3TUFA

Structure of the spoiiq-spoiiiah pore forming complex.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
DDLFTTYRLDLEDARSKEREELNAIVSSDDATAKEKSEAYDKMTALSEVEGTEKQLETLIKTQGYEDALVNAEGDKINITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Stage II sporulation protein Q
publication title Structure of components of an intercellular channel complex in sporulating Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 42
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2011-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.270 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3tufA00
3UZ0A 3TUFA
chains in the Genus database with same CATH superfamily
4GKJC 2ZM6C 3IEUA 5H9UA 4ISBA 2V7BA 1XMOC 2CU6A 3ETCA 1XS3A 2EGTA 2D27A 5BSVA 1IBKC 4PUHA 3T1HC 1XNQC 3O2EA 3T1YC 1P7LA 5LMNC 5A2QD 3A9VA 4DCVA 5A19A 3R9WA 4LF4C 4IR7A 3OTOC 3UEBA 5BURA 1ML8A 3PROC 4LF9C 2OO4A 4IZ6A 3I07A 4BSZA 1USPA 1HH2P 5KEIA 5BR8C 3UX3A 2DPLA 3GKUA 2UXBC 4KHPC 1O9TA 5JRHA 1MXBA 4FTFA 4X66C 2YWCA 2E0GA 4TPSB 4YY3C 3R44A 4DCTA 3VNSA 1L2FA 1PG3A 1HR0C 3PESA 4NOZA 1I94C 2AYAA 2UXCC 4OXIA 4MH4A 2CXCA 1VEHA 2VQFC 3IEVA 1YJ7A 3DHVA 2KZ0A 1HNWC 4L2ZA 3L8CA 1N34C 2VSQA 1USPB 2OPLA 4DV5C 4AQYC 2ASBA 4DV7C 4JI0C 1QWIA 4NXNC 4B3SC 4LF6C 3CQ2A 2D1SA 4DUZC 2D1TA 1PG4A 2PT7G 4PZPA 4X64C 4DR3C 2ATWA 2E7GA 3CJEA 5KYTA 4LE5A 4BC7A 2QVYX 2E5LC 1MD9A 1AMUA 2Y27A 3CW8X 4JI4C 1RG9A 3G7SA 2D28C 1WH9A 3IPLA 2UUCC 5KYVA 4DR2C 2P2MA 5LCIA 1FJGC 4JI6C 5A1IA 3RG2A 1LCIA 5AE1A 3TUFA 4ODJA 1MKYA 2ONFA 2YCBA 4X65C 2P2BA 1ZB8A 4JM1A 2ZZNA 2E8CA 5BSRA 3JAMD 4GXRA 3C5EA 4JI3C 4D4IA 4JI7C 3A25A 2P2FA 3LGXA 5BSUA 5BSMA 1PU1A 5BSWA 3LNVA 4KTVA 3GR0A 1V25A 2VZEA 4K0BA 2D1QA 4PHTA 4U5YD 4DR5C 4DUYC 4PUGA 1MDBA 4DV6C 4LFCC 2P2QA 5AE2A 2MCQA 1RY2A 1NY8A 1KKGA 1O93A 3TDEA 3A4IA 3CQ1A 4HPVA 4LFBC 3I08A 2PROA 2XR1A 3L95X 1QM4A 2E8FA 3E7XA 1IBLC 2BH1X 3NI2A 4ZJZA 2QW0X 1UWDA 1BA3A 1MDFA 4JYAC 4R1LA 1ZB9A 4FUQA 4DV1C 1HNXC 2M5HA 1V26A 4OYCA 5FLXD 3K6RA 3CW9A 1N2FA 4D57A 5AE3A 2ZZMA 5GTDA 4LF8C 3J80D 3AF5A 1M6XA 4WS9A 5CZXA 3CQ3A 5E7QA 2MMAB 3TQIA 4I9FA 2NCLA 1GPMA 1EGAA 5K8FA 3UX2A 3S82A 1UKKA 2UUAC 4DR7C 3H2TA 3N54B 2UXDC 4DG8A 1PA4A 2MM9A 1N36C 2QVZX 3R9XA 4RM3A 4ZLPA 4JI2C 2P2JA 1M6XC 4K0KC 1J5EC 4DR6C 3GPCA 2QVXX 4JI8C 1XRBA 3B7WA 1FLOA 1N33C 4NXMC 3UOWA 4L7IA 2CY1A 1MXAA 1T5DX 1XRAA 4MTNA 2BJOA 2M5OA 4R0MA 1K0RA 1LQLA 4L4QA 1XHJA 1ULTA 1XMQC 4B3RC 2PN2A 5ADZA 5T8TA 3J81D 5BUQA 1IB8A 4XX2A 5DV9A 4BC9A 3VNRA 5CZVA 3AY0A 4GS5A 4RLFA 5A1GA 2HHHC 3DAYA 4GKKC 1MXCA 1HNZC 3RV2A 3DLPX 4DV2C 2YX1A 4D4GA 3N2QA 3LUSA 5IWAC 4WV3A 1V60A 4JV5C 2Z51A 3VNQA 3LNOA 5LMUC 4B3TC 4X62C 3GR1A 2KDNA 4DV0C 1XNRC 5T8SA 4LFAC 1JOSA 3NYQA 4G1IA 5K85A 3NPDA 5IT9D 4BBYA 2QL8A 1P4EA 4EATA 3UZ0A 1IBMC 4LF7C 2WD9A 3A9UA 2HJGA 1NYEA 3IMLA 3AF6A 2Y4OA 4FUTA 4NDNA 1TH5A 2JMPA 3SO4A 5IFIA 3PBKA 4G37A 2DHMA 4PUIA 4GXQA 2YWBA 1P4EC 3EQ6A 4OX9C 4D56A 4DCSA 2P02A 3FCCA 4G36A 4RVNA 3E7WA 4DR1C 1O92A 1XRCA 4RMNA 2D7VA 2OBVA 4RVOA 2F4VC 4R1MA 5BSTA 2E8EA 1WCJA 4YHHC 2D1RA 4RLQA 4DV4C 4DR4C 4JI1C 1O90A 4BCAA 3EERA 3A26A 2UU9C 3KXWA 2P20A 1FUGA 3LAXA 2UUBC 4KTTA 1WF3A 3NYRA 4LF5C 4DV3C 2Y4NA 4DCUA 3TR3A 1N32C 4DG9A 4B3MC 2WP0C 5BUSA 2OPLB 4PROC 3ETOA 4I9GA 2VQEC 2DYJA 2KZFA 4JI5C 1T5HX 1VLAA 2JNVA 4RM2A 3FCEA
chains in the Genus database with same CATH topology
4GKJC 2ZM6C 3IEUA 5H9UA 4ISBA 2V7BA 1XMOC 3ETCA 2EGTA 2D27A 5BSVA 1IBKC 3T1HC 1XNQC 3T1YC 1P7LA 5LMNC 5A2QD 3A9VA 4DCVA 5A19A 3R9WA 4LF4C 4IR7A 3OTOC 5BURA 1ML8A 3PROC 4LF9C 2OO4A 4IZ6A 3I07A 4BSZA 1USPA 1HH2P 5KEIA 5BR8C 2DPLA 3GKUA 2UXBC 4KHPC 1O9TA 5JRHA 1MXBA 4FTFA 4X66C 2YWCA 2E0GA 4TPSB 4YY3C 3R44A 4DCTA 3VNSA 1L2FA 1PG3A 1HR0C 3PESA 4NOZA 1I94C 2AYAA 2UXCC 4OXIA 4MH4A 2CXCA 2VQFC 3IEVA 1YJ7A 3DHVA 1HNWC 4L2ZA 3L8CA 1N34C 2VSQA 1USPB 2OPLA 4DV5C 4AQYC 2ASBA 4DV7C 4JI0C 1QWIA 4NXNC 4B3SC 4LF6C 2D1SA 4DUZC 2D1TA 1PG4A 2PT7G 4PZPA 4X64C 4DR3C 2ATWA 2E7GA 3CJEA 5KYTA 4LE5A 4BC7A 2QVYX 2E5LC 1MD9A 1AMUA 2Y27A 3CW8X 4JI4C 1RG9A 3G7SA 2D28C 1WH9A 3IPLA 2UUCC 5KYVA 4DR2C 2P2MA 1FJGC 4JI6C 5A1IA 3RG2A 1LCIA 5AE1A 3TUFA 4ODJA 1MKYA 2ONFA 2YCBA 4X65C 2P2BA 1ZB8A 4JM1A 2E8CA 5BSRA 3JAMD 4GXRA 3C5EA 4JI3C 4D4IA 4JI7C 2P2FA 3LGXA 5BSUA 5BSMA 5BSWA 3LNVA 4KTVA 3GR0A 1V25A 2VZEA 4K0BA 2D1QA 4PHTA 4U5YD 4DR5C 4DUYC 1MDBA 4DV6C 4LFCC 2P2QA 5AE2A 1RY2A 1KKGA 1O93A 3TDEA 3A4IA 4HPVA 4LFBC 3I08A 2PROA 2XR1A 3L95X 1QM4A 2E8FA 3E7XA 1IBLC 2BH1X 3NI2A 4ZJZA 2QW0X 1BA3A 1MDFA 4JYAC 4R1LA 1ZB9A 4FUQA 4DV1C 1HNXC 1V26A 4OYCA 5FLXD 3CW9A 1N2FA 4D57A 5AE3A 5GTDA 4LF8C 3J80D 3AF5A 4WS9A 5CZXA 5E7QA 3TQIA 4I9FA 1GPMA 1EGAA 5K8FA 3S82A 1UKKA 2UUAC 4DR7C 3H2TA 3N54B 2UXDC 4DG8A 1PA4A 1N36C 2QVZX 3R9XA 4RM3A 4ZLPA 4JI2C 2P2JA 4K0KC 1J5EC 4DR6C 3GPCA 2QVXX 4JI8C 1XRBA 3B7WA 1N33C 4NXMC 3UOWA 4L7IA 2CY1A 1MXAA 1T5DX 1XRAA 4MTNA 2BJOA 4R0MA 1K0RA 1LQLA 4L4QA 1ULTA 1XMQC 4B3RC 2PN2A 5ADZA 5T8TA 3J81D 5BUQA 4XX2A 5DV9A 4BC9A 3VNRA 5CZVA 4GS5A 4RLFA 5A1GA 2HHHC 3DAYA 4GKKC 1MXCA 1HNZC 3RV2A 3DLPX 4DV2C 4D4GA 3N2QA 3LUSA 5IWAC 4WV3A 4JV5C 3VNQA 5LMUC 4B3TC 4X62C 3GR1A 4DV0C 1XNRC 5T8SA 4LFAC 1JOSA 3NYQA 4G1IA 5K85A 3NPDA 5IT9D 4BBYA 2QL8A 4EATA 3UZ0A 1IBMC 4LF7C 2WD9A 3A9UA 2HJGA 1NYEA 3IMLA 3AF6A 2Y4OA 4FUTA 4NDNA 2JMPA 3SO4A 5IFIA 3PBKA 4G37A 4GXQA 2YWBA 3EQ6A 4OX9C 4D56A 4DCSA 2P02A 3FCCA 4G36A 4RVNA 3E7WA 4DR1C 1O92A 1XRCA 4RMNA 2D7VA 2OBVA 4RVOA 2F4VC 4R1MA 5BSTA 2E8EA 4YHHC 2D1RA 4RLQA 4DV4C 4DR4C 4JI1C 1O90A 4BCAA 3EERA 2UU9C 3KXWA 2P20A 1FUGA 3LAXA 2UUBC 4KTTA 1WF3A 3NYRA 4LF5C 4DV3C 2Y4NA 4DCUA 1N32C 4DG9A 4B3MC 2WP0C 5BUSA 2OPLB 4PROC 3ETOA 4I9GA 2VQEC 2DYJA 2KZFA 4JI5C 1T5HX 1VLAA 4RM2A 3FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UZ0 A;  3TUF A; 
#chains in the Genus database with same CATH topology
 4GKJ C;  2ZM6 C;  3IEU A;  5H9U A;  4ISB A;  2V7B A;  1XMO C;  2CU6 A;  3ETC A;  1XS3 A;  2EGT A;  2D27 A;  5BSV A;  1IBK C;  4PUH A;  3T1H C;  1XNQ C;  3O2E A;  3T1Y C;  1P7L A;  5LMN C;  5A2Q D;  3A9V A;  4DCV A;  5A19 A;  3R9W A;  4LF4 C;  4IR7 A;  3OTO C;  3UEB A;  5BUR A;  1ML8 A;  3PRO C;  4LF9 C;  2OO4 A;  4IZ6 A;  3I07 A;  4BSZ A;  1USP A;  1HH2 P;  5KEI A;  5BR8 C;  3UX3 A;  2DPL A;  3GKU A;  2UXB C;  4KHP C;  1O9T A;  5JRH A;  1MXB A;  4FTF A;  4X66 C;  2YWC A;  2E0G A;  4TPS B;  4YY3 C;  3R44 A;  4DCT A;  3VNS A;  1L2F A;  1PG3 A;  1HR0 C;  3PES A;  4NOZ A;  1I94 C;  2AYA A;  2UXC C;  4OXI A;  4MH4 A;  2CXC A;  1VEH A;  2VQF C;  3IEV A;  1YJ7 A;  3DHV A;  2KZ0 A;  1HNW C;  4L2Z A;  3L8C A;  1N34 C;  2VSQ A;  1USP B;  2OPL A;  4DV5 C;  4AQY C;  2ASB A;  4DV7 C;  4JI0 C;  1QWI A;  4NXN C;  4B3S C;  4LF6 C;  3CQ2 A;  2D1S A;  4DUZ C;  2D1T A;  1PG4 A;  2PT7 G;  4PZP A;  4X64 C;  4DR3 C;  2ATW A;  2E7G A;  3CJE A;  5KYT A;  4LE5 A;  4BC7 A;  2QVY X;  2E5L C;  1MD9 A;  1AMU A;  2Y27 A;  3CW8 X;  4JI4 C;  1RG9 A;  3G7S A;  2D28 C;  1WH9 A;  3IPL A;  2UUC C;  5KYV A;  4DR2 C;  2P2M A;  5LCI A;  1FJG C;  4JI6 C;  5A1I A;  3RG2 A;  1LCI A;  5AE1 A;  3TUF A;  4ODJ A;  1MKY A;  2ONF A;  2YCB A;  4X65 C;  2P2B A;  1ZB8 A;  4JM1 A;  2ZZN A;  2E8C A;  5BSR A;  3JAM D;  4GXR A;  3C5E A;  4JI3 C;  4D4I A;  4JI7 C;  3A25 A;  2P2F A;  3LGX A;  5BSU A;  5BSM A;  1PU1 A;  5BSW A;  3LNV A;  4KTV A;  3GR0 A;  1V25 A;  2VZE A;  4K0B A;  2D1Q A;  4PHT A;  4U5Y D;  4DR5 C;  4DUY C;  4PUG A;  1MDB A;  4DV6 C;  4LFC C;  2P2Q A;  5AE2 A;  2MCQ A;  1RY2 A;  1NY8 A;  1KKG A;  1O93 A;  3TDE A;  3A4I A;  3CQ1 A;  4HPV A;  4LFB C;  3I08 A;  2PRO A;  2XR1 A;  3L95 X;  1QM4 A;  2E8F A;  3E7X A;  1IBL C;  2BH1 X;  3NI2 A;  4ZJZ A;  2QW0 X;  1UWD A;  1BA3 A;  1MDF A;  4JYA C;  4R1L A;  1ZB9 A;  4FUQ A;  4DV1 C;  1HNX C;  2M5H A;  1V26 A;  4OYC A;  5FLX D;  3K6R A;  3CW9 A;  1N2F A;  4D57 A;  5AE3 A;  2ZZM A;  5GTD A;  4LF8 C;  3J80 D;  3AF5 A;  1M6X A;  4WS9 A;  5CZX A;  3CQ3 A;  5E7Q A;  2MMA B;  3TQI A;  4I9F A;  2NCL A;  1GPM A;  1EGA A;  5K8F A;  3UX2 A;  3S82 A;  1UKK A;  2UUA C;  4DR7 C;  3H2T A;  3N54 B;  2UXD C;  4DG8 A;  1PA4 A;  2MM9 A;  1N36 C;  2QVZ X;  3R9X A;  4RM3 A;  4ZLP A;  4JI2 C;  2P2J A;  1M6X C;  4K0K C;  1J5E C;  4DR6 C;  3GPC A;  2QVX X;  4JI8 C;  1XRB A;  3B7W A;  1FLO A;  1N33 C;  4NXM C;  3UOW A;  4L7I A;  2CY1 A;  1MXA A;  1T5D X;  1XRA A;  4MTN A;  2BJO A;  2M5O A;  4R0M A;  1K0R A;  1LQL A;  4L4Q A;  1XHJ A;  1ULT A;  1XMQ C;  4B3R C;  2PN2 A;  5ADZ A;  5T8T A;  3J81 D;  5BUQ A;  1IB8 A;  4XX2 A;  5DV9 A;  4BC9 A;  3VNR A;  5CZV A;  3AY0 A;  4GS5 A;  4RLF A;  5A1G A;  2HHH C;  3DAY A;  4GKK C;  1MXC A;  1HNZ C;  3RV2 A;  3DLP X;  4DV2 C;  2YX1 A;  4D4G A;  3N2Q A;  3LUS A;  5IWA C;  4WV3 A;  1V60 A;  4JV5 C;  2Z51 A;  3VNQ A;  3LNO A;  5LMU C;  4B3T C;  4X62 C;  3GR1 A;  2KDN A;  4DV0 C;  1XNR C;  5T8S A;  4LFA C;  1JOS A;  3NYQ A;  4G1I A;  5K85 A;  3NPD A;  5IT9 D;  4BBY A;  2QL8 A;  1P4E A;  4EAT A;  3UZ0 A;  1IBM C;  4LF7 C;  2WD9 A;  3A9U A;  2HJG A;  1NYE A;  3IML A;  3AF6 A;  2Y4O A;  4FUT A;  4NDN A;  1TH5 A;  2JMP A;  3SO4 A;  5IFI A;  3PBK A;  4G37 A;  2DHM A;  4PUI A;  4GXQ A;  2YWB A;  1P4E C;  3EQ6 A;  4OX9 C;  4D56 A;  4DCS A;  2P02 A;  3FCC A;  4G36 A;  4RVN A;  3E7W A;  4DR1 C;  1O92 A;  1XRC A;  4RMN A;  2D7V A;  2OBV A;  4RVO A;  2F4V C;  4R1M A;  5BST A;  2E8E A;  1WCJ A;  4YHH C;  2D1R A;  4RLQ A;  4DV4 C;  4DR4 C;  4JI1 C;  1O90 A;  4BCA A;  3EER A;  3A26 A;  2UU9 C;  3KXW A;  2P20 A;  1FUG A;  3LAX A;  2UUB C;  4KTT A;  1WF3 A;  3NYR A;  4LF5 C;  4DV3 C;  2Y4N A;  4DCU A;  3TR3 A;  1N32 C;  4DG9 A;  4B3M C;  2WP0 C;  5BUS A;  2OPL B;  4PRO C;  3ETO A;  4I9G A;  2VQE C;  2DYJ A;  2KZF A;  4JI5 C;  1T5H X;  1VLA A;  2JNV A;  4RM2 A;  3FCE A; 
#chains in the Genus database with same CATH homology
 4GKJ C;  2ZM6 C;  3IEU A;  5H9U A;  4ISB A;  2V7B A;  1XMO C;  3ETC A;  2EGT A;  2D27 A;  5BSV A;  1IBK C;  3T1H C;  1XNQ C;  3T1Y C;  1P7L A;  5LMN C;  5A2Q D;  3A9V A;  4DCV A;  5A19 A;  3R9W A;  4LF4 C;  4IR7 A;  3OTO C;  5BUR A;  1ML8 A;  3PRO C;  4LF9 C;  2OO4 A;  4IZ6 A;  3I07 A;  4BSZ A;  1USP A;  1HH2 P;  5KEI A;  5BR8 C;  2DPL A;  3GKU A;  2UXB C;  4KHP C;  1O9T A;  5JRH A;  1MXB A;  4FTF A;  4X66 C;  2YWC A;  2E0G A;  4TPS B;  4YY3 C;  3R44 A;  4DCT A;  3VNS A;  1L2F A;  1PG3 A;  1HR0 C;  3PES A;  4NOZ A;  1I94 C;  2AYA A;  2UXC C;  4OXI A;  4MH4 A;  2CXC A;  2VQF C;  3IEV A;  1YJ7 A;  3DHV A;  1HNW C;  4L2Z A;  3L8C A;  1N34 C;  2VSQ A;  1USP B;  2OPL A;  4DV5 C;  4AQY C;  2ASB A;  4DV7 C;  4JI0 C;  1QWI A;  4NXN C;  4B3S C;  4LF6 C;  2D1S A;  4DUZ C;  2D1T A;  1PG4 A;  2PT7 G;  4PZP A;  4X64 C;  4DR3 C;  2ATW A;  2E7G A;  3CJE A;  5KYT A;  4LE5 A;  4BC7 A;  2QVY X;  2E5L C;  1MD9 A;  1AMU A;  2Y27 A;  3CW8 X;  4JI4 C;  1RG9 A;  3G7S A;  2D28 C;  1WH9 A;  3IPL A;  2UUC C;  5KYV A;  4DR2 C;  2P2M A;  1FJG C;  4JI6 C;  5A1I A;  3RG2 A;  1LCI A;  5AE1 A;  3TUF A;  4ODJ A;  1MKY A;  2ONF A;  2YCB A;  4X65 C;  2P2B A;  1ZB8 A;  4JM1 A;  2E8C A;  5BSR A;  3JAM D;  4GXR A;  3C5E A;  4JI3 C;  4D4I A;  4JI7 C;  2P2F A;  3LGX A;  5BSU A;  5BSM A;  5BSW A;  3LNV A;  4KTV A;  3GR0 A;  1V25 A;  2VZE A;  4K0B A;  2D1Q A;  4PHT A;  4U5Y D;  4DR5 C;  4DUY C;  1MDB A;  4DV6 C;  4LFC C;  2P2Q A;  5AE2 A;  1RY2 A;  1KKG A;  1O93 A;  3TDE A;  3A4I A;  4HPV A;  4LFB C;  3I08 A;  2PRO A;  2XR1 A;  3L95 X;  1QM4 A;  2E8F A;  3E7X A;  1IBL C;  2BH1 X;  3NI2 A;  4ZJZ A;  2QW0 X;  1BA3 A;  1MDF A;  4JYA C;  4R1L A;  1ZB9 A;  4FUQ A;  4DV1 C;  1HNX C;  1V26 A;  4OYC A;  5FLX D;  3CW9 A;  1N2F A;  4D57 A;  5AE3 A;  5GTD A;  4LF8 C;  3J80 D;  3AF5 A;  4WS9 A;  5CZX A;  5E7Q A;  3TQI A;  4I9F A;  1GPM A;  1EGA A;  5K8F A;  3S82 A;  1UKK A;  2UUA C;  4DR7 C;  3H2T A;  3N54 B;  2UXD C;  4DG8 A;  1PA4 A;  1N36 C;  2QVZ X;  3R9X A;  4RM3 A;  4ZLP A;  4JI2 C;  2P2J A;  4K0K C;  1J5E C;  4DR6 C;  3GPC A;  2QVX X;  4JI8 C;  1XRB A;  3B7W A;  1N33 C;  4NXM C;  3UOW A;  4L7I A;  2CY1 A;  1MXA A;  1T5D X;  1XRA A;  4MTN A;  2BJO A;  4R0M A;  1K0R A;  1LQL A;  4L4Q A;  1ULT A;  1XMQ C;  4B3R C;  2PN2 A;  5ADZ A;  5T8T A;  3J81 D;  5BUQ A;  4XX2 A;  5DV9 A;  4BC9 A;  3VNR A;  5CZV A;  4GS5 A;  4RLF A;  5A1G A;  2HHH C;  3DAY A;  4GKK C;  1MXC A;  1HNZ C;  3RV2 A;  3DLP X;  4DV2 C;  4D4G A;  3N2Q A;  3LUS A;  5IWA C;  4WV3 A;  4JV5 C;  3VNQ A;  5LMU C;  4B3T C;  4X62 C;  3GR1 A;  4DV0 C;  1XNR C;  5T8S A;  4LFA C;  1JOS A;  3NYQ A;  4G1I A;  5K85 A;  3NPD A;  5IT9 D;  4BBY A;  2QL8 A;  4EAT A;  3UZ0 A;  1IBM C;  4LF7 C;  2WD9 A;  3A9U A;  2HJG A;  1NYE A;  3IML A;  3AF6 A;  2Y4O A;  4FUT A;  4NDN A;  2JMP A;  3SO4 A;  5IFI A;  3PBK A;  4G37 A;  4GXQ A;  2YWB A;  3EQ6 A;  4OX9 C;  4D56 A;  4DCS A;  2P02 A;  3FCC A;  4G36 A;  4RVN A;  3E7W A;  4DR1 C;  1O92 A;  1XRC A;  4RMN A;  2D7V A;  2OBV A;  4RVO A;  2F4V C;  4R1M A;  5BST A;  2E8E A;  4YHH C;  2D1R A;  4RLQ A;  4DV4 C;  4DR4 C;  4JI1 C;  1O90 A;  4BCA A;  3EER A;  2UU9 C;  3KXW A;  2P20 A;  1FUG A;  3LAX A;  2UUB C;  4KTT A;  1WF3 A;  3NYR A;  4LF5 C;  4DV3 C;  2Y4N A;  4DCU A;  1N32 C;  4DG9 A;  4B3M C;  2WP0 C;  5BUS A;  2OPL B;  4PRO C;  3ETO A;  4I9G A;  2VQE C;  2DYJ A;  2KZF A;  4JI5 C;  1T5H X;  1VLA A;  4RM2 A;  3FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...