3TUFA

Structure of the spoiiq-spoiiiah pore forming complex.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
DDLFTTYRLDLEDARSKEREELNAIVSSDDATAKEKSEAYDKMTALSEVEGTEKQLETLIKTQGYEDALVNAEGDKINITVKSDKHSKSKATAIIDLVAKEIKTMKDVAVTFEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stage II sporulation protein Q
publication title Structure of components of an intercellular channel complex in sporulating Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Signaling protein
total genus 42
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2011-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.270 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3tufA00
3UZ0A 3TUFA
chains in the Genus database with same CATH superfamily
4BBYA 2ZZMA 4PHTA 5IFIA 4B3RC 3R9XA 3AY0A 4LF7C 3TR3A 1M6XC 1YJ7A 3RV2A 1N34C 4X64C 4DV3C 1ZB8A 3UX2A 4JI7C 3SO4A 1V26A 2ZM6C 4LF5C 2VSQA 1MKYA 5BR8C 1WH9A 4L7IA 4X66C 1M6XA 4WS9A 4RLQA 2YX1A 2QVXX 4DR3C 4DG8A 2YCBA 2JMPA 4LF9C 1J5EC 2VZEA 3LAXA 4GXQA 2P02A 2D7VA 1MXAA 4U5YD 2VQFC 2ONFA 4DV5C 4RVNA 1MXBA 4D4GA 5E7QA 1XNQC 2M5OA 2YWBA 4JI4C 5KYTA 1VEHA 1MXCA 2F4VC 4I9GA 1K0RA 2UXCC 1L2FA 5KYVA 3L95X 1XNRC 1QM4A 1RG9A 1XRAA 2NCLA 2E7GA 3C5EA 4B3SC 4PZPA 3RG2A 1O90A 4NXMC 4G37A 4JI0C 4D56A 5CZVA 4JI8C 3I08A 4RM3A 4DR2C 3E7WA 1MD9A 4PROC 1P7LA 1USPB 4DCVA 4DV1C 4ZJZA 5H9UA 5LMUC 1LCIA 4LFCC 4DV7C 3UX3A 1MDBA 4PUHA 5KEIA 3NYRA 1NY8A 2DYJA 3EQ6A 3A4IA 4ODJA 4GS5A 2BH1X 3LNVA 3IEUA 3S82A 1WCJA 2HHHC 1FUGA 2CXCA 3CQ3A 4KHPC 3EERA 3VNQA 5A2QD 2KZFA 4OX9C 1VLAA 1I94C 4JI6C 4DV0C 3PBKA 2UUBC 4RMNA 4PUGA 1IB8A 4G1IA 4AQYC 4OXIA 5A19A 3JAMD 1TH5A 1RY2A 4FUTA 2Y4OA 4DR7C 3CW9A 2P20A 1PG4A 4YY3C 4LF8C 4FUQA 2P2FA 5AE2A 5FLXD 1IBMC 4NDNA 2P2QA 1BA3A 2OPLA 4JYAC 3I07A 1IBLC 3A26A 5BSVA 2UU9C 4JI1C 4BCAA 5JRHA 5LCIA 2D1SA 1XMOC 1HNZC 1ML8A 2ZZNA 3NI2A 1PA4A 2UXBC 3GR1A 4DUZC 1JOSA 2DPLA 1N36C 4RM2A 4GXRA 3GR0A 4D57A 2YWCA 5BUQA 4OYCA 2ASBA 3G7SA 2PT7G 3UZ0A 3H2TA 3B7WA 3CW8X 1XS3A 4L4QA 2M5HA 5ADZA 1FJGC 1GPMA 5AE1A 1UKKA 3PESA 5DV9A 1XRCA 4YHHC 2V7BA 5GTDA 2UXDC 4K0KC 4B3TC 3LUSA 4NXNC 2E8EA 1IBKC 1XMQC 3CQ1A 3IEVA 2VQEC 3K6RA 1XRBA 3UEBA 4IZ6A 3DAYA 4DG9A 4LFBC 1PG3A 4LF6C 3J81D 4ZLPA 1ULTA 1QWIA 2MM9A 4LFAC 1N32C 2KDNA 4DV6C 2UUCC 4RLFA 3N2QA 3T1HC 1T5HX 3A25A 5BSWA 4JV5C 4LE5A 3VNSA 4D4IA 5IT9D 3TUFA 5BSUA 5CZXA 2Z51A 3A9VA 4KTTA 3T1YC 4DCTA 5BURA 2CU6A 2BJOA 2QVYX 1LQLA 3FCCA 3NYQA 4JI2C 2KZ0A 1PU1A 5T8TA 2JNVA 4R1LA 1P4EC 3AF6A 4JI5C 3PROC 2OPLB 1HR0C 3L8CA 2PROA 4NOZA 1XHJA 4FTFA 2WP0C 1HNWC 4DR5C 5K85A 2P2MA 4EATA 2D28C 4GKKC 3J80D 3OTOC 3CQ2A 1FLOA 3E7XA 4DUYC 1P4EA 2OBVA 4X65C 3A9UA 1HH2P 3NPDA 1O93A 3IPLA 4K0BA 3UOWA 2Y4NA 3AF5A 5A1GA 3ETCA 4R1MA 4JI3C 3IMLA 3TDEA 1ZB9A 4BC9A 1KKGA 2D1RA 3DLPX 3FCEA 1N33C 5BUSA 4BC7A 4BSZA 1V25A 1N2FA 5AE3A 2WD9A 4DV4C 2MMAB 4DR1C 2ATWA 1NYEA 1MDFA 2PN2A 2E5LC 4G36A 2D27A 2MCQA 2OO4A 2D1QA 4GKJC 3ETOA 2DHMA 4DCSA 2P2JA 4KTVA 2HJGA 3R44A 1O92A 3O2EA 1AMUA 2XR1A 1V60A 1EGAA 3N54B 2EGTA 4RVOA 4L2ZA 1UWDA 5BSRA 3CJEA 4XX2A 2E8CA 2QW0X 3KXWA 2Y27A 2E8FA 4B3MC 3R9WA 5A1IA 3TQIA 2D1TA 5LMNC 4PUIA 2CY1A 5T8SA 4DR4C 1O9TA 1WF3A 4DR6C 2QL8A 1HNXC 4DCUA 3VNRA 2E0GA 5BSTA 4IR7A 4ISBA 2AYAA 4WV3A 3GPCA 3LGXA 4MTNA 2UUAC 1USPA 2QVZX 4TPSB 4JM1A 3GKUA 3DHVA 3LNOA 1T5DX 5BSMA 4I9FA 5IWAC 4MH4A 2P2BA 4LF4C 4HPVA 4R0MA 4DV2C 4X62C 5K8FA
chains in the Genus database with same CATH topology
4BBYA 4PHTA 5IFIA 4B3RC 3R9XA 4LF7C 1YJ7A 3RV2A 1N34C 4X64C 4DV3C 1ZB8A 4JI7C 3SO4A 1V26A 2ZM6C 4LF5C 2VSQA 1MKYA 5BR8C 1WH9A 4L7IA 4X66C 4WS9A 4RLQA 2QVXX 4DR3C 4DG8A 2YCBA 2JMPA 4LF9C 1J5EC 2VZEA 3LAXA 4GXQA 2P02A 2D7VA 1MXAA 4U5YD 2VQFC 2ONFA 4DV5C 4RVNA 1MXBA 4D4GA 5E7QA 1XNQC 2YWBA 4JI4C 5KYTA 1MXCA 2F4VC 4I9GA 1K0RA 2UXCC 1L2FA 5KYVA 3L95X 1XNRC 1QM4A 1RG9A 1XRAA 2E7GA 3C5EA 4B3SC 4PZPA 3RG2A 1O90A 4NXMC 4G37A 4JI0C 4D56A 5CZVA 4JI8C 3I08A 4RM3A 4DR2C 3E7WA 1MD9A 4PROC 1P7LA 1USPB 4DCVA 4DV1C 4ZJZA 5H9UA 5LMUC 1LCIA 4LFCC 4DV7C 1MDBA 5KEIA 3NYRA 2DYJA 3EQ6A 3A4IA 4ODJA 4GS5A 2BH1X 3LNVA 3IEUA 3S82A 2HHHC 1FUGA 2CXCA 4KHPC 3EERA 3VNQA 5A2QD 2KZFA 4OX9C 1VLAA 1I94C 4JI6C 4DV0C 3PBKA 2UUBC 4RMNA 4G1IA 4AQYC 4OXIA 5A19A 3JAMD 1RY2A 4FUTA 2Y4OA 4DR7C 3CW9A 2P20A 1PG4A 4YY3C 4LF8C 4FUQA 2P2FA 5AE2A 5FLXD 1IBMC 4NDNA 2P2QA 1BA3A 2OPLA 4JYAC 3I07A 1IBLC 5BSVA 2UU9C 4JI1C 4BCAA 5JRHA 2D1SA 1XMOC 1HNZC 1ML8A 3NI2A 1PA4A 2UXBC 3GR1A 4DUZC 1JOSA 2DPLA 1N36C 4RM2A 4GXRA 3GR0A 4D57A 2YWCA 5BUQA 4OYCA 2ASBA 3G7SA 2PT7G 3UZ0A 3H2TA 3B7WA 3CW8X 4L4QA 5ADZA 1FJGC 1GPMA 5AE1A 1UKKA 3PESA 5DV9A 1XRCA 4YHHC 2V7BA 5GTDA 2UXDC 4K0KC 4B3TC 3LUSA 4NXNC 2E8EA 1IBKC 1XMQC 3IEVA 2VQEC 1XRBA 4IZ6A 3DAYA 4DG9A 4LFBC 1PG3A 4LF6C 3J81D 4ZLPA 1ULTA 1QWIA 4LFAC 1N32C 4DV6C 2UUCC 4RLFA 3N2QA 3T1HC 1T5HX 5BSWA 4JV5C 4LE5A 3VNSA 4D4IA 5IT9D 3TUFA 5BSUA 5CZXA 3A9VA 4KTTA 3T1YC 4DCTA 5BURA 2BJOA 2QVYX 1LQLA 3FCCA 3NYQA 4JI2C 5T8TA 4R1LA 3AF6A 4JI5C 3PROC 2OPLB 1HR0C 3L8CA 2PROA 4NOZA 4FTFA 2WP0C 1HNWC 4DR5C 5K85A 2P2MA 4EATA 2D28C 4GKKC 3J80D 3OTOC 3E7XA 4DUYC 2OBVA 4X65C 3A9UA 1HH2P 3NPDA 1O93A 3IPLA 4K0BA 3UOWA 2Y4NA 3AF5A 5A1GA 3ETCA 4R1MA 4JI3C 3IMLA 3TDEA 1ZB9A 4BC9A 1KKGA 2D1RA 3DLPX 3FCEA 1N33C 5BUSA 4BC7A 4BSZA 1V25A 1N2FA 5AE3A 2WD9A 4DV4C 4DR1C 2ATWA 1NYEA 1MDFA 2PN2A 2E5LC 4G36A 2D27A 2OO4A 2D1QA 4GKJC 3ETOA 4DCSA 2P2JA 4KTVA 2HJGA 3R44A 1O92A 1AMUA 2XR1A 1EGAA 3N54B 2EGTA 4RVOA 4L2ZA 5BSRA 3CJEA 4XX2A 2E8CA 2QW0X 3KXWA 2Y27A 2E8FA 4B3MC 3R9WA 5A1IA 3TQIA 2D1TA 5LMNC 2CY1A 5T8SA 4DR4C 1O9TA 1WF3A 4DR6C 2QL8A 1HNXC 4DCUA 3VNRA 2E0GA 5BSTA 4IR7A 4ISBA 2AYAA 4WV3A 3GPCA 3LGXA 4MTNA 2UUAC 1USPA 2QVZX 4TPSB 4JM1A 3GKUA 3DHVA 1T5DX 5BSMA 4I9FA 5IWAC 4MH4A 2P2BA 4LF4C 4HPVA 4R0MA 4DV2C 4X62C 5K8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UZ0 A;  3TUF A; 
#chains in the Genus database with same CATH topology
 4BBY A;  2ZZM A;  4PHT A;  5IFI A;  4B3R C;  3R9X A;  3AY0 A;  4LF7 C;  3TR3 A;  1M6X C;  1YJ7 A;  3RV2 A;  1N34 C;  4X64 C;  4DV3 C;  1ZB8 A;  3UX2 A;  4JI7 C;  3SO4 A;  1V26 A;  2ZM6 C;  4LF5 C;  2VSQ A;  1MKY A;  5BR8 C;  1WH9 A;  4L7I A;  4X66 C;  1M6X A;  4WS9 A;  4RLQ A;  2YX1 A;  2QVX X;  4DR3 C;  4DG8 A;  2YCB A;  2JMP A;  4LF9 C;  1J5E C;  2VZE A;  3LAX A;  4GXQ A;  2P02 A;  2D7V A;  1MXA A;  4U5Y D;  2VQF C;  2ONF A;  4DV5 C;  4RVN A;  1MXB A;  4D4G A;  5E7Q A;  1XNQ C;  2M5O A;  2YWB A;  4JI4 C;  5KYT A;  1VEH A;  1MXC A;  2F4V C;  4I9G A;  1K0R A;  2UXC C;  1L2F A;  5KYV A;  3L95 X;  1XNR C;  1QM4 A;  1RG9 A;  1XRA A;  2NCL A;  2E7G A;  3C5E A;  4B3S C;  4PZP A;  3RG2 A;  1O90 A;  4NXM C;  4G37 A;  4JI0 C;  4D56 A;  5CZV A;  4JI8 C;  3I08 A;  4RM3 A;  4DR2 C;  3E7W A;  1MD9 A;  4PRO C;  1P7L A;  1USP B;  4DCV A;  4DV1 C;  4ZJZ A;  5H9U A;  5LMU C;  1LCI A;  4LFC C;  4DV7 C;  3UX3 A;  1MDB A;  4PUH A;  5KEI A;  3NYR A;  1NY8 A;  2DYJ A;  3EQ6 A;  3A4I A;  4ODJ A;  4GS5 A;  2BH1 X;  3LNV A;  3IEU A;  3S82 A;  1WCJ A;  2HHH C;  1FUG A;  2CXC A;  3CQ3 A;  4KHP C;  3EER A;  3VNQ A;  5A2Q D;  2KZF A;  4OX9 C;  1VLA A;  1I94 C;  4JI6 C;  4DV0 C;  3PBK A;  2UUB C;  4RMN A;  4PUG A;  1IB8 A;  4G1I A;  4AQY C;  4OXI A;  5A19 A;  3JAM D;  1TH5 A;  1RY2 A;  4FUT A;  2Y4O A;  4DR7 C;  3CW9 A;  2P20 A;  1PG4 A;  4YY3 C;  4LF8 C;  4FUQ A;  2P2F A;  5AE2 A;  5FLX D;  1IBM C;  4NDN A;  2P2Q A;  1BA3 A;  2OPL A;  4JYA C;  3I07 A;  1IBL C;  3A26 A;  5BSV A;  2UU9 C;  4JI1 C;  4BCA A;  5JRH A;  5LCI A;  2D1S A;  1XMO C;  1HNZ C;  1ML8 A;  2ZZN A;  3NI2 A;  1PA4 A;  2UXB C;  3GR1 A;  4DUZ C;  1JOS A;  2DPL A;  1N36 C;  4RM2 A;  4GXR A;  3GR0 A;  4D57 A;  2YWC A;  5BUQ A;  4OYC A;  2ASB A;  3G7S A;  2PT7 G;  3UZ0 A;  3H2T A;  3B7W A;  3CW8 X;  1XS3 A;  4L4Q A;  2M5H A;  5ADZ A;  1FJG C;  1GPM A;  5AE1 A;  1UKK A;  3PES A;  5DV9 A;  1XRC A;  4YHH C;  2V7B A;  5GTD A;  2UXD C;  4K0K C;  4B3T C;  3LUS A;  4NXN C;  2E8E A;  1IBK C;  1XMQ C;  3CQ1 A;  3IEV A;  2VQE C;  3K6R A;  1XRB A;  3UEB A;  4IZ6 A;  3DAY A;  4DG9 A;  4LFB C;  1PG3 A;  4LF6 C;  3J81 D;  4ZLP A;  1ULT A;  1QWI A;  2MM9 A;  4LFA C;  1N32 C;  2KDN A;  4DV6 C;  2UUC C;  4RLF A;  3N2Q A;  3T1H C;  1T5H X;  3A25 A;  5BSW A;  4JV5 C;  4LE5 A;  3VNS A;  4D4I A;  5IT9 D;  3TUF A;  5BSU A;  5CZX A;  2Z51 A;  3A9V A;  4KTT A;  3T1Y C;  4DCT A;  5BUR A;  2CU6 A;  2BJO A;  2QVY X;  1LQL A;  3FCC A;  3NYQ A;  4JI2 C;  2KZ0 A;  1PU1 A;  5T8T A;  2JNV A;  4R1L A;  1P4E C;  3AF6 A;  4JI5 C;  3PRO C;  2OPL B;  1HR0 C;  3L8C A;  2PRO A;  4NOZ A;  1XHJ A;  4FTF A;  2WP0 C;  1HNW C;  4DR5 C;  5K85 A;  2P2M A;  4EAT A;  2D28 C;  4GKK C;  3J80 D;  3OTO C;  3CQ2 A;  1FLO A;  3E7X A;  4DUY C;  1P4E A;  2OBV A;  4X65 C;  3A9U A;  1HH2 P;  3NPD A;  1O93 A;  3IPL A;  4K0B A;  3UOW A;  2Y4N A;  3AF5 A;  5A1G A;  3ETC A;  4R1M A;  4JI3 C;  3IML A;  3TDE A;  1ZB9 A;  4BC9 A;  1KKG A;  2D1R A;  3DLP X;  3FCE A;  1N33 C;  5BUS A;  4BC7 A;  4BSZ A;  1V25 A;  1N2F A;  5AE3 A;  2WD9 A;  4DV4 C;  2MMA B;  4DR1 C;  2ATW A;  1NYE A;  1MDF A;  2PN2 A;  2E5L C;  4G36 A;  2D27 A;  2MCQ A;  2OO4 A;  2D1Q A;  4GKJ C;  3ETO A;  2DHM A;  4DCS A;  2P2J A;  4KTV A;  2HJG A;  3R44 A;  1O92 A;  3O2E A;  1AMU A;  2XR1 A;  1V60 A;  1EGA A;  3N54 B;  2EGT A;  4RVO A;  4L2Z A;  1UWD A;  5BSR A;  3CJE A;  4XX2 A;  2E8C A;  2QW0 X;  3KXW A;  2Y27 A;  2E8F A;  4B3M C;  3R9W A;  5A1I A;  3TQI A;  2D1T A;  5LMN C;  4PUI A;  2CY1 A;  5T8S A;  4DR4 C;  1O9T A;  1WF3 A;  4DR6 C;  2QL8 A;  1HNX C;  4DCU A;  3VNR A;  2E0G A;  5BST A;  4IR7 A;  4ISB A;  2AYA A;  4WV3 A;  3GPC A;  3LGX A;  4MTN A;  2UUA C;  1USP A;  2QVZ X;  4TPS B;  4JM1 A;  3GKU A;  3DHV A;  3LNO A;  1T5D X;  5BSM A;  4I9F A;  5IWA C;  4MH4 A;  2P2B A;  4LF4 C;  4HPV A;  4R0M A;  4DV2 C;  4X62 C;  5K8F A; 
#chains in the Genus database with same CATH homology
 4BBY A;  4PHT A;  5IFI A;  4B3R C;  3R9X A;  4LF7 C;  1YJ7 A;  3RV2 A;  1N34 C;  4X64 C;  4DV3 C;  1ZB8 A;  4JI7 C;  3SO4 A;  1V26 A;  2ZM6 C;  4LF5 C;  2VSQ A;  1MKY A;  5BR8 C;  1WH9 A;  4L7I A;  4X66 C;  4WS9 A;  4RLQ A;  2QVX X;  4DR3 C;  4DG8 A;  2YCB A;  2JMP A;  4LF9 C;  1J5E C;  2VZE A;  3LAX A;  4GXQ A;  2P02 A;  2D7V A;  1MXA A;  4U5Y D;  2VQF C;  2ONF A;  4DV5 C;  4RVN A;  1MXB A;  4D4G A;  5E7Q A;  1XNQ C;  2YWB A;  4JI4 C;  5KYT A;  1MXC A;  2F4V C;  4I9G A;  1K0R A;  2UXC C;  1L2F A;  5KYV A;  3L95 X;  1XNR C;  1QM4 A;  1RG9 A;  1XRA A;  2E7G A;  3C5E A;  4B3S C;  4PZP A;  3RG2 A;  1O90 A;  4NXM C;  4G37 A;  4JI0 C;  4D56 A;  5CZV A;  4JI8 C;  3I08 A;  4RM3 A;  4DR2 C;  3E7W A;  1MD9 A;  4PRO C;  1P7L A;  1USP B;  4DCV A;  4DV1 C;  4ZJZ A;  5H9U A;  5LMU C;  1LCI A;  4LFC C;  4DV7 C;  1MDB A;  5KEI A;  3NYR A;  2DYJ A;  3EQ6 A;  3A4I A;  4ODJ A;  4GS5 A;  2BH1 X;  3LNV A;  3IEU A;  3S82 A;  2HHH C;  1FUG A;  2CXC A;  4KHP C;  3EER A;  3VNQ A;  5A2Q D;  2KZF A;  4OX9 C;  1VLA A;  1I94 C;  4JI6 C;  4DV0 C;  3PBK A;  2UUB C;  4RMN A;  4G1I A;  4AQY C;  4OXI A;  5A19 A;  3JAM D;  1RY2 A;  4FUT A;  2Y4O A;  4DR7 C;  3CW9 A;  2P20 A;  1PG4 A;  4YY3 C;  4LF8 C;  4FUQ A;  2P2F A;  5AE2 A;  5FLX D;  1IBM C;  4NDN A;  2P2Q A;  1BA3 A;  2OPL A;  4JYA C;  3I07 A;  1IBL C;  5BSV A;  2UU9 C;  4JI1 C;  4BCA A;  5JRH A;  2D1S A;  1XMO C;  1HNZ C;  1ML8 A;  3NI2 A;  1PA4 A;  2UXB C;  3GR1 A;  4DUZ C;  1JOS A;  2DPL A;  1N36 C;  4RM2 A;  4GXR A;  3GR0 A;  4D57 A;  2YWC A;  5BUQ A;  4OYC A;  2ASB A;  3G7S A;  2PT7 G;  3UZ0 A;  3H2T A;  3B7W A;  3CW8 X;  4L4Q A;  5ADZ A;  1FJG C;  1GPM A;  5AE1 A;  1UKK A;  3PES A;  5DV9 A;  1XRC A;  4YHH C;  2V7B A;  5GTD A;  2UXD C;  4K0K C;  4B3T C;  3LUS A;  4NXN C;  2E8E A;  1IBK C;  1XMQ C;  3IEV A;  2VQE C;  1XRB A;  4IZ6 A;  3DAY A;  4DG9 A;  4LFB C;  1PG3 A;  4LF6 C;  3J81 D;  4ZLP A;  1ULT A;  1QWI A;  4LFA C;  1N32 C;  4DV6 C;  2UUC C;  4RLF A;  3N2Q A;  3T1H C;  1T5H X;  5BSW A;  4JV5 C;  4LE5 A;  3VNS A;  4D4I A;  5IT9 D;  3TUF A;  5BSU A;  5CZX A;  3A9V A;  4KTT A;  3T1Y C;  4DCT A;  5BUR A;  2BJO A;  2QVY X;  1LQL A;  3FCC A;  3NYQ A;  4JI2 C;  5T8T A;  4R1L A;  3AF6 A;  4JI5 C;  3PRO C;  2OPL B;  1HR0 C;  3L8C A;  2PRO A;  4NOZ A;  4FTF A;  2WP0 C;  1HNW C;  4DR5 C;  5K85 A;  2P2M A;  4EAT A;  2D28 C;  4GKK C;  3J80 D;  3OTO C;  3E7X A;  4DUY C;  2OBV A;  4X65 C;  3A9U A;  1HH2 P;  3NPD A;  1O93 A;  3IPL A;  4K0B A;  3UOW A;  2Y4N A;  3AF5 A;  5A1G A;  3ETC A;  4R1M A;  4JI3 C;  3IML A;  3TDE A;  1ZB9 A;  4BC9 A;  1KKG A;  2D1R A;  3DLP X;  3FCE A;  1N33 C;  5BUS A;  4BC7 A;  4BSZ A;  1V25 A;  1N2F A;  5AE3 A;  2WD9 A;  4DV4 C;  4DR1 C;  2ATW A;  1NYE A;  1MDF A;  2PN2 A;  2E5L C;  4G36 A;  2D27 A;  2OO4 A;  2D1Q A;  4GKJ C;  3ETO A;  4DCS A;  2P2J A;  4KTV A;  2HJG A;  3R44 A;  1O92 A;  1AMU A;  2XR1 A;  1EGA A;  3N54 B;  2EGT A;  4RVO A;  4L2Z A;  5BSR A;  3CJE A;  4XX2 A;  2E8C A;  2QW0 X;  3KXW A;  2Y27 A;  2E8F A;  4B3M C;  3R9W A;  5A1I A;  3TQI A;  2D1T A;  5LMN C;  2CY1 A;  5T8S A;  4DR4 C;  1O9T A;  1WF3 A;  4DR6 C;  2QL8 A;  1HNX C;  4DCU A;  3VNR A;  2E0G A;  5BST A;  4IR7 A;  4ISB A;  2AYA A;  4WV3 A;  3GPC A;  3LGX A;  4MTN A;  2UUA C;  1USP A;  2QVZ X;  4TPS B;  4JM1 A;  3GKU A;  3DHV A;  1T5D X;  5BSM A;  4I9F A;  5IWA C;  4MH4 A;  2P2B A;  4LF4 C;  4HPV A;  4R0M A;  4DV2 C;  4X62 C;  5K8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...