5LCIA

Solution structure of bola1 from homo sapiens
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
88
structure length
88
Chain Sequence
PVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords BolA-like protein 1
publication title Mitochondrial Bol1 and Bol3 function as assembly factors for specific iron-sulfur proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 5lciA00
4PUGA 3TR3A 4PUHA 2NCLA 2MM9A 2KDNA 1V60A 5LCIA 2MMAB 4PUIA 3O2EA 2MCQA 2DHMA 2KZ0A 1NY8A 1XS3A
chains in the Genus database with same CATH superfamily
5ADZA 4DR5C 4DV4C 5A1IA 1ZB9A 4DCSA 4OX9C 5BSVA 3DHVA 3ETOA 3AF6A 1IBKC 3GPCA 4G37A 2OBVA 2VQEC 5A2QD 4ISBA 1GPMA 4L4QA 4ZLPA 1XNRC 1V60A 5LCIA 1V26A 4X62C 3R9XA 3E7WA 1UWDA 2QVZX 3OTOC 3TUFA 4B3TC 3AF5A 1N32C 4B3SC 5IT9D 5E7QA 2BH1X 5A1GA 3E7XA 1NYEA 1HR0C 1MD9A 4JI0C 1KKGA 2E5LC 5BSWA 4DR7C 2E0GA 4DV5C 2OO4A 5BSRA 2KDNA 3B7WA 4GS5A 3RG2A 2ATWA 5BUQA 4R1MA 1XNQC 4PHTA 1ML8A 1T5HX 1VLAA 1UKKA 4K0BA 2DYJA 4LFCC 2D1QA 4IR7A 5BSMA 1MKYA 4BC7A 2M5HA 4LFAC 5IFIA 4B3RC 3VNSA 4DR4C 3UEBA 3EQ6A 3L8CA 4DR3C 4IZ6A 4RVOA 4GKKC 3S82A 1FLOA 2EGTA 3TDEA 4D4GA 5BUSA 2ZZNA 1HH2P 2PT7G 2E8CA 3LGXA 2D1TA 4GKJC 3VNRA 4L7IA 1PA4A 5KYVA 4KHPC 5LMUC 2HHHC 1HNZC 4DG9A 1O9TA 4FTFA 2VZEA 3PESA 1TH5A 4PUGA 2QVYX 2CU6A 2NCLA 5DV9A 1K0RA 1XHJA 3NYRA 4FUTA 3UX3A 4DCVA 5KEIA 3UOWA 3J80D 4LE5A 1PG3A 3A9VA 4DV6C 2P2MA 4ZJZA 4JI8C 3FCEA 1XMOC 2PROA 3NPDA 2ASBA 1XRBA 1WF3A 1N33C 4LF6C 2UU9C 4LF7C 3CQ1A 1LQLA 2OPLA 3TQIA 2D1RA 4D56A 5KYTA 1FJGC 4BBYA 3LNOA 4DR2C 4NXNC 3GKUA 1YJ7A 2YCBA 4NXMC 3IMLA 1QM4A 4AQYC 2P2JA 3CQ2A 2M5OA 4DG8A 2UXDC 4OXIA 3SO4A 4DCTA 3CW9A 5K85A 4RMNA 1HNXC 2MMAB 5BSTA 5CZXA 4BSZA 4U5YD 2QL8A 4HPVA 2ZM6C 2JMPA 1LCIA 5AE2A 3IEVA 2HJGA 5K8FA 2PN2A 4BCAA 2JNVA 2WD9A 3DLPX 4JI2C 2AYAA 1O90A 3ETCA 1WCJA 3I08A 3N2QA 4LF5C 3KXWA 3R9WA 3CJEA 1M6XC 4RLQA 3A26A 2Y4NA 1N2FA 5BURA 4GXQA 5JRHA 2VQFC 1EGAA 4RM2A 4X64C 5H9UA 2KZFA 4KTTA 4WV3A 5A19A 1USPA 2Z51A 3N54B 3A25A 3K6RA 2QVXX 1FUGA 3G7SA 4B3MC 1P4EC 1HNWC 1MDFA 3LNVA 3O2EA 2E7GA 3CQ3A 1BA3A 1PU1A 4X65C 1T5DX 2D27A 2CY1A 1NY8A 1IB8A 5CZVA 4PUIA 1ULTA 1MXAA 1VEHA 4MH4A 4KTVA 1USPB 5IWAC 3H2TA 3PBKA 4DR1C 4JI6C 5BSUA 4D57A 3PROC 4DV3C 1P7LA 2VSQA 3GR1A 3RV2A 2YX1A 4LF8C 5T8SA 2P02A 1QWIA 4DV2C 3C5EA 2DHMA 1J5EC 4RM3A 1XMQC 4K0KC 4LFBC 1N34C 2YWBA 2Y4OA 2E8EA 3FCCA 2D28C 1XRAA 4OYCA 2D1SA 4G1IA 4MTNA 1N36C 4RLFA 2UUBC 1I94C 4DR6C 2ZZMA 4XX2A 4G36A 2CXCA 1JOSA 3UX2A 4D4IA 1MXCA 1XRCA 1IBLC 3AY0A 3JAMD 2MM9A 2P2BA 4DCUA 1V25A 2OPLB 4JI3C 4ODJA 3I07A 3IEUA 3NYQA 3J81D 2BJOA 4PUHA 4NOZA 4R0MA 1M6XA 4JI4C 2E8FA 2XR1A 1O93A 3EERA 3IPLA 2P2FA 4DV7C 1RG9A 3LUSA 5AE3A 1MDBA 4NDNA 4PROC 3NI2A 4L2ZA 2QW0X 4TPSB 3A4IA 5FLXD 1WH9A 1ZB8A 1IBMC 2ONFA 3UZ0A 4I9GA 2Y27A 5T8TA 2UUCC 4JI5C 4JI1C 5BR8C 1P4EA 1XS3A 3GR0A 4DV0C 5GTDA 4LF9C 4EATA 1L2FA 2DPLA 4WS9A 1O92A 2F4VC 3CW8X 4FUQA 4JYAC 2UUAC 1MXBA 4DV1C 5AE1A 1AMUA 4PZPA 2D7VA 2V7BA 3T1HC 2UXBC 1RY2A 3LAXA 3DAYA 4I9FA 3L95X 2P20A 1PG4A 2UXCC 4X66C 2YWCA 4YY3C 4GXRA 4RVNA 4R1LA 3T1YC 4JM1A 2P2QA 4JI7C 4DUZC 4BC9A 5LMNC 2WP0C 3R44A 4JV5C 2MCQA 3VNQA 4DUYC 2KZ0A 3TR3A 4YHHC 3A9UA 4LF4C
chains in the Genus database with same CATH topology
4PUGA 3TR3A 4PUHA 2NCLA 2MM9A 2KDNA 1V60A 5LCIA 2MMAB 4PUIA 3O2EA 2MCQA 2DHMA 2KZ0A 1NY8A 1XS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUG A;  3TR3 A;  4PUH A;  2NCL A;  2MM9 A;  2KDN A;  1V60 A;  5LCI A;  2MMA B;  4PUI A;  3O2E A;  2MCQ A;  2DHM A;  2KZ0 A;  1NY8 A;  1XS3 A; 
#chains in the Genus database with same CATH topology
 5ADZ A;  4DR5 C;  4DV4 C;  5A1I A;  1ZB9 A;  4DCS A;  4OX9 C;  5BSV A;  3DHV A;  3ETO A;  3AF6 A;  1IBK C;  3GPC A;  4G37 A;  2OBV A;  2VQE C;  5A2Q D;  4ISB A;  1GPM A;  4L4Q A;  4ZLP A;  1XNR C;  1V60 A;  5LCI A;  1V26 A;  4X62 C;  3R9X A;  3E7W A;  1UWD A;  2QVZ X;  3OTO C;  3TUF A;  4B3T C;  3AF5 A;  1N32 C;  4B3S C;  5IT9 D;  5E7Q A;  2BH1 X;  5A1G A;  3E7X A;  1NYE A;  1HR0 C;  1MD9 A;  4JI0 C;  1KKG A;  2E5L C;  5BSW A;  4DR7 C;  2E0G A;  4DV5 C;  2OO4 A;  5BSR A;  2KDN A;  3B7W A;  4GS5 A;  3RG2 A;  2ATW A;  5BUQ A;  4R1M A;  1XNQ C;  4PHT A;  1ML8 A;  1T5H X;  1VLA A;  1UKK A;  4K0B A;  2DYJ A;  4LFC C;  2D1Q A;  4IR7 A;  5BSM A;  1MKY A;  4BC7 A;  2M5H A;  4LFA C;  5IFI A;  4B3R C;  3VNS A;  4DR4 C;  3UEB A;  3EQ6 A;  3L8C A;  4DR3 C;  4IZ6 A;  4RVO A;  4GKK C;  3S82 A;  1FLO A;  2EGT A;  3TDE A;  4D4G A;  5BUS A;  2ZZN A;  1HH2 P;  2PT7 G;  2E8C A;  3LGX A;  2D1T A;  4GKJ C;  3VNR A;  4L7I A;  1PA4 A;  5KYV A;  4KHP C;  5LMU C;  2HHH C;  1HNZ C;  4DG9 A;  1O9T A;  4FTF A;  2VZE A;  3PES A;  1TH5 A;  4PUG A;  2QVY X;  2CU6 A;  2NCL A;  5DV9 A;  1K0R A;  1XHJ A;  3NYR A;  4FUT A;  3UX3 A;  4DCV A;  5KEI A;  3UOW A;  3J80 D;  4LE5 A;  1PG3 A;  3A9V A;  4DV6 C;  2P2M A;  4ZJZ A;  4JI8 C;  3FCE A;  1XMO C;  2PRO A;  3NPD A;  2ASB A;  1XRB A;  1WF3 A;  1N33 C;  4LF6 C;  2UU9 C;  4LF7 C;  3CQ1 A;  1LQL A;  2OPL A;  3TQI A;  2D1R A;  4D56 A;  5KYT A;  1FJG C;  4BBY A;  3LNO A;  4DR2 C;  4NXN C;  3GKU A;  1YJ7 A;  2YCB A;  4NXM C;  3IML A;  1QM4 A;  4AQY C;  2P2J A;  3CQ2 A;  2M5O A;  4DG8 A;  2UXD C;  4OXI A;  3SO4 A;  4DCT A;  3CW9 A;  5K85 A;  4RMN A;  1HNX C;  2MMA B;  5BST A;  5CZX A;  4BSZ A;  4U5Y D;  2QL8 A;  4HPV A;  2ZM6 C;  2JMP A;  1LCI A;  5AE2 A;  3IEV A;  2HJG A;  5K8F A;  2PN2 A;  4BCA A;  2JNV A;  2WD9 A;  3DLP X;  4JI2 C;  2AYA A;  1O90 A;  3ETC A;  1WCJ A;  3I08 A;  3N2Q A;  4LF5 C;  3KXW A;  3R9W A;  3CJE A;  1M6X C;  4RLQ A;  3A26 A;  2Y4N A;  1N2F A;  5BUR A;  4GXQ A;  5JRH A;  2VQF C;  1EGA A;  4RM2 A;  4X64 C;  5H9U A;  2KZF A;  4KTT A;  4WV3 A;  5A19 A;  1USP A;  2Z51 A;  3N54 B;  3A25 A;  3K6R A;  2QVX X;  1FUG A;  3G7S A;  4B3M C;  1P4E C;  1HNW C;  1MDF A;  3LNV A;  3O2E A;  2E7G A;  3CQ3 A;  1BA3 A;  1PU1 A;  4X65 C;  1T5D X;  2D27 A;  2CY1 A;  1NY8 A;  1IB8 A;  5CZV A;  4PUI A;  1ULT A;  1MXA A;  1VEH A;  4MH4 A;  4KTV A;  1USP B;  5IWA C;  3H2T A;  3PBK A;  4DR1 C;  4JI6 C;  5BSU A;  4D57 A;  3PRO C;  4DV3 C;  1P7L A;  2VSQ A;  3GR1 A;  3RV2 A;  2YX1 A;  4LF8 C;  5T8S A;  2P02 A;  1QWI A;  4DV2 C;  3C5E A;  2DHM A;  1J5E C;  4RM3 A;  1XMQ C;  4K0K C;  4LFB C;  1N34 C;  2YWB A;  2Y4O A;  2E8E A;  3FCC A;  2D28 C;  1XRA A;  4OYC A;  2D1S A;  4G1I A;  4MTN A;  1N36 C;  4RLF A;  2UUB C;  1I94 C;  4DR6 C;  2ZZM A;  4XX2 A;  4G36 A;  2CXC A;  1JOS A;  3UX2 A;  4D4I A;  1MXC A;  1XRC A;  1IBL C;  3AY0 A;  3JAM D;  2MM9 A;  2P2B A;  4DCU A;  1V25 A;  2OPL B;  4JI3 C;  4ODJ A;  3I07 A;  3IEU A;  3NYQ A;  3J81 D;  2BJO A;  4PUH A;  4NOZ A;  4R0M A;  1M6X A;  4JI4 C;  2E8F A;  2XR1 A;  1O93 A;  3EER A;  3IPL A;  2P2F A;  4DV7 C;  1RG9 A;  3LUS A;  5AE3 A;  1MDB A;  4NDN A;  4PRO C;  3NI2 A;  4L2Z A;  2QW0 X;  4TPS B;  3A4I A;  5FLX D;  1WH9 A;  1ZB8 A;  1IBM C;  2ONF A;  3UZ0 A;  4I9G A;  2Y27 A;  5T8T A;  2UUC C;  4JI5 C;  4JI1 C;  5BR8 C;  1P4E A;  1XS3 A;  3GR0 A;  4DV0 C;  5GTD A;  4LF9 C;  4EAT A;  1L2F A;  2DPL A;  4WS9 A;  1O92 A;  2F4V C;  3CW8 X;  4FUQ A;  4JYA C;  2UUA C;  1MXB A;  4DV1 C;  5AE1 A;  1AMU A;  4PZP A;  2D7V A;  2V7B A;  3T1H C;  2UXB C;  1RY2 A;  3LAX A;  3DAY A;  4I9F A;  3L95 X;  2P20 A;  1PG4 A;  2UXC C;  4X66 C;  2YWC A;  4YY3 C;  4GXR A;  4RVN A;  4R1L A;  3T1Y C;  4JM1 A;  2P2Q A;  4JI7 C;  4DUZ C;  4BC9 A;  5LMN C;  2WP0 C;  3R44 A;  4JV5 C;  2MCQ A;  3VNQ A;  4DUY C;  2KZ0 A;  3TR3 A;  4YHH C;  3A9U A;  4LF4 C; 
#chains in the Genus database with same CATH homology
 4PUG A;  3TR3 A;  4PUH A;  2NCL A;  2MM9 A;  2KDN A;  1V60 A;  5LCI A;  2MMA B;  4PUI A;  3O2E A;  2MCQ A;  2DHM A;  2KZ0 A;  1NY8 A;  1XS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...