2PROA

Pro region of alpha-lytic protease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
142
Chain Sequence
DPQLKFAMQRDLGIFPTQLPQYLQTEKLARTQAAAIEREFGAQFAGSWIERNEDGSFKLVAATSGARKSSTLGGVEVRNVRYSLKQLQSAMEQLDAGAGVQSWYVDPRSNAVVVKVDDGATDAGVDFVALSGADSAQVRIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structure of alpha-lytic protease complexed with its pro region.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Pro region
total genus 38
structure length 142
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02983 Pro_Al_protease Alpha-lytic protease prodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.50 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2proA02
3.30.300.50 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2proA01
2PROA 4PROC 3PROC
chains in the Genus database with same CATH superfamily
3NPDA 1VEHA 2ZZNA 4DV6C 3AF6A 3UX3A 2OO4A 1IBKC 3G7SA 4DR3C 5DV9A 3A9UA 2HJGA 3LNOA 4RVOA 4JI3C 2BH1X 5BUQA 2Y4OA 3N54B 4D4IA 1K0RA 3AY0A 1N2FA 4BSZA 5GTDA 1MKYA 4DG8A 4NXNC 4LFCC 4TPSB 2BJOA 1V26A 2JNVA 5CZVA 4DV0C 1LQLA 3SO4A 4DV3C 5BSWA 3GR1A 2QL8A 3EQ6A 4PZPA 1N34C 3E7XA 1XS3A 2JMPA 3DHVA 3O2EA 2UXBC 4LE5A 1QM4A 4RMNA 1I94C 1XRCA 4LF4C 4DR6C 1WH9A 1M6XA 1HR0C 2YWBA 3IEUA 1GPMA 2NCLA 2UUAC 2ZM6C 4B3SC 1IBMC 3PBKA 4JI5C 1FUGA 2Y27A 3TUFA 2ATWA 4LF9C 4MTNA 3LGXA 3H2TA 3A4IA 2HHHC 1UWDA 4PHTA 2E5LC 4KTTA 2D1SA 5E7QA 1PG4A 5KEIA 1PA4A 4FUTA 5T8SA 4R1MA 1ML8A 1XMQC 3FCEA 2P2BA 5IT9D 1EGAA 4U5YD 4BC9A 4LF5C 4OYCA 4IZ6A 3J80D 3UEBA 2PROA 4DR7C 2OPLA 2V7BA 3IPLA 1ULTA 5A19A 2EGTA 1P4EA 5BURA 4BBYA 3LAXA 3J81D 1FJGC 3UOWA 2D27A 3R9WA 5CZXA 3I07A 2DHMA 2ONFA 4YHHC 3A25A 4FTFA 4DV2C 2XR1A 5LCIA 4G1IA 4RLQA 1J5EC 3K6RA 1USPA 2M5HA 1V25A 1L2FA 4OX9C 4EATA 1O92A 3RV2A 1XNQC 1PG3A 4GXQA 1BA3A 2E8EA 1O93A 1WCJA 1N33C 3UX2A 1XNRC 3LNVA 4GS5A 5KYVA 5BSMA 3PESA 4PUGA 4DV4C 2KZFA 4JYAC 2D28C 1LCIA 5IFIA 1QWIA 2QVZX 2Z51A 2Y4NA 3ETOA 5IWAC 4DR5C 4KHPC 3A9VA 2UUBC 2VQFC 4L7IA 4BCAA 4ZJZA 5A1GA 1RY2A 4PUHA 4WS9A 2UUCC 4XX2A 3TR3A 3T1YC 4GXRA 3TDEA 1N32C 3ETCA 3VNSA 4X62C 3LUSA 4JI1C 3TQIA 3NYRA 4ODJA 5KYTA 4LFAC 2ZZMA 2D1RA 1UKKA 2D1TA 4LF6C 4D57A 4DR2C 2UXDC 1NY8A 1RG9A 5K8FA 1T5DX 2P2JA 2P02A 3CW9A 3CQ1A 3B7WA 3E7WA 4ZLPA 4NOZA 4G36A 2CXCA 3AF5A 2E0GA 3NYQA 4JI0C 3N2QA 1P7LA 4FUQA 4DG9A 2PN2A 4WV3A 5A2QD 1ZB9A 4JI8C 4BC7A 4RM3A 3KXWA 2MCQA 2CY1A 4B3RC 2UXCC 2D7VA 1MDFA 2AYAA 1WF3A 4L4QA 4DCVA 4DV1C 1MDBA 3R9XA 1HNXC 3VNQA 1USPB 1XRAA 3IMLA 2UU9C 3C5EA 1MXBA 4R0MA 2KDNA 5K85A 4IR7A 4JM1A 4I9FA 4R1LA 4GKKC 1V60A 2WP0C 1AMUA 1XMOC 2VSQA 1XRBA 3DAYA 4D56A 4DUYC 1YJ7A 2DYJA 3RG2A 4DCTA 2E8CA 5BUSA 2ASBA 3IEVA 4K0KC 1MXAA 4DR4C 2OBVA 2M5OA 3GR0A 4JI6C 5ADZA 1O90A 4L2ZA 4PROC 5T8TA 1PU1A 5JRHA 3FCCA 3R44A 4NXMC 4X66C 4B3MC 1MXCA 2E8FA 5AE3A 1IBLC 3L8CA 4JI2C 3OTOC 1MD9A 2DPLA 2QVXX 3GPCA 4RLFA 2WD9A 1TH5A 3NI2A 4KTVA 5BSRA 4LF7C 5LMNC 3PROC 4D4GA 1FLOA 4LF8C 3VNRA 1M6XC 4NDNA 5BSUA 4JI7C 4PUIA 1IB8A 1HNWC 5LMUC 2QW0X 4G37A 5A1IA 1KKGA 4K0BA 2YWCA 3T1HC 2QVYX 5BSTA 2E7GA 3A26A 3CQ2A 1VLAA 2VQEC 4HPVA 1N36C 1O9TA 3CW8X 2F4VC 4DCUA 1JOSA 3GKUA 4GKJC 5BR8C 2D1QA 2OPLB 4MH4A 4ISBA 2P2MA 1HNZC 5AE1A 3DLPX 3L95X 2CU6A 1T5HX 4JI4C 3EERA 1P4EC 2YX1A 5BSVA 2MMAB 1HH2P 4X64C 4OXIA 3JAMD 5AE2A 5H9UA 1NYEA 2PT7G 2VZEA 2YCBA 2MM9A 4RVNA 4DR1C 4YY3C 4X65C 4LFBC 3UZ0A 2P2QA 3I08A 1ZB8A 4AQYC 4DCSA 5FLXD 4I9GA 1XHJA 2KZ0A 2P2FA 3S82A 4DV5C 3CQ3A 4JV5C 2P20A 4RM2A 4DUZC 4DV7C 4B3TC 3CJEA
chains in the Genus database with same CATH topology
3NPDA 4DV6C 3AF6A 2OO4A 1IBKC 3G7SA 4DR3C 5DV9A 3A9UA 2HJGA 4RVOA 4JI3C 2BH1X 5BUQA 2Y4OA 3N54B 4D4IA 1K0RA 1N2FA 4BSZA 5GTDA 1MKYA 4DG8A 4NXNC 4LFCC 4TPSB 2BJOA 1V26A 5CZVA 4DV0C 1LQLA 3SO4A 4DV3C 5BSWA 3GR1A 2QL8A 3EQ6A 4PZPA 1N34C 3E7XA 2JMPA 3DHVA 2UXBC 4LE5A 1QM4A 4RMNA 1I94C 1XRCA 4LF4C 4DR6C 1WH9A 1HR0C 2YWBA 3IEUA 1GPMA 2UUAC 2ZM6C 4B3SC 1IBMC 3PBKA 4JI5C 1FUGA 2Y27A 3TUFA 2ATWA 4LF9C 4MTNA 3LGXA 3H2TA 3A4IA 2HHHC 4PHTA 2E5LC 4KTTA 2D1SA 5E7QA 1PG4A 5KEIA 1PA4A 4FUTA 5T8SA 4R1MA 1ML8A 1XMQC 3FCEA 2P2BA 5IT9D 1EGAA 4U5YD 4BC9A 4LF5C 4OYCA 4IZ6A 3J80D 2PROA 4DR7C 2OPLA 2V7BA 3IPLA 1ULTA 5A19A 2EGTA 5BURA 4BBYA 3LAXA 3J81D 1FJGC 3UOWA 2D27A 3R9WA 5CZXA 3I07A 2ONFA 4YHHC 4FTFA 4DV2C 2XR1A 4G1IA 4RLQA 1J5EC 1USPA 1V25A 1L2FA 4OX9C 4EATA 1O92A 3RV2A 1XNQC 1PG3A 4GXQA 1BA3A 2E8EA 1O93A 1N33C 1XNRC 3LNVA 4GS5A 5KYVA 5BSMA 3PESA 4DV4C 2KZFA 4JYAC 2D28C 1LCIA 5IFIA 1QWIA 2QVZX 5IWAC 2Y4NA 3ETOA 4DR5C 4KHPC 3A9VA 2UUBC 2VQFC 4L7IA 4BCAA 4ZJZA 5A1GA 1RY2A 4WS9A 2UUCC 4XX2A 3T1YC 4GXRA 3TDEA 1N32C 3ETCA 3VNSA 4X62C 3LUSA 4JI1C 3TQIA 3NYRA 4ODJA 5KYTA 4LFAC 2D1RA 1UKKA 2D1TA 4LF6C 4D57A 4DR2C 2UXDC 1RG9A 5K8FA 1T5DX 2P2JA 2P02A 3CW9A 3B7WA 3E7WA 4ZLPA 4NOZA 4G36A 2CXCA 3AF5A 2E0GA 3NYQA 4JI0C 3N2QA 1P7LA 4FUQA 4DG9A 2PN2A 4WV3A 5A2QD 1ZB9A 4JI8C 4BC7A 4RM3A 3KXWA 2CY1A 4B3RC 2UXCC 2D7VA 1MDFA 2AYAA 1WF3A 4L4QA 4DCVA 4DV1C 1MDBA 3R9XA 1HNXC 3VNQA 1USPB 1XRAA 3IMLA 2UU9C 3C5EA 1MXBA 4R0MA 5K85A 4IR7A 4JM1A 4I9FA 4R1LA 4GKKC 2WP0C 1AMUA 1XMOC 2VSQA 1XRBA 3DAYA 4D56A 4DUYC 1YJ7A 2DYJA 3RG2A 4DCTA 2E8CA 5BUSA 2ASBA 3IEVA 4K0KC 1MXAA 4DR4C 2OBVA 3GR0A 4JI6C 5ADZA 1O90A 4L2ZA 4PROC 5T8TA 5JRHA 3FCCA 3R44A 4NXMC 4X66C 4B3MC 1MXCA 2E8FA 5AE3A 1IBLC 3L8CA 4JI2C 3OTOC 1MD9A 2DPLA 2QVXX 3GPCA 4RLFA 2WD9A 3NI2A 4KTVA 5BSRA 4LF7C 5LMNC 3PROC 4D4GA 4LF8C 3VNRA 4NDNA 5BSUA 4JI7C 1HNWC 5LMUC 2QW0X 4G37A 5A1IA 1KKGA 4K0BA 2YWCA 3T1HC 2QVYX 5BSTA 2E7GA 1VLAA 2VQEC 4HPVA 1N36C 1O9TA 3CW8X 2F4VC 4DCUA 1JOSA 3GKUA 4GKJC 5BR8C 2D1QA 2OPLB 4MH4A 4ISBA 2P2MA 1HNZC 5AE1A 3DLPX 3L95X 1T5HX 4JI4C 3EERA 5BSVA 1HH2P 4X64C 4OXIA 3JAMD 5AE2A 5H9UA 1NYEA 2PT7G 2VZEA 2YCBA 4RVNA 4DR1C 4YY3C 4X65C 4LFBC 3UZ0A 2P2QA 3I08A 1ZB8A 4AQYC 4DCSA 5FLXD 4I9GA 2P2FA 3S82A 4DV5C 4JV5C 2P20A 4RM2A 4DUZC 4DV7C 4B3TC 3CJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRO A;  4PRO C;  3PRO C; 
#chains in the Genus database with same CATH topology
 3NPD A;  1VEH A;  2ZZN A;  4DV6 C;  3AF6 A;  3UX3 A;  2OO4 A;  1IBK C;  3G7S A;  4DR3 C;  5DV9 A;  3A9U A;  2HJG A;  3LNO A;  4RVO A;  4JI3 C;  2BH1 X;  5BUQ A;  2Y4O A;  3N54 B;  4D4I A;  1K0R A;  3AY0 A;  1N2F A;  4BSZ A;  5GTD A;  1MKY A;  4DG8 A;  4NXN C;  4LFC C;  4TPS B;  2BJO A;  1V26 A;  2JNV A;  5CZV A;  4DV0 C;  1LQL A;  3SO4 A;  4DV3 C;  5BSW A;  3GR1 A;  2QL8 A;  3EQ6 A;  4PZP A;  1N34 C;  3E7X A;  1XS3 A;  2JMP A;  3DHV A;  3O2E A;  2UXB C;  4LE5 A;  1QM4 A;  4RMN A;  1I94 C;  1XRC A;  4LF4 C;  4DR6 C;  1WH9 A;  1M6X A;  1HR0 C;  2YWB A;  3IEU A;  1GPM A;  2NCL A;  2UUA C;  2ZM6 C;  4B3S C;  1IBM C;  3PBK A;  4JI5 C;  1FUG A;  2Y27 A;  3TUF A;  2ATW A;  4LF9 C;  4MTN A;  3LGX A;  3H2T A;  3A4I A;  2HHH C;  1UWD A;  4PHT A;  2E5L C;  4KTT A;  2D1S A;  5E7Q A;  1PG4 A;  5KEI A;  1PA4 A;  4FUT A;  5T8S A;  4R1M A;  1ML8 A;  1XMQ C;  3FCE A;  2P2B A;  5IT9 D;  1EGA A;  4U5Y D;  4BC9 A;  4LF5 C;  4OYC A;  4IZ6 A;  3J80 D;  3UEB A;  2PRO A;  4DR7 C;  2OPL A;  2V7B A;  3IPL A;  1ULT A;  5A19 A;  2EGT A;  1P4E A;  5BUR A;  4BBY A;  3LAX A;  3J81 D;  1FJG C;  3UOW A;  2D27 A;  3R9W A;  5CZX A;  3I07 A;  2DHM A;  2ONF A;  4YHH C;  3A25 A;  4FTF A;  4DV2 C;  2XR1 A;  5LCI A;  4G1I A;  4RLQ A;  1J5E C;  3K6R A;  1USP A;  2M5H A;  1V25 A;  1L2F A;  4OX9 C;  4EAT A;  1O92 A;  3RV2 A;  1XNQ C;  1PG3 A;  4GXQ A;  1BA3 A;  2E8E A;  1O93 A;  1WCJ A;  1N33 C;  3UX2 A;  1XNR C;  3LNV A;  4GS5 A;  5KYV A;  5BSM A;  3PES A;  4PUG A;  4DV4 C;  2KZF A;  4JYA C;  2D28 C;  1LCI A;  5IFI A;  1QWI A;  2QVZ X;  2Z51 A;  2Y4N A;  3ETO A;  5IWA C;  4DR5 C;  4KHP C;  3A9V A;  2UUB C;  2VQF C;  4L7I A;  4BCA A;  4ZJZ A;  5A1G A;  1RY2 A;  4PUH A;  4WS9 A;  2UUC C;  4XX2 A;  3TR3 A;  3T1Y C;  4GXR A;  3TDE A;  1N32 C;  3ETC A;  3VNS A;  4X62 C;  3LUS A;  4JI1 C;  3TQI A;  3NYR A;  4ODJ A;  5KYT A;  4LFA C;  2ZZM A;  2D1R A;  1UKK A;  2D1T A;  4LF6 C;  4D57 A;  4DR2 C;  2UXD C;  1NY8 A;  1RG9 A;  5K8F A;  1T5D X;  2P2J A;  2P02 A;  3CW9 A;  3CQ1 A;  3B7W A;  3E7W A;  4ZLP A;  4NOZ A;  4G36 A;  2CXC A;  3AF5 A;  2E0G A;  3NYQ A;  4JI0 C;  3N2Q A;  1P7L A;  4FUQ A;  4DG9 A;  2PN2 A;  4WV3 A;  5A2Q D;  1ZB9 A;  4JI8 C;  4BC7 A;  4RM3 A;  3KXW A;  2MCQ A;  2CY1 A;  4B3R C;  2UXC C;  2D7V A;  1MDF A;  2AYA A;  1WF3 A;  4L4Q A;  4DCV A;  4DV1 C;  1MDB A;  3R9X A;  1HNX C;  3VNQ A;  1USP B;  1XRA A;  3IML A;  2UU9 C;  3C5E A;  1MXB A;  4R0M A;  2KDN A;  5K85 A;  4IR7 A;  4JM1 A;  4I9F A;  4R1L A;  4GKK C;  1V60 A;  2WP0 C;  1AMU A;  1XMO C;  2VSQ A;  1XRB A;  3DAY A;  4D56 A;  4DUY C;  1YJ7 A;  2DYJ A;  3RG2 A;  4DCT A;  2E8C A;  5BUS A;  2ASB A;  3IEV A;  4K0K C;  1MXA A;  4DR4 C;  2OBV A;  2M5O A;  3GR0 A;  4JI6 C;  5ADZ A;  1O90 A;  4L2Z A;  4PRO C;  5T8T A;  1PU1 A;  5JRH A;  3FCC A;  3R44 A;  4NXM C;  4X66 C;  4B3M C;  1MXC A;  2E8F A;  5AE3 A;  1IBL C;  3L8C A;  4JI2 C;  3OTO C;  1MD9 A;  2DPL A;  2QVX X;  3GPC A;  4RLF A;  2WD9 A;  1TH5 A;  3NI2 A;  4KTV A;  5BSR A;  4LF7 C;  5LMN C;  3PRO C;  4D4G A;  1FLO A;  4LF8 C;  3VNR A;  1M6X C;  4NDN A;  5BSU A;  4JI7 C;  4PUI A;  1IB8 A;  1HNW C;  5LMU C;  2QW0 X;  4G37 A;  5A1I A;  1KKG A;  4K0B A;  2YWC A;  3T1H C;  2QVY X;  5BST A;  2E7G A;  3A26 A;  3CQ2 A;  1VLA A;  2VQE C;  4HPV A;  1N36 C;  1O9T A;  3CW8 X;  2F4V C;  4DCU A;  1JOS A;  3GKU A;  4GKJ C;  5BR8 C;  2D1Q A;  2OPL B;  4MH4 A;  4ISB A;  2P2M A;  1HNZ C;  5AE1 A;  3DLP X;  3L95 X;  2CU6 A;  1T5H X;  4JI4 C;  3EER A;  1P4E C;  2YX1 A;  5BSV A;  2MMA B;  1HH2 P;  4X64 C;  4OXI A;  3JAM D;  5AE2 A;  5H9U A;  1NYE A;  2PT7 G;  2VZE A;  2YCB A;  2MM9 A;  4RVN A;  4DR1 C;  4YY3 C;  4X65 C;  4LFB C;  3UZ0 A;  2P2Q A;  3I08 A;  1ZB8 A;  4AQY C;  4DCS A;  5FLX D;  4I9G A;  1XHJ A;  2KZ0 A;  2P2F A;  3S82 A;  4DV5 C;  3CQ3 A;  4JV5 C;  2P20 A;  4RM2 A;  4DUZ C;  4DV7 C;  4B3T C;  3CJE A; 
#chains in the Genus database with same CATH homology
 3NPD A;  4DV6 C;  3AF6 A;  2OO4 A;  1IBK C;  3G7S A;  4DR3 C;  5DV9 A;  3A9U A;  2HJG A;  4RVO A;  4JI3 C;  2BH1 X;  5BUQ A;  2Y4O A;  3N54 B;  4D4I A;  1K0R A;  1N2F A;  4BSZ A;  5GTD A;  1MKY A;  4DG8 A;  4NXN C;  4LFC C;  4TPS B;  2BJO A;  1V26 A;  5CZV A;  4DV0 C;  1LQL A;  3SO4 A;  4DV3 C;  5BSW A;  3GR1 A;  2QL8 A;  3EQ6 A;  4PZP A;  1N34 C;  3E7X A;  2JMP A;  3DHV A;  2UXB C;  4LE5 A;  1QM4 A;  4RMN A;  1I94 C;  1XRC A;  4LF4 C;  4DR6 C;  1WH9 A;  1HR0 C;  2YWB A;  3IEU A;  1GPM A;  2UUA C;  2ZM6 C;  4B3S C;  1IBM C;  3PBK A;  4JI5 C;  1FUG A;  2Y27 A;  3TUF A;  2ATW A;  4LF9 C;  4MTN A;  3LGX A;  3H2T A;  3A4I A;  2HHH C;  4PHT A;  2E5L C;  4KTT A;  2D1S A;  5E7Q A;  1PG4 A;  5KEI A;  1PA4 A;  4FUT A;  5T8S A;  4R1M A;  1ML8 A;  1XMQ C;  3FCE A;  2P2B A;  5IT9 D;  1EGA A;  4U5Y D;  4BC9 A;  4LF5 C;  4OYC A;  4IZ6 A;  3J80 D;  2PRO A;  4DR7 C;  2OPL A;  2V7B A;  3IPL A;  1ULT A;  5A19 A;  2EGT A;  5BUR A;  4BBY A;  3LAX A;  3J81 D;  1FJG C;  3UOW A;  2D27 A;  3R9W A;  5CZX A;  3I07 A;  2ONF A;  4YHH C;  4FTF A;  4DV2 C;  2XR1 A;  4G1I A;  4RLQ A;  1J5E C;  1USP A;  1V25 A;  1L2F A;  4OX9 C;  4EAT A;  1O92 A;  3RV2 A;  1XNQ C;  1PG3 A;  4GXQ A;  1BA3 A;  2E8E A;  1O93 A;  1N33 C;  1XNR C;  3LNV A;  4GS5 A;  5KYV A;  5BSM A;  3PES A;  4DV4 C;  2KZF A;  4JYA C;  2D28 C;  1LCI A;  5IFI A;  1QWI A;  2QVZ X;  5IWA C;  2Y4N A;  3ETO A;  4DR5 C;  4KHP C;  3A9V A;  2UUB C;  2VQF C;  4L7I A;  4BCA A;  4ZJZ A;  5A1G A;  1RY2 A;  4WS9 A;  2UUC C;  4XX2 A;  3T1Y C;  4GXR A;  3TDE A;  1N32 C;  3ETC A;  3VNS A;  4X62 C;  3LUS A;  4JI1 C;  3TQI A;  3NYR A;  4ODJ A;  5KYT A;  4LFA C;  2D1R A;  1UKK A;  2D1T A;  4LF6 C;  4D57 A;  4DR2 C;  2UXD C;  1RG9 A;  5K8F A;  1T5D X;  2P2J A;  2P02 A;  3CW9 A;  3B7W A;  3E7W A;  4ZLP A;  4NOZ A;  4G36 A;  2CXC A;  3AF5 A;  2E0G A;  3NYQ A;  4JI0 C;  3N2Q A;  1P7L A;  4FUQ A;  4DG9 A;  2PN2 A;  4WV3 A;  5A2Q D;  1ZB9 A;  4JI8 C;  4BC7 A;  4RM3 A;  3KXW A;  2CY1 A;  4B3R C;  2UXC C;  2D7V A;  1MDF A;  2AYA A;  1WF3 A;  4L4Q A;  4DCV A;  4DV1 C;  1MDB A;  3R9X A;  1HNX C;  3VNQ A;  1USP B;  1XRA A;  3IML A;  2UU9 C;  3C5E A;  1MXB A;  4R0M A;  5K85 A;  4IR7 A;  4JM1 A;  4I9F A;  4R1L A;  4GKK C;  2WP0 C;  1AMU A;  1XMO C;  2VSQ A;  1XRB A;  3DAY A;  4D56 A;  4DUY C;  1YJ7 A;  2DYJ A;  3RG2 A;  4DCT A;  2E8C A;  5BUS A;  2ASB A;  3IEV A;  4K0K C;  1MXA A;  4DR4 C;  2OBV A;  3GR0 A;  4JI6 C;  5ADZ A;  1O90 A;  4L2Z A;  4PRO C;  5T8T A;  5JRH A;  3FCC A;  3R44 A;  4NXM C;  4X66 C;  4B3M C;  1MXC A;  2E8F A;  5AE3 A;  1IBL C;  3L8C A;  4JI2 C;  3OTO C;  1MD9 A;  2DPL A;  2QVX X;  3GPC A;  4RLF A;  2WD9 A;  3NI2 A;  4KTV A;  5BSR A;  4LF7 C;  5LMN C;  3PRO C;  4D4G A;  4LF8 C;  3VNR A;  4NDN A;  5BSU A;  4JI7 C;  1HNW C;  5LMU C;  2QW0 X;  4G37 A;  5A1I A;  1KKG A;  4K0B A;  2YWC A;  3T1H C;  2QVY X;  5BST A;  2E7G A;  1VLA A;  2VQE C;  4HPV A;  1N36 C;  1O9T A;  3CW8 X;  2F4V C;  4DCU A;  1JOS A;  3GKU A;  4GKJ C;  5BR8 C;  2D1Q A;  2OPL B;  4MH4 A;  4ISB A;  2P2M A;  1HNZ C;  5AE1 A;  3DLP X;  3L95 X;  1T5H X;  4JI4 C;  3EER A;  5BSV A;  1HH2 P;  4X64 C;  4OXI A;  3JAM D;  5AE2 A;  5H9U A;  1NYE A;  2PT7 G;  2VZE A;  2YCB A;  4RVN A;  4DR1 C;  4YY3 C;  4X65 C;  4LFB C;  3UZ0 A;  2P2Q A;  3I08 A;  1ZB8 A;  4AQY C;  4DCS A;  5FLX D;  4I9G A;  2P2F A;  3S82 A;  4DV5 C;  4JV5 C;  2P20 A;  4RM2 A;  4DUZ C;  4DV7 C;  4B3T C;  3CJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...