3UX3A

Crystal structure of domain-swapped fam96a minor dimer
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
130
structure length
130
Chain Sequence
SNARIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIP18 family protein FAM96A
publication title The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer
doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 3ux3A01
2JNVA 3LNOA 3UX2A 1VEHA 1WCJA 3UX3A 3CQ1A 1XHJA 2Z51A 1TH5A 2CU6A 3CQ2A 2M5OA 1UWDA 2M5HA 3CQ3A
chains in the Genus database with same CATH superfamily
1MD9A 5BSMA 4OX9C 5GTDA 5A2QD 2OO4A 4I9GA 4JI2C 5T8SA 1XHJA 3LGXA 4DV1C 1HNZC 1WCJA 3T1YC 1BA3A 1MKYA 2ASBA 3AF5A 3T1HC 3DLPX 2QW0X 2ONFA 2Y4OA 1IBLC 2P2MA 2P02A 2D28C 4LFCC 4BSZA 2D1RA 1N2FA 1FUGA 1J5EC 3L8CA 2F4VC 2V7BA 4FTFA 4HPVA 4KTTA 3GKUA 1XMQC 5BUSA 4FUQA 3EERA 3IEUA 3IEVA 4U5YD 1IB8A 5A1GA 2UXBC 4OYCA 3K6RA 2P2BA 5JRHA 3RG2A 5LCIA 4R1LA 3CQ1A 4GS5A 1ULTA 4ISBA 2YCBA 1O92A 4DR3C 1N36C 2QVZX 1N33C 1P7LA 4RLQA 2DPLA 3N54B 5E7QA 4LF9C 5IFIA 3LNVA 4DCUA 3UX3A 5K8FA 4PROC 3R44A 5BSWA 3UEBA 2QVXX 4PHTA 3FCEA 2D7VA 2YX1A 4GKJC 5BSVA 3B7WA 4PUIA 3GPCA 5A19A 2BJOA 1P4EA 4LF8C 3ETOA 2MMAB 4JI3C 3C5EA 5CZVA 1HNXC 4NXNC 2ATWA 2D1QA 4BCAA 1V26A 1XNRC 5AE2A 1AMUA 4PZPA 4X66C 4RM2A 1PG4A 4DV7C 2D1SA 1IBKC 5CZXA 1QM4A 1XNQC 5AE1A 2HHHC 3TQIA 4LE5A 4JV5C 4K0KC 2JNVA 3UX2A 5KYTA 1TH5A 3E7WA 4ZJZA 5BUQA 5BSTA 3A9VA 4DR4C 1EGAA 1XRAA 4FUTA 4IZ6A 3R9XA 4GXRA 4DR5C 2CU6A 3R9WA 2MM9A 4PUHA 2QVYX 4D57A 1PG3A 2UUBC 1XS3A 1M6XC 1WH9A 3AY0A 1HR0C 2XR1A 4DR7C 2PN2A 1MXAA 4DCVA 2Y27A 3O2EA 4JI1C 2VQEC 2UU9C 2VZEA 3NYQA 1MDFA 1ZB9A 4G36A 4NOZA 1PU1A 2YWCA 4L2ZA 2UXDC 2BH1X 5BR8C 5A1IA 2KZFA 1NY8A 4EATA 4D56A 3DAYA 4I9FA 4IR7A 4DV5C 3JAMD 3UZ0A 3NYRA 4K0BA 3OTOC 1KKGA 4YHHC 4WV3A 3G7SA 2VSQA 4B3RC 3A25A 1ZB8A 2NCLA 3J80D 2CXCA 3S82A 5H9UA 4ODJA 1USPA 3VNRA 4YY3C 1XMOC 4B3TC 3I08A 2AYAA 2PROA 2M5HA 4MH4A 1XRBA 2YWBA 3CW8X 1V25A 3TR3A 5T8TA 3LUSA 4LFAC 2E7GA 3CW9A 1FLOA 4JI5C 1RG9A 4X62C 4DV4C 1O90A 4X64C 2UUAC 2KDNA 2Z51A 5KEIA 3VNSA 5BSRA 3UOWA 4GXQA 2P20A 2VQFC 2HJGA 5IWAC 4DV6C 1N32C 4BBYA 3PBKA 4RLFA 4BC7A 3L95X 1V60A 4JI4C 3ETCA 3PROC 1UKKA 3H2TA 4KHPC 3AF6A 1K0RA 2UXCC 2E8CA 3LNOA 3E7XA 4JI6C 3LAXA 2P2JA 4RMNA 3GR1A 2E8FA 2DYJA 4JI0C 2E5LC 3J81D 1LCIA 1O93A 4L7IA 4TPSB 3A26A 4KTVA 4BC9A 2MCQA 3NPDA 1MDBA 4LF5C 4JYAC 2ZZMA 1VEHA 1P4EC 1XRCA 2P2FA 4XX2A 5ADZA 4DV2C 4WS9A 4MTNA 2E8EA 1MXBA 5LMNC 4R0MA 5IT9D 1N34C 4DG9A 4OXIA 2WP0C 2CY1A 3A9UA 1T5HX 5K85A 4DR6C 4LF6C 2D1TA 4L4QA 1WF3A 1MXCA 1LQLA 5KYVA 2QL8A 4ZLPA 1RY2A 4D4IA 3RV2A 4DCSA 1ML8A 4DV3C 4AQYC 1IBMC 4DCTA 2JMPA 1GPMA 1QWIA 1JOSA 4JI8C 4D4GA 3CJEA 1USPB 3KXWA 4R1MA 3SO4A 4GKKC 4LF7C 1T5DX 2UUCC 5BSUA 4G37A 3TUFA 4X65C 2ZM6C 4DUYC 2EGTA 3EQ6A 2WD9A 4PUGA 4RVNA 1HH2P 3TDEA 4LFBC 5BURA 4DR2C 4NDNA 4NXMC 1FJGC 3NI2A 4DG8A 4RVOA 3I07A 4JI7C 2ZZNA 2D27A 1YJ7A 4B3MC 2Y4NA 3IPLA 1VLAA 1HNWC 5AE3A 1NYEA 2OPLB 3VNQA 5FLXD 1UWDA 1O9TA 1PA4A 5DV9A 3CQ3A 2E0GA 1L2FA 1I94C 1M6XA 4DV0C 3FCCA 4B3SC 2M5OA 2OBVA 5LMUC 3DHVA 4LF4C 2PT7G 4RM3A 4G1IA 2DHMA 4JM1A 3A4IA 3N2QA 4DR1C 3GR0A 2P2QA 3IMLA 2KZ0A 2OPLA 4DUZC 3PESA 3CQ2A
chains in the Genus database with same CATH topology
2JNVA 3LNOA 3UX2A 1VEHA 1WCJA 3UX3A 3CQ1A 1XHJA 2Z51A 1TH5A 2CU6A 3CQ2A 2M5OA 1UWDA 2M5HA 3CQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNV A;  3LNO A;  3UX2 A;  1VEH A;  1WCJ A;  3UX3 A;  3CQ1 A;  1XHJ A;  2Z51 A;  1TH5 A;  2CU6 A;  3CQ2 A;  2M5O A;  1UWD A;  2M5H A;  3CQ3 A; 
#chains in the Genus database with same CATH topology
 1MD9 A;  5BSM A;  4OX9 C;  5GTD A;  5A2Q D;  2OO4 A;  4I9G A;  4JI2 C;  5T8S A;  1XHJ A;  3LGX A;  4DV1 C;  1HNZ C;  1WCJ A;  3T1Y C;  1BA3 A;  1MKY A;  2ASB A;  3AF5 A;  3T1H C;  3DLP X;  2QW0 X;  2ONF A;  2Y4O A;  1IBL C;  2P2M A;  2P02 A;  2D28 C;  4LFC C;  4BSZ A;  2D1R A;  1N2F A;  1FUG A;  1J5E C;  3L8C A;  2F4V C;  2V7B A;  4FTF A;  4HPV A;  4KTT A;  3GKU A;  1XMQ C;  5BUS A;  4FUQ A;  3EER A;  3IEU A;  3IEV A;  4U5Y D;  1IB8 A;  5A1G A;  2UXB C;  4OYC A;  3K6R A;  2P2B A;  5JRH A;  3RG2 A;  5LCI A;  4R1L A;  3CQ1 A;  4GS5 A;  1ULT A;  4ISB A;  2YCB A;  1O92 A;  4DR3 C;  1N36 C;  2QVZ X;  1N33 C;  1P7L A;  4RLQ A;  2DPL A;  3N54 B;  5E7Q A;  4LF9 C;  5IFI A;  3LNV A;  4DCU A;  3UX3 A;  5K8F A;  4PRO C;  3R44 A;  5BSW A;  3UEB A;  2QVX X;  4PHT A;  3FCE A;  2D7V A;  2YX1 A;  4GKJ C;  5BSV A;  3B7W A;  4PUI A;  3GPC A;  5A19 A;  2BJO A;  1P4E A;  4LF8 C;  3ETO A;  2MMA B;  4JI3 C;  3C5E A;  5CZV A;  1HNX C;  4NXN C;  2ATW A;  2D1Q A;  4BCA A;  1V26 A;  1XNR C;  5AE2 A;  1AMU A;  4PZP A;  4X66 C;  4RM2 A;  1PG4 A;  4DV7 C;  2D1S A;  1IBK C;  5CZX A;  1QM4 A;  1XNQ C;  5AE1 A;  2HHH C;  3TQI A;  4LE5 A;  4JV5 C;  4K0K C;  2JNV A;  3UX2 A;  5KYT A;  1TH5 A;  3E7W A;  4ZJZ A;  5BUQ A;  5BST A;  3A9V A;  4DR4 C;  1EGA A;  1XRA A;  4FUT A;  4IZ6 A;  3R9X A;  4GXR A;  4DR5 C;  2CU6 A;  3R9W A;  2MM9 A;  4PUH A;  2QVY X;  4D57 A;  1PG3 A;  2UUB C;  1XS3 A;  1M6X C;  1WH9 A;  3AY0 A;  1HR0 C;  2XR1 A;  4DR7 C;  2PN2 A;  1MXA A;  4DCV A;  2Y27 A;  3O2E A;  4JI1 C;  2VQE C;  2UU9 C;  2VZE A;  3NYQ A;  1MDF A;  1ZB9 A;  4G36 A;  4NOZ A;  1PU1 A;  2YWC A;  4L2Z A;  2UXD C;  2BH1 X;  5BR8 C;  5A1I A;  2KZF A;  1NY8 A;  4EAT A;  4D56 A;  3DAY A;  4I9F A;  4IR7 A;  4DV5 C;  3JAM D;  3UZ0 A;  3NYR A;  4K0B A;  3OTO C;  1KKG A;  4YHH C;  4WV3 A;  3G7S A;  2VSQ A;  4B3R C;  3A25 A;  1ZB8 A;  2NCL A;  3J80 D;  2CXC A;  3S82 A;  5H9U A;  4ODJ A;  1USP A;  3VNR A;  4YY3 C;  1XMO C;  4B3T C;  3I08 A;  2AYA A;  2PRO A;  2M5H A;  4MH4 A;  1XRB A;  2YWB A;  3CW8 X;  1V25 A;  3TR3 A;  5T8T A;  3LUS A;  4LFA C;  2E7G A;  3CW9 A;  1FLO A;  4JI5 C;  1RG9 A;  4X62 C;  4DV4 C;  1O90 A;  4X64 C;  2UUA C;  2KDN A;  2Z51 A;  5KEI A;  3VNS A;  5BSR A;  3UOW A;  4GXQ A;  2P20 A;  2VQF C;  2HJG A;  5IWA C;  4DV6 C;  1N32 C;  4BBY A;  3PBK A;  4RLF A;  4BC7 A;  3L95 X;  1V60 A;  4JI4 C;  3ETC A;  3PRO C;  1UKK A;  3H2T A;  4KHP C;  3AF6 A;  1K0R A;  2UXC C;  2E8C A;  3LNO A;  3E7X A;  4JI6 C;  3LAX A;  2P2J A;  4RMN A;  3GR1 A;  2E8F A;  2DYJ A;  4JI0 C;  2E5L C;  3J81 D;  1LCI A;  1O93 A;  4L7I A;  4TPS B;  3A26 A;  4KTV A;  4BC9 A;  2MCQ A;  3NPD A;  1MDB A;  4LF5 C;  4JYA C;  2ZZM A;  1VEH A;  1P4E C;  1XRC A;  2P2F A;  4XX2 A;  5ADZ A;  4DV2 C;  4WS9 A;  4MTN A;  2E8E A;  1MXB A;  5LMN C;  4R0M A;  5IT9 D;  1N34 C;  4DG9 A;  4OXI A;  2WP0 C;  2CY1 A;  3A9U A;  1T5H X;  5K85 A;  4DR6 C;  4LF6 C;  2D1T A;  4L4Q A;  1WF3 A;  1MXC A;  1LQL A;  5KYV A;  2QL8 A;  4ZLP A;  1RY2 A;  4D4I A;  3RV2 A;  4DCS A;  1ML8 A;  4DV3 C;  4AQY C;  1IBM C;  4DCT A;  2JMP A;  1GPM A;  1QWI A;  1JOS A;  4JI8 C;  4D4G A;  3CJE A;  1USP B;  3KXW A;  4R1M A;  3SO4 A;  4GKK C;  4LF7 C;  1T5D X;  2UUC C;  5BSU A;  4G37 A;  3TUF A;  4X65 C;  2ZM6 C;  4DUY C;  2EGT A;  3EQ6 A;  2WD9 A;  4PUG A;  4RVN A;  1HH2 P;  3TDE A;  4LFB C;  5BUR A;  4DR2 C;  4NDN A;  4NXM C;  1FJG C;  3NI2 A;  4DG8 A;  4RVO A;  3I07 A;  4JI7 C;  2ZZN A;  2D27 A;  1YJ7 A;  4B3M C;  2Y4N A;  3IPL A;  1VLA A;  1HNW C;  5AE3 A;  1NYE A;  2OPL B;  3VNQ A;  5FLX D;  1UWD A;  1O9T A;  1PA4 A;  5DV9 A;  3CQ3 A;  2E0G A;  1L2F A;  1I94 C;  1M6X A;  4DV0 C;  3FCC A;  4B3S C;  2M5O A;  2OBV A;  5LMU C;  3DHV A;  4LF4 C;  2PT7 G;  4RM3 A;  4G1I A;  2DHM A;  4JM1 A;  3A4I A;  3N2Q A;  4DR1 C;  3GR0 A;  2P2Q A;  3IML A;  2KZ0 A;  2OPL A;  4DUZ C;  3PES A;  3CQ2 A; 
#chains in the Genus database with same CATH homology
 2JNV A;  3LNO A;  3UX2 A;  1VEH A;  1WCJ A;  3UX3 A;  3CQ1 A;  1XHJ A;  2Z51 A;  1TH5 A;  2CU6 A;  3CQ2 A;  2M5O A;  1UWD A;  2M5H A;  3CQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...