  1Y1V I;  4K0K C;  3DHV A;  3I08 A;  1TWH I;  3IEV A;  1XNR C;  4DV6 C;  3DLP X;  3OW2 Z;  2OTJ 1;  2ONF A;  2Q51 A;  4BSZ A;  4RV9 A;  1VQM 1;  4MH4 A;  3HOY I;  4HPV A;  1I94 C;  2P2J A;  3CC7 Z;  4DV5 C;  3J81 b;  3CCJ Z;  2D27 A;  1RG9 A;  1VQ9 1;  4I9G A;  3CPW Z;  3S14 I;  2QVZ X;  4E2Y A;  2P2M A;  2M48 A;  5BSR A;  3UOW A;  4WS9 A;  4X64 C;  2P2Q A;  1SFO I;  1W2B Z;  5LMU C;  1Q82 2;  1MDF A;  1VQP 1;  4E2W A;  4E30 A;  3J81 f;  4D4G A;  2OOX B;  2D7V A;  1PG4 A;  2VF1 A;  3PO3 I;  3NI2 A;  4IR7 A;  5ADZ A;  5A1I A;  1HNW C;  1N32 C;  3F3F C;  5T67 A;  2VUM I;  4NB9 A;  3AF6 A;  5IT9 D;  4LF6 C;  3DAY A;  1YIJ 1;  1I6H I;  3G7S A;  2XR1 A;  4BCA A;  1PG3 A;  4DV0 C;  3R9W A;  2I3C A;  3VNQ A;  1N36 C;  2F4M A;  2UUC C;  3M3Y I;  4MD9 A;  4RVG A;  2QW0 X;  3GPC A;  2RT9 A;  4RVH A;  3Q87 A;  3S2H I;  1QF8 A;  2JA5 I;  5FLX b;  1S7M A;  1ZH1 A;  2KPI A;  5FLX f;  2NVQ I;  3CMA Z;  1XMO C;  1VQO 1;  2VQE C;  4AQY C;  3CCU 1;  4MD7 A;  1XNQ C;  1Q86 2;  4JI0 C;  1FJG C;  1X0T A;  4E2X A;  5T8T A;  5CZV A;  4BBS I;  1YI2 1;  1TWC I;  1EGA A;  4NBH A;  3MON A;  4RM2 A;  4RVN A;  1PFT A;  3NH5 A;  3OTO C;  5LMN C;  4D4I A;  1Z03 A;  4JI3 C;  2DE5 A;  1I3Q I;  2OO4 A;  3VB9 A;  3M4O I;  3VNS A;  2ZM6 C;  4JI6 C;  3JAM f;  3HOU I;  3I56 Z;  3PES A;  2K5R A;  3CCV 1;  2RHB A;  4NFR A;  4A3D I;  3NDJ A;  3S1M I;  4WV3 A;  5AE2 A;  1K9M 2;  2WD9 A;  3CC4 1;  1Q7Y 1;  2LIY A;  2QA4 1;  5D1P A;  1M1K 2;  4DR2 C;  1YJ7 A;  4BY1 I;  3LGX A;  2QVY X;  3CCQ 1;  2E9H A;  1GPM A;  4JI7 C;  5H9U A;  2QRC B;  3S2D I;  3H0G I;  4AYB A;  4FTF A;  4PZP A;  4JV5 C;  1YHQ Z;  3EER A;  5BSU A;  1Q82 1;  2P20 A;  1M90 2;  4DR7 C;  5JRH A;  4LF4 C;  1Y1V S;  5CZX A;  2KZF A;  1KRL A;  3S1R I;  4NH1 C;  3IPL A;  3U50 C;  3GTL I;  2QA4 Z;  4DCT A;  5IWA C;  1S72 1;  2YWB A;  1UKK A;  4MRI A;  3UZ0 A;  1T5H X;  4OYC A;  1K0R A;  1K8A 1;  3CW8 X;  1KD1 2;  3RZO I;  4QTU A;  1KD1 1;  5IP9 I;  3CCS Z;  1VLA A;  4MTN A;  1LQL A;  2VUG A;  1WH9 A;  1HNX C;  1S72 Z;  3R9X A;  3CXC Y;  4DV2 C;  2NVY I;  3ETC A;  3IX0 A;  1M90 1;  1JJ2 Y;  3FCC A;  2HF1 A;  4LF9 C;  3IF8 A;  1NP6 A;  2R92 I;  2Y4N A;  2V8I A;  2CXC A;  2P2B A;  2HU9 A;  3CCE Z;  3GTM I;  3VMI A;  1WCM I;  4NXN C;  4RMN A;  2BH1 X;  2PN2 A;  4LFC C;  3GTO I;  1WII A;  3GTK I;  4NBB A;  4JI4 C;  4DCU A;  4E32 A;  4A3F I;  2QL8 A;  2JUB A;  3LAX A;  4A3G I;  4X66 C;  3E7X A;  3G4S 1;  3C5E A;  4D57 A;  3NFZ A;  1VQL Z;  1LCI A;  5BUS A;  3RV2 A;  4BC7 A;  3CCQ Z;  4DV7 C;  5K8F A;  3CC4 Z;  5BSM A;  4JYA C;  5A19 A;  4GKJ C;  3CCV Z;  3TDH B;  1JJ2 Z;  1MXA A;  4RVD A;  3L8C A;  3CXC Z;  1USP A;  3A9V A;  2OOY B;  1VQN 1;  3EQ6 A;  4G37 A;  3NDI A;  3IML A;  4RS4 A;  1N8R 2;  3I4N I;  5IFI A;  1YI2 Z;  2WP0 C;  3T1Y C;  1TWA I;  2V8J A;  1Q81 1;  3CJE A;  2Y0S A;  1NJI 2;  2ASB A;  2RPR A;  4DR5 C;  3CCJ 1;  1HH2 P;  4NDN A;  3E7W A;  3JAM D;  2QEX Z;  2NVX I;  4GXQ A;  3H3V J;  3IFU A;  2RIQ A;  3CME 1;  3CMA 1;  1MKY A;  3A4I A;  4KTT A;  3GR1 A;  2QRD B;  1V25 A;  4NBA A;  3CME Z;  3AF5 A;  2QEX 1;  1I50 I;  1XRA A;  3R44 A;  1QVF Y;  1IBK C;  2YU9 I;  2BJO A;  1YJ9 1;  2D1Q A;  2DE7 A;  4IZ6 A;  3CC2 Z;  4A3E I;  3PBK A;  4DGL A;  1AMU A;  5FLM I;  4X65 C;  4MD8 A;  2D1T A;  1NJI 1;  4PRO C;  4L2Z A;  4JM1 A;  4NOZ A;  1MXC A;  2VZE A;  4RLQ A;  4MON A;  3HOX I;  4B3R C;  3HOZ I;  1WF3 A;  4DUZ C;  5AE1 A;  4RM3 A;  2AKL A;  1M1K 1;  3CC2 1;  2OPL B;  5KEI A;  2OZK A;  2M6N A;  1BA3 A;  3RG2 A;  2UU9 C;  4HH4 A;  1YJ9 Z;  3PRO C;  4NXM C;  1DL6 A;  4DCS A;  5A2Q D;  2QVX X;  1TWG I;  4L7I A;  3S15 I;  3CC7 1;  2P3Y A;  5BSV A;  1VQL 1;  3CD6 1;  2R93 I;  2G2K A;  4DG9 A;  1HR0 C;  3CQZ I;  1JOS A;  2WAQ A;  4DQY B;  4JI5 C;  1VQ6 1;  3NH4 A;  1W2B Y;  4A3C I;  3CCE 1;  2LFU A;  3T1H C;  1IBM C;  3FKI I;  4BY7 I;  3NPD A;  1QYP A;  2HHH C;  1X3W A;  2P2F A;  1NYE A;  5E7Q A;  1P7L A;  1J5E C;  2KI7 B;  1VQN Z;  1V26 A;  2UXD C;  4DR4 C;  2YCB A;  4R1M A;  1KQS Z;  3GTM S;  5T8S A;  4QTT A;  2D1R A;  3D9X A;  1RO4 A;  4YY3 C;  3GTQ I;  4E33 A;  1O90 A;  2IZ3 A;  4NBC A;  1K8A 2;  5IP7 I;  3GR0 A;  2VSQ A;  3LNV A;  3SO4 A;  2E8E A;  1KKG A;  3G4S Z;  4DV4 C;  3G6E Z;  4KHP C;  3LUS A;  3NH8 A;  4A93 I;  1ZB8 A;  4MXU A;  1YHQ 1;  5AN9 F;  5C4X I;  1VQK 1;  1K73 2;  2E2I I;  4X6A I;  2AYA A;  1L2F A;  2W03 A;  4R1L A;  2H85 A;  4I9F A;  1Z01 A;  4NB8 A;  4A3M I;  4LFB C;  2GTH A;  3G71 Z;  1VQ7 Z;  1KQS Y;  1USP B;  3HOW I;  3J80 b;  5A2Q f;  3VMG A;  2J6A A;  3QWU A;  3MZL B;  4LE5 A;  2PRO A;  2YAD A;  4A3B I;  5DV9 A;  4BC9 A;  2O4H A;  3CCS 1;  5D1O B;  2IZ4 A;  1O9T A;  4DR6 C;  2PK7 A;  2GU2 A;  3BG0 B;  3EED A;  1K9M 1;  3GKU A;  5A2Q b;  5KYV A;  5CM2 M;  3J7A 4;  3GKQ A;  1VQ5 Z;  1MXB A;  2JA8 I;  4YHH C;  4DG8 A;  4A3J I;  1K83 I;  4L4Q A;  4B3T C;  4LF5 C;  4B3M C;  1X3Z A;  2VQF C;  5KYT A;  1YUA A;  3TQI A;  3HOV I;  4BXX I;  1PA4 A;  1RNI A;  2PT7 G;  2JR6 A;  3FQM A;  1YIT 1;  5K85 A;  4A3I I;  3VTN A;  2O53 A;  3K7A I;  3S1N I;  4GS5 A;  1N33 C;  2QKD A;  4R0M A;  4DUY C;  2JA6 I;  2UUA C;  4LF7 C;  2R7Z I;  4KTV A;  4B3S C;  4PHT A;  2RBL A;  4ODJ A;  1ZB9 A;  4DV3 C;  4NBG A;  3CCL 1;  1YIJ Z;  2OTL Z;  2OBV A;  3JAM b;  2P28 A;  3J81 D;  3CCL Z;  3I56 1;  3FCE A;  1ML8 A;  3KXW A;  4JI8 C;  5T64 A;  1XMQ C;  4G1I A;  3CCM Z;  2Y27 A;  1VQ8 1;  3N2Q A;  1N34 C;  1RLY A;  5BUR A;  3S1Q I;  2E5L C;  3NYR A;  3TUF A;  1FUG A;  2ZAE B;  3ESW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...