2PROA

Pro region of alpha-lytic protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
142
Chain Sequence
DPQLKFAMQRDLGIFPTQLPQYLQTEKLARTQAAAIEREFGAQFAGSWIERNEDGSFKLVAATSGARKSSTLGGVEVRNVRYSLKQLQSAMEQLDAGAGVQSWYVDPRSNAVVVKVDDGATDAGVDFVALSGADSAQVRIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of alpha-lytic protease complexed with its pro region.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Pro region
molecule keywords ALPHA-LYTIC PROTEASE
total genus 38
structure length 142
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02983 Pro_Al_protease Alpha-lytic protease prodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.50 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2proA02
3.30.300.50 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2proA01
3PROC 4PROC 2PROA
chains in the Genus database with same CATH superfamily
1T5HX 4MTNA 4DUZC 2P2MA 4D57A 2XR1A 2BH1X 3NI2A 2JNVA 2KZFA 2ASBA 2OO4A 3R9XA 3J81D 2DHMA 2E0GA 2KDNA 4DV2C 4NXMC 4JYAC 2QVYX 4G37A 3NYRA 1N32C 5BUSA 5BR8C 2UUBC 4DR4C 1XRBA 1WCJA 1N34C 1NY8A 1PG3A 1ULTA 4PHTA 4DR3C 1J5EC 4PUHA 4D4GA 3A4IA 3PBKA 4ODJA 4ZJZA 4JI3C 3UEBA 5BSWA 1XNRC 3IEUA 5AE3A 4DR5C 3AY0A 5KYTA 4DG8A 1ZB8A 3IPLA 2UXCC 3LUSA 4X66C 1XHJA 4WV3A 1MXAA 4LE5A 2CY1A 2VQFC 2D1QA 4DV4C 4LF7C 2JMPA 2PROA 1PG4A 5AE1A 3FCCA 2E5LC 3A9UA 4DCTA 4LF5C 3DLPX 4LFCC 4DR6C 1PA4A 1GPMA 1KKGA 1ML8A 1T5DX 2Y27A 5CZVA 1IB8A 4GS5A 4GKJC 1XRCA 4TPSB 1L2FA 2YX1A 3CQ3A 4KHPC 3LNOA 2CXCA 4PUGA 4MH4A 2YWCA 4DCUA 4RLFA 3B7WA 5BSRA 1V25A 4PUIA 1IBKC 1P4EA 1MDBA 3I07A 1HNXC 4DV0C 5T8SA 3IEVA 2Z51A 1LCIA 4YY3C 4DV7C 4JI0C 3CJEA 2UXBC 4RMNA 2ATWA 1UWDA 1IBLC 2OPLA 4L4QA 2P2FA 2P20A 2MCQA 4JI4C 1USPA 3N54B 5A1GA 1I94C 5DV9A 4JV5C 4EATA 2ONFA 1O90A 3DHVA 1HNZC 4R0MA 4KTVA 1QM4A 1QWIA 5E7QA 4LF8C 2P2BA 3AF6A 3K6RA 3A26A 3PROC 3CW8X 4U5YD 4XX2A 4ZLPA 4LF4C 3R9WA 4RVNA 4G36A 2PN2A 3EQ6A 4GXRA 2AYAA 4G1IA 3L8CA 1V26A 1WF3A 4DR1C 1EGAA 3CQ2A 1ZB9A 4DCVA 2P2QA 4X62C 1N2FA 2P02A 4RLQA 1O93A 2UU9C 4OXIA 1V60A 1UKKA 5LMNC 1XMQC 2E8EA 2QVXX 2Y4NA 2QL8A 2NCLA 4B3MC 2MM9A 2QVZX 2M5HA 3RG2A 2D28C 1K0RA 2P2JA 3CW9A 1XS3A 1HNWC 1VLAA 3DAYA 2KZ0A 4RVOA 4D4IA 2PT7G 2UUCC 5A1IA 1P7LA 1XRAA 3KXWA 3L95X 4DV6C 1WH9A 2VSQA 4DR7C 3VNRA 5IWAC 4BC9A 4OYCA 5BUQA 4JI6C 1MXBA 5A19A 1XMOC 2MMAB 2D7VA 3VNSA 3OTOC 3T1HC 3GR0A 2D1SA 3TUFA 4NXNC 5K85A 1IBMC 4DV5C 1BA3A 4LF6C 3GKUA 5GTDA 1FUGA 5JRHA 2UUAC 4X64C 3FCEA 3UX3A 3O2EA 3GPCA 1FLOA 4NDNA 3VNQA 4OX9C 4HPVA 3TDEA 5H9UA 5KYVA 2OBVA 2WD9A 1FJGC 3CQ1A 3PESA 4GKKC 4DV1C 4L2ZA 4DV3C 3GR1A 2E7GA 5BSTA 4R1MA 3TR3A 2ZM6C 5IFIA 3E7WA 4LFBC 5T8TA 4I9FA 4R1LA 4AQYC 5LMUC 4JI7C 2V7BA 3ETOA 2QW0X 4LFAC 4K0BA 1MXCA 3IMLA 3I08A 4IR7A 2Y4OA 4BCAA 3UOWA 1VEHA 4D56A 5ADZA 2WP0C 4B3SC 3LNVA 4FTFA 2F4VC 1LQLA 2ZZNA 5BSMA 2ZZMA 1MD9A 5FLXD 2HJGA 4WS9A 4BBYA 4I9GA 1M6XA 2EGTA 3JAMD 4FUQA 2VQEC 1PU1A 4L7IA 1O92A 4K0KC 1TH5A 3UX2A 4JM1A 4PROC 4KTTA 3EERA 4IZ6A 2DYJA 3N2QA 2UXDC 1MKYA 4JI8C 4DUYC 3J80D 3R44A 1N33C 3AF5A 4JI1C 3SO4A 2VZEA 3T1YC 2YWBA 4X65C 5BSUA 1HH2P 2BJOA 2CU6A 4JI2C 3LGXA 5IT9D 1JOSA 2D1TA 1RG9A 3C5EA 4ISBA 2YCBA 4DG9A 1MDFA 3TQIA 2M5OA 3A9VA 2DPLA 4LF9C 4PZPA 2OPLB 3UZ0A 3E7XA 4RM3A 5A2QD 2E8FA 3ETCA 3S82A 4B3RC 1XNQC 4BSZA 4B3TC 5BSVA 5LCIA 4FUTA 5BURA 1P4EC 3G7SA 4GXQA 1AMUA 4NOZA 2D1RA 5AE2A 1YJ7A 5KEIA 3H2TA 4DCSA 5K8FA 3NPDA 3NYQA 3A25A 2D27A 2E8CA 2HHHC 5CZXA 1NYEA 1M6XC 3LAXA 1USPB 1O9TA 4BC7A 4YHHC 1RY2A 1N36C 4RM2A 1HR0C 4DR2C 3RV2A 4JI5C
chains in the Genus database with same CATH topology
1T5HX 4MTNA 4DUZC 2P2MA 4D57A 2XR1A 2BH1X 3NI2A 2KZFA 2ASBA 2OO4A 3R9XA 3J81D 2E0GA 4DV2C 4NXMC 4JYAC 2QVYX 4G37A 3NYRA 1N32C 5BUSA 5BR8C 2UUBC 4DR4C 1XRBA 1N34C 1PG3A 1ULTA 4PHTA 4DR3C 1J5EC 4D4GA 3A4IA 3PBKA 4ODJA 4ZJZA 4JI3C 5BSWA 1XNRC 3IEUA 5AE3A 4DR5C 5KYTA 4DG8A 1ZB8A 3IPLA 2UXCC 3LUSA 4X66C 4WV3A 1MXAA 4LE5A 2CY1A 2VQFC 2D1QA 4DV4C 4LF7C 2JMPA 2PROA 1PG4A 5AE1A 3FCCA 2E5LC 3A9UA 4DCTA 4LF5C 3DLPX 4LFCC 4DR6C 1PA4A 1GPMA 1KKGA 1ML8A 1T5DX 2Y27A 5CZVA 4GS5A 4GKJC 1XRCA 4TPSB 1L2FA 4KHPC 2CXCA 4MH4A 2YWCA 4DCUA 4RLFA 3B7WA 5BSRA 1V25A 1IBKC 1MDBA 3I07A 1HNXC 4DV0C 5T8SA 3IEVA 1LCIA 4YY3C 4DV7C 4JI0C 3CJEA 2UXBC 4RMNA 2ATWA 1IBLC 2OPLA 4L4QA 2P2FA 2P20A 4JI4C 1USPA 3N54B 5A1GA 1I94C 5DV9A 4JV5C 4EATA 2ONFA 1O90A 3DHVA 1HNZC 4R0MA 4KTVA 1QM4A 1QWIA 5E7QA 4LF8C 2P2BA 3AF6A 3PROC 3CW8X 4U5YD 4XX2A 4ZLPA 4LF4C 3R9WA 4RVNA 4G36A 2PN2A 3EQ6A 4GXRA 2AYAA 4G1IA 3L8CA 1V26A 1WF3A 4DR1C 1EGAA 1ZB9A 4DCVA 2P2QA 4X62C 1N2FA 2P02A 4RLQA 1O93A 2UU9C 4OXIA 1UKKA 5LMNC 1XMQC 2E8EA 2QVXX 2Y4NA 2QL8A 4B3MC 2QVZX 3RG2A 2D28C 1K0RA 2P2JA 3CW9A 1HNWC 1VLAA 3DAYA 4RVOA 4D4IA 2PT7G 2UUCC 5A1IA 1P7LA 1XRAA 3KXWA 3L95X 4DV6C 1WH9A 2VSQA 4DR7C 3VNRA 5IWAC 4BC9A 4OYCA 5BUQA 4JI6C 1MXBA 5A19A 1XMOC 2D7VA 3VNSA 3OTOC 3T1HC 3GR0A 2D1SA 3TUFA 4NXNC 5K85A 1IBMC 4DV5C 1BA3A 4LF6C 3GKUA 5GTDA 1FUGA 5JRHA 2UUAC 4X64C 3FCEA 3GPCA 4NDNA 3VNQA 4OX9C 4HPVA 3TDEA 5H9UA 5KYVA 2OBVA 2WD9A 1FJGC 3PESA 4GKKC 4DV1C 4L2ZA 4DV3C 3GR1A 2E7GA 5BSTA 4R1MA 2ZM6C 5IFIA 3E7WA 4LFBC 5T8TA 4I9FA 4R1LA 4AQYC 5LMUC 4JI7C 2V7BA 3ETOA 2QW0X 4LFAC 4K0BA 1MXCA 3IMLA 3I08A 4IR7A 2Y4OA 4BCAA 3UOWA 4D56A 5ADZA 2WP0C 4B3SC 3LNVA 4FTFA 2F4VC 1LQLA 5BSMA 1MD9A 5FLXD 2HJGA 4WS9A 4BBYA 4I9GA 2EGTA 3JAMD 4FUQA 2VQEC 4L7IA 1O92A 4K0KC 4JM1A 4PROC 4KTTA 3EERA 4IZ6A 2DYJA 3N2QA 2UXDC 1MKYA 4JI8C 4DUYC 3J80D 3R44A 1N33C 3AF5A 4JI1C 3SO4A 2VZEA 3T1YC 2YWBA 4X65C 5BSUA 1HH2P 2BJOA 4JI2C 3LGXA 5IT9D 1JOSA 2D1TA 1RG9A 3C5EA 4ISBA 2YCBA 4DG9A 1MDFA 3TQIA 3A9VA 2DPLA 4LF9C 4PZPA 2OPLB 3UZ0A 3E7XA 4RM3A 5A2QD 2E8FA 3ETCA 3S82A 4B3RC 1XNQC 4BSZA 4B3TC 5BSVA 4FUTA 5BURA 3G7SA 4GXQA 1AMUA 4NOZA 2D1RA 5AE2A 1YJ7A 5KEIA 3H2TA 4DCSA 5K8FA 3NPDA 3NYQA 2D27A 2E8CA 2HHHC 5CZXA 1NYEA 3LAXA 1USPB 1O9TA 4BC7A 4YHHC 1RY2A 1N36C 4RM2A 1HR0C 4DR2C 3RV2A 4JI5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRO C;  4PRO C;  2PRO A; 
#chains in the Genus database with same CATH topology
 1T5H X;  4MTN A;  4DUZ C;  2P2M A;  4D57 A;  2XR1 A;  2BH1 X;  3NI2 A;  2JNV A;  2KZF A;  2ASB A;  2OO4 A;  3R9X A;  3J81 D;  2DHM A;  2E0G A;  2KDN A;  4DV2 C;  4NXM C;  4JYA C;  2QVY X;  4G37 A;  3NYR A;  1N32 C;  5BUS A;  5BR8 C;  2UUB C;  4DR4 C;  1XRB A;  1WCJ A;  1N34 C;  1NY8 A;  1PG3 A;  1ULT A;  4PHT A;  4DR3 C;  1J5E C;  4PUH A;  4D4G A;  3A4I A;  3PBK A;  4ODJ A;  4ZJZ A;  4JI3 C;  3UEB A;  5BSW A;  1XNR C;  3IEU A;  5AE3 A;  4DR5 C;  3AY0 A;  5KYT A;  4DG8 A;  1ZB8 A;  3IPL A;  2UXC C;  3LUS A;  4X66 C;  1XHJ A;  4WV3 A;  1MXA A;  4LE5 A;  2CY1 A;  2VQF C;  2D1Q A;  4DV4 C;  4LF7 C;  2JMP A;  2PRO A;  1PG4 A;  5AE1 A;  3FCC A;  2E5L C;  3A9U A;  4DCT A;  4LF5 C;  3DLP X;  4LFC C;  4DR6 C;  1PA4 A;  1GPM A;  1KKG A;  1ML8 A;  1T5D X;  2Y27 A;  5CZV A;  1IB8 A;  4GS5 A;  4GKJ C;  1XRC A;  4TPS B;  1L2F A;  2YX1 A;  3CQ3 A;  4KHP C;  3LNO A;  2CXC A;  4PUG A;  4MH4 A;  2YWC A;  4DCU A;  4RLF A;  3B7W A;  5BSR A;  1V25 A;  4PUI A;  1IBK C;  1P4E A;  1MDB A;  3I07 A;  1HNX C;  4DV0 C;  5T8S A;  3IEV A;  2Z51 A;  1LCI A;  4YY3 C;  4DV7 C;  4JI0 C;  3CJE A;  2UXB C;  4RMN A;  2ATW A;  1UWD A;  1IBL C;  2OPL A;  4L4Q A;  2P2F A;  2P20 A;  2MCQ A;  4JI4 C;  1USP A;  3N54 B;  5A1G A;  1I94 C;  5DV9 A;  4JV5 C;  4EAT A;  2ONF A;  1O90 A;  3DHV A;  1HNZ C;  4R0M A;  4KTV A;  1QM4 A;  1QWI A;  5E7Q A;  4LF8 C;  2P2B A;  3AF6 A;  3K6R A;  3A26 A;  3PRO C;  3CW8 X;  4U5Y D;  4XX2 A;  4ZLP A;  4LF4 C;  3R9W A;  4RVN A;  4G36 A;  2PN2 A;  3EQ6 A;  4GXR A;  2AYA A;  4G1I A;  3L8C A;  1V26 A;  1WF3 A;  4DR1 C;  1EGA A;  3CQ2 A;  1ZB9 A;  4DCV A;  2P2Q A;  4X62 C;  1N2F A;  2P02 A;  4RLQ A;  1O93 A;  2UU9 C;  4OXI A;  1V60 A;  1UKK A;  5LMN C;  1XMQ C;  2E8E A;  2QVX X;  2Y4N A;  2QL8 A;  2NCL A;  4B3M C;  2MM9 A;  2QVZ X;  2M5H A;  3RG2 A;  2D28 C;  1K0R A;  2P2J A;  3CW9 A;  1XS3 A;  1HNW C;  1VLA A;  3DAY A;  2KZ0 A;  4RVO A;  4D4I A;  2PT7 G;  2UUC C;  5A1I A;  1P7L A;  1XRA A;  3KXW A;  3L95 X;  4DV6 C;  1WH9 A;  2VSQ A;  4DR7 C;  3VNR A;  5IWA C;  4BC9 A;  4OYC A;  5BUQ A;  4JI6 C;  1MXB A;  5A19 A;  1XMO C;  2MMA B;  2D7V A;  3VNS A;  3OTO C;  3T1H C;  3GR0 A;  2D1S A;  3TUF A;  4NXN C;  5K85 A;  1IBM C;  4DV5 C;  1BA3 A;  4LF6 C;  3GKU A;  5GTD A;  1FUG A;  5JRH A;  2UUA C;  4X64 C;  3FCE A;  3UX3 A;  3O2E A;  3GPC A;  1FLO A;  4NDN A;  3VNQ A;  4OX9 C;  4HPV A;  3TDE A;  5H9U A;  5KYV A;  2OBV A;  2WD9 A;  1FJG C;  3CQ1 A;  3PES A;  4GKK C;  4DV1 C;  4L2Z A;  4DV3 C;  3GR1 A;  2E7G A;  5BST A;  4R1M A;  3TR3 A;  2ZM6 C;  5IFI A;  3E7W A;  4LFB C;  5T8T A;  4I9F A;  4R1L A;  4AQY C;  5LMU C;  4JI7 C;  2V7B A;  3ETO A;  2QW0 X;  4LFA C;  4K0B A;  1MXC A;  3IML A;  3I08 A;  4IR7 A;  2Y4O A;  4BCA A;  3UOW A;  1VEH A;  4D56 A;  5ADZ A;  2WP0 C;  4B3S C;  3LNV A;  4FTF A;  2F4V C;  1LQL A;  2ZZN A;  5BSM A;  2ZZM A;  1MD9 A;  5FLX D;  2HJG A;  4WS9 A;  4BBY A;  4I9G A;  1M6X A;  2EGT A;  3JAM D;  4FUQ A;  2VQE C;  1PU1 A;  4L7I A;  1O92 A;  4K0K C;  1TH5 A;  3UX2 A;  4JM1 A;  4PRO C;  4KTT A;  3EER A;  4IZ6 A;  2DYJ A;  3N2Q A;  2UXD C;  1MKY A;  4JI8 C;  4DUY C;  3J80 D;  3R44 A;  1N33 C;  3AF5 A;  4JI1 C;  3SO4 A;  2VZE A;  3T1Y C;  2YWB A;  4X65 C;  5BSU A;  1HH2 P;  2BJO A;  2CU6 A;  4JI2 C;  3LGX A;  5IT9 D;  1JOS A;  2D1T A;  1RG9 A;  3C5E A;  4ISB A;  2YCB A;  4DG9 A;  1MDF A;  3TQI A;  2M5O A;  3A9V A;  2DPL A;  4LF9 C;  4PZP A;  2OPL B;  3UZ0 A;  3E7X A;  4RM3 A;  5A2Q D;  2E8F A;  3ETC A;  3S82 A;  4B3R C;  1XNQ C;  4BSZ A;  4B3T C;  5BSV A;  5LCI A;  4FUT A;  5BUR A;  1P4E C;  3G7S A;  4GXQ A;  1AMU A;  4NOZ A;  2D1R A;  5AE2 A;  1YJ7 A;  5KEI A;  3H2T A;  4DCS A;  5K8F A;  3NPD A;  3NYQ A;  3A25 A;  2D27 A;  2E8C A;  2HHH C;  5CZX A;  1NYE A;  1M6X C;  3LAX A;  1USP B;  1O9T A;  4BC7 A;  4YHH C;  1RY2 A;  1N36 C;  4RM2 A;  1HR0 C;  4DR2 C;  3RV2 A;  4JI5 C; 
#chains in the Genus database with same CATH homology
 1T5H X;  4MTN A;  4DUZ C;  2P2M A;  4D57 A;  2XR1 A;  2BH1 X;  3NI2 A;  2KZF A;  2ASB A;  2OO4 A;  3R9X A;  3J81 D;  2E0G A;  4DV2 C;  4NXM C;  4JYA C;  2QVY X;  4G37 A;  3NYR A;  1N32 C;  5BUS A;  5BR8 C;  2UUB C;  4DR4 C;  1XRB A;  1N34 C;  1PG3 A;  1ULT A;  4PHT A;  4DR3 C;  1J5E C;  4D4G A;  3A4I A;  3PBK A;  4ODJ A;  4ZJZ A;  4JI3 C;  5BSW A;  1XNR C;  3IEU A;  5AE3 A;  4DR5 C;  5KYT A;  4DG8 A;  1ZB8 A;  3IPL A;  2UXC C;  3LUS A;  4X66 C;  4WV3 A;  1MXA A;  4LE5 A;  2CY1 A;  2VQF C;  2D1Q A;  4DV4 C;  4LF7 C;  2JMP A;  2PRO A;  1PG4 A;  5AE1 A;  3FCC A;  2E5L C;  3A9U A;  4DCT A;  4LF5 C;  3DLP X;  4LFC C;  4DR6 C;  1PA4 A;  1GPM A;  1KKG A;  1ML8 A;  1T5D X;  2Y27 A;  5CZV A;  4GS5 A;  4GKJ C;  1XRC A;  4TPS B;  1L2F A;  4KHP C;  2CXC A;  4MH4 A;  2YWC A;  4DCU A;  4RLF A;  3B7W A;  5BSR A;  1V25 A;  1IBK C;  1MDB A;  3I07 A;  1HNX C;  4DV0 C;  5T8S A;  3IEV A;  1LCI A;  4YY3 C;  4DV7 C;  4JI0 C;  3CJE A;  2UXB C;  4RMN A;  2ATW A;  1IBL C;  2OPL A;  4L4Q A;  2P2F A;  2P20 A;  4JI4 C;  1USP A;  3N54 B;  5A1G A;  1I94 C;  5DV9 A;  4JV5 C;  4EAT A;  2ONF A;  1O90 A;  3DHV A;  1HNZ C;  4R0M A;  4KTV A;  1QM4 A;  1QWI A;  5E7Q A;  4LF8 C;  2P2B A;  3AF6 A;  3PRO C;  3CW8 X;  4U5Y D;  4XX2 A;  4ZLP A;  4LF4 C;  3R9W A;  4RVN A;  4G36 A;  2PN2 A;  3EQ6 A;  4GXR A;  2AYA A;  4G1I A;  3L8C A;  1V26 A;  1WF3 A;  4DR1 C;  1EGA A;  1ZB9 A;  4DCV A;  2P2Q A;  4X62 C;  1N2F A;  2P02 A;  4RLQ A;  1O93 A;  2UU9 C;  4OXI A;  1UKK A;  5LMN C;  1XMQ C;  2E8E A;  2QVX X;  2Y4N A;  2QL8 A;  4B3M C;  2QVZ X;  3RG2 A;  2D28 C;  1K0R A;  2P2J A;  3CW9 A;  1HNW C;  1VLA A;  3DAY A;  4RVO A;  4D4I A;  2PT7 G;  2UUC C;  5A1I A;  1P7L A;  1XRA A;  3KXW A;  3L95 X;  4DV6 C;  1WH9 A;  2VSQ A;  4DR7 C;  3VNR A;  5IWA C;  4BC9 A;  4OYC A;  5BUQ A;  4JI6 C;  1MXB A;  5A19 A;  1XMO C;  2D7V A;  3VNS A;  3OTO C;  3T1H C;  3GR0 A;  2D1S A;  3TUF A;  4NXN C;  5K85 A;  1IBM C;  4DV5 C;  1BA3 A;  4LF6 C;  3GKU A;  5GTD A;  1FUG A;  5JRH A;  2UUA C;  4X64 C;  3FCE A;  3GPC A;  4NDN A;  3VNQ A;  4OX9 C;  4HPV A;  3TDE A;  5H9U A;  5KYV A;  2OBV A;  2WD9 A;  1FJG C;  3PES A;  4GKK C;  4DV1 C;  4L2Z A;  4DV3 C;  3GR1 A;  2E7G A;  5BST A;  4R1M A;  2ZM6 C;  5IFI A;  3E7W A;  4LFB C;  5T8T A;  4I9F A;  4R1L A;  4AQY C;  5LMU C;  4JI7 C;  2V7B A;  3ETO A;  2QW0 X;  4LFA C;  4K0B A;  1MXC A;  3IML A;  3I08 A;  4IR7 A;  2Y4O A;  4BCA A;  3UOW A;  4D56 A;  5ADZ A;  2WP0 C;  4B3S C;  3LNV A;  4FTF A;  2F4V C;  1LQL A;  5BSM A;  1MD9 A;  5FLX D;  2HJG A;  4WS9 A;  4BBY A;  4I9G A;  2EGT A;  3JAM D;  4FUQ A;  2VQE C;  4L7I A;  1O92 A;  4K0K C;  4JM1 A;  4PRO C;  4KTT A;  3EER A;  4IZ6 A;  2DYJ A;  3N2Q A;  2UXD C;  1MKY A;  4JI8 C;  4DUY C;  3J80 D;  3R44 A;  1N33 C;  3AF5 A;  4JI1 C;  3SO4 A;  2VZE A;  3T1Y C;  2YWB A;  4X65 C;  5BSU A;  1HH2 P;  2BJO A;  4JI2 C;  3LGX A;  5IT9 D;  1JOS A;  2D1T A;  1RG9 A;  3C5E A;  4ISB A;  2YCB A;  4DG9 A;  1MDF A;  3TQI A;  3A9V A;  2DPL A;  4LF9 C;  4PZP A;  2OPL B;  3UZ0 A;  3E7X A;  4RM3 A;  5A2Q D;  2E8F A;  3ETC A;  3S82 A;  4B3R C;  1XNQ C;  4BSZ A;  4B3T C;  5BSV A;  4FUT A;  5BUR A;  3G7S A;  4GXQ A;  1AMU A;  4NOZ A;  2D1R A;  5AE2 A;  1YJ7 A;  5KEI A;  3H2T A;  4DCS A;  5K8F A;  3NPD A;  3NYQ A;  2D27 A;  2E8C A;  2HHH C;  5CZX A;  1NYE A;  3LAX A;  1USP B;  1O9T A;  4BC7 A;  4YHH C;  1RY2 A;  1N36 C;  4RM2 A;  1HR0 C;  4DR2 C;  3RV2 A;  4JI5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...