2CXCA

Crystal structure of archaeal transcription termination factor nusa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVKRARLVLSKLFGVEKVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and RNA-binding analysis of the archaeal transcription factor NusA
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transcription
molecule keywords NusA
total genus 42
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cxcA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cxcA02
4DV6C 1J5EC 4JI8C 4JI7C 1NYEA 3JAMD 4MTNA 4JV5C 2UU9C 4DR3C 4DR6C 1XNQC 1HNWC 1QWIA 3EERA 2HJGA 4DV0C 4LFAC 4DV3C 1PA4A 4XX2A 2XR1A 4DR7C 5IT9D 1ZB8A 3R9XA 4GKKC 4JI3C 4K0KC 4NXMC 5FLXD 1N34C 4DV2C 1HH2P 4YHHC 2OPLA 4BSZA 5LMNC 4LF8C 1USPA 2BJOA 4B3MC 3T1HC 2ATWA 3I07A 4DUZC 4LF7C 4LF5C 3OTOC 1FJGC 4JI1C 4JI5C 4DV1C 1I94C 1HNXC 2KZFA 1JOSA 2OPLB 4GKJC 1L2FA 4MH4A 1USPB 2D7VA 5IWAC 1IBMC 2HHHC 3R9WA 1IBKC 1UKKA 3LUSA 4X66C 3T1YC 4DCSA 2EGTA 4JI0C 4YY3C 1EGAA 1XMQC 1MKYA 2E5LC 2UXBC 2YCBA 4X64C 4B3SC 2VQFC 5LMUC 2PN2A 1IBLC 2CY1A 1HR0C 4B3TC 3GKUA 1N32C 4DV5C 2E8FA 1ZB9A 1XMOC 1K0RA 4LFCC 2UXDC 1WH9A 4X62C 4DR1C 4NXNC 4JYAC 5A2QD 4B3RC 1KKGA 2UUAC 3AF6A 4OX9C 1XNRC 1N33C 4DUYC 4DR5C 4LF4C 3AF5A 4JI2C 4DR4C 4LF6C 2UUCC 1HNZC 2UXCC 4LF9C 2VQEC 1N36C 1ML8A 2QL8A 4NOZA 2E8EA 4JI4C 2UUBC 4DR2C 2CXCA 4DCTA 1N2FA 2PT7G 4DV7C 3J81D 4KHPC 3IEUA 2E7GA 4JI6C 2ASBA 2F4VC 2E8CA 1VLAA 5BR8C 4DV4C 2JMPA 2ONFA 2ZM6C 3IEVA 1LQLA 1WF3A 4DCUA 3J80D 4X65C 3CJEA 4DCVA 4AQYC 2DYJA 4LFBC
chains in the Genus database with same CATH superfamily
4RVNA 1T5HX 1J5EC 3S82A 3A25A 4DR6C 4FUQA 2YX1A 1HNWC 3ETCA 1QWIA 1XRAA 2HJGA 3N2QA 4DR7C 4XX2A 5IT9D 5DV9A 3R9XA 4GKKC 4K0KC 3L8CA 5GTDA 2D1QA 3CW9A 5LMNC 4RVOA 1FLOA 1T5DX 2P02A 4I9GA 1HNXC 1JOSA 5A1IA 1M6XC 4L4QA 1NY8A 1O90A 1IBMC 3UX2A 4PUHA 4X66C 2EGTA 3GR1A 5E7QA 5BSRA 3CQ3A 3TUFA 4PZPA 2UXBC 2YCBA 4B3SC 1IB8A 4B3TC 1N32C 1K0RA 3FCEA 2YWBA 1MXCA 1PU1A 4KTVA 2D1RA 4DR1C 3NYRA 1O9TA 5A2QD 4B3RC 2KZ0A 3AF6A 4OX9C 1N33C 4DR5C 2QVXX 3UEBA 3CQ1A 3AF5A 2MM9A 4GXRA 5KYVA 2OBVA 2VQEC 1N36C 4LF9C 4JI4C 3VNSA 4L2ZA 5AE3A 4U5YD 5CZVA 4G37A 5H9UA 2PT7G 4PHTA 2E7GA 4JI6C 3R44A 5BR8C 4DV4C 3CQ2A 3PBKA 1WF3A 5KYTA 3J80D 3EQ6A 4K0BA 3UX3A 1V25A 4JV5C 2AYAA 2Z51A 3LGXA 2KDNA 2CU6A 1XNQC 4DV0C 2D28C 4LFAC 2D1TA 1PA4A 2XR1A 2Y27A 4JI3C 4YHHC 1UWDA 2OPLA 4BSZA 4LF8C 2JNVA 1USPA 2D1SA 2P2QA 4DUZC 5K85A 3OTOC 4L7IA 4R0MA 3DHVA 3N54B 1L2FA 2PROA 3VNRA 3DLPX 4KTTA 1PG3A 1UKKA 4DCSA 1EGAA 3NI2A 2M5OA 1FUGA 1IBLC 5BURA 4OXIA 2VZEA 1XMOC 2ZZNA 4LFCC 5BSMA 1WH9A 4BC7A 4NXNC 3ETOA 3PROC 1KKGA 4TPSB 1XNRC 1XRBA 4RM3A 5KEIA 4IZ6A 4DR4C 1P4EA 4LF6C 2UUCC 4EATA 2QVZX 2OO4A 5CZXA 4DR2C 3E7XA 2CXCA 4DV7C 3A4IA 1XS3A 5K8FA 3J81D 2ASBA 1MDFA 2MMAB 1VLAA 1VEHA 3IEVA 5BUQA 4DCUA 4PUIA 2DYJA 4DV6C 5T8TA 2Y4NA 3C5EA 5AE1A 1NYEA 4LE5A 3TQIA 4D57A 2UU9C 4DR3C 1YJ7A 1V60A 3EERA 4RLQA 4DV3C 3UZ0A 1ZB8A 2QVYX 3H2TA 4GS5A 2DHMA 2NCLA 1HH2P 2VSQA 2BJOA 3O2EA 5BSVA 4G36A 3T1HC 2DPLA 2MCQA 4LF5C 5ADZA 2ZZMA 4JI5C 4DV1C 2OPLB 1MXAA 4GKJC 4MH4A 1USPB 2D7VA 2P2FA 4OYCA 5IWAC 3LAXA 4ZLPA 5JRHA 3R9WA 2M5HA 1IBKC 3LUSA 4JI0C 1V26A 4YY3C 4R1MA 1XMQC 1MKYA 2E5LC 3A9UA 5LMUC 1LCIA 1HR0C 4RLFA 1GPMA 1O93A 3GKUA 2E8FA 1ZB9A 4GXQA 1WCJA 3IMLA 4BC9A 4I9FA 4X62C 3FCCA 5T8SA 1ULTA 3TR3A 5A19A 4FTFA 4JI2C 2P2MA 2Y4OA 1BA3A 2UXCC 1ML8A 4NDNA 4NOZA 4DG8A 3I08A 5BSWA 4DCTA 1N2FA 4PROC 4KHPC 3IEUA 4R1LA 1RY2A 2E8CA 4D56A 1MDBA 2JMPA 4ZJZA 2ZM6C 1LQLA 2BH1X 4WS9A 4DCVA 1AMUA 3CW8X 4RMNA 2P2BA 4JI8C 4JI7C 2WP0C 1P4EC 3JAMD 4MTNA 2V7BA 3A9VA 4ODJA 4RM2A 3B7WA 3E7WA 1M6XA 5BUSA 4JM1A 1RG9A 1MD9A 4NXMC 5FLXD 1N34C 4WV3A 4BCAA 4DV2C 4DG9A 1MXBA 5AE2A 4B3MC 2ATWA 1PG4A 3I07A 4LF7C 1XRCA 2E0GA 1FJGC 4JI1C 1I94C 4G1IA 2KZFA 3LNVA 3DAYA 3K6RA 2HHHC 2P2JA 3LNOA 5BSUA 3T1YC 3L95X 5IFIA 3SO4A 3GR0A 5LCIA 3TDEA 3G7SA 4X64C 4HPVA 2VQFC 2PN2A 2CY1A 4ISBA 5BSTA 3GPCA 2P20A 5A1GA 4DV5C 4IR7A 2UXDC 4JYAC 2UUAC 1QM4A 3RG2A 3VNQA 4DUYC 4LF4C 3NYQA 2D27A 3RV2A 4BBYA 4FUTA 4D4GA 3UOWA 1HNZC 4PUGA 2QL8A 3A26A 2UUBC 2E8EA 2QW0X 3KXWA 4D4IA 3PESA 3NPDA 1TH5A 2F4VC 3IPLA 2ONFA 1O92A 1XHJA 3AY0A 2YWCA 4X65C 1P7LA 3CJEA 2WD9A 4AQYC 4LFBC
chains in the Genus database with same CATH topology
4RVNA 1T5HX 1J5EC 3S82A 4DR6C 4FUQA 1HNWC 3ETCA 1QWIA 1XRAA 2HJGA 3N2QA 4DR7C 4XX2A 5IT9D 5DV9A 3R9XA 4GKKC 4K0KC 3L8CA 5GTDA 2D1QA 3CW9A 5LMNC 4RVOA 1T5DX 2P02A 4I9GA 1HNXC 1JOSA 5A1IA 4L4QA 1O90A 1IBMC 4X66C 2EGTA 3GR1A 5E7QA 5BSRA 3TUFA 4PZPA 2UXBC 2YCBA 4B3SC 4B3TC 1N32C 1K0RA 3FCEA 2YWBA 1MXCA 4KTVA 2D1RA 4DR1C 3NYRA 1O9TA 5A2QD 4B3RC 3AF6A 4OX9C 1N33C 4DR5C 2QVXX 3AF5A 4GXRA 5KYVA 2OBVA 2VQEC 1N36C 4LF9C 4JI4C 3VNSA 4L2ZA 5AE3A 4U5YD 5CZVA 4G37A 5H9UA 2PT7G 4PHTA 2E7GA 4JI6C 3R44A 5BR8C 4DV4C 3PBKA 1WF3A 5KYTA 3J80D 3EQ6A 4K0BA 1V25A 4JV5C 2AYAA 3LGXA 1XNQC 4DV0C 2D28C 4LFAC 2D1TA 1PA4A 2XR1A 2Y27A 4JI3C 4YHHC 2OPLA 4BSZA 4LF8C 1USPA 2D1SA 2P2QA 4DUZC 5K85A 3OTOC 4L7IA 4R0MA 3DHVA 3N54B 1L2FA 2PROA 3VNRA 3DLPX 4KTTA 1PG3A 1UKKA 4DCSA 1EGAA 3NI2A 1FUGA 1IBLC 5BURA 4OXIA 2VZEA 1XMOC 4LFCC 5BSMA 1WH9A 4BC7A 4NXNC 3ETOA 3PROC 1KKGA 4TPSB 1XNRC 1XRBA 4RM3A 5KEIA 4IZ6A 4DR4C 4LF6C 2UUCC 4EATA 2QVZX 2OO4A 5CZXA 4DR2C 3E7XA 2CXCA 3A4IA 5K8FA 3J81D 4DV7C 2ASBA 1MDFA 1VLAA 3IEVA 5BUQA 4DCUA 2DYJA 4DV6C 5T8TA 2Y4NA 3C5EA 5AE1A 1NYEA 4LE5A 3TQIA 4D57A 2UU9C 4DR3C 1YJ7A 3EERA 4RLQA 4DV3C 3UZ0A 1ZB8A 2QVYX 3H2TA 4GS5A 1HH2P 2VSQA 2BJOA 5BSVA 4G36A 3T1HC 2DPLA 4LF5C 5ADZA 4JI5C 4DV1C 2OPLB 1MXAA 4GKJC 4MH4A 1USPB 2D7VA 2P2FA 4OYCA 5IWAC 3LAXA 4ZLPA 5JRHA 3R9WA 1IBKC 3LUSA 4JI0C 1V26A 4YY3C 4R1MA 1XMQC 1MKYA 2E5LC 3A9UA 5LMUC 1LCIA 1HR0C 4RLFA 1GPMA 1O93A 3GKUA 2E8FA 1ZB9A 4GXQA 3IMLA 4BC9A 4I9FA 4X62C 3FCCA 5T8SA 1ULTA 5A19A 4FTFA 4JI2C 2P2MA 2Y4OA 1BA3A 2UXCC 1ML8A 4NDNA 4NOZA 4DG8A 3I08A 5BSWA 4DCTA 1N2FA 4PROC 4KHPC 3IEUA 4R1LA 1RY2A 2E8CA 4D56A 1MDBA 2JMPA 4ZJZA 2ZM6C 1LQLA 2BH1X 4WS9A 4DCVA 1AMUA 3CW8X 4RMNA 2P2BA 4JI8C 4JI7C 2WP0C 3JAMD 4MTNA 2V7BA 3A9VA 4ODJA 4RM2A 3B7WA 3E7WA 5BUSA 4JM1A 1RG9A 1MD9A 4NXMC 5FLXD 1N34C 4WV3A 4BCAA 4DV2C 4DG9A 1MXBA 5AE2A 4B3MC 2ATWA 1PG4A 3I07A 4LF7C 1XRCA 2E0GA 1FJGC 4JI1C 1I94C 4G1IA 2KZFA 3LNVA 3DAYA 2HHHC 2P2JA 5BSUA 3T1YC 3L95X 5IFIA 3SO4A 3GR0A 3TDEA 3G7SA 4X64C 4HPVA 2VQFC 2PN2A 2CY1A 4ISBA 5BSTA 3GPCA 2P20A 5A1GA 4DV5C 4IR7A 2UXDC 4JYAC 2UUAC 1QM4A 3RG2A 3VNQA 4DUYC 4LF4C 3NYQA 2D27A 3RV2A 4BBYA 4FUTA 4D4GA 3UOWA 1HNZC 2QL8A 2UUBC 2E8EA 2QW0X 3KXWA 4D4IA 3PESA 3NPDA 2F4VC 3IPLA 2ONFA 1O92A 2YWCA 4X65C 1P7LA 3CJEA 2WD9A 4AQYC 4LFBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 C;  1J5E C;  4JI8 C;  4JI7 C;  1NYE A;  3JAM D;  4MTN A;  4JV5 C;  2UU9 C;  4DR3 C;  4DR6 C;  1XNQ C;  1HNW C;  1QWI A;  3EER A;  2HJG A;  4DV0 C;  4LFA C;  4DV3 C;  1PA4 A;  4XX2 A;  2XR1 A;  4DR7 C;  5IT9 D;  1ZB8 A;  3R9X A;  4GKK C;  4JI3 C;  4K0K C;  4NXM C;  5FLX D;  1N34 C;  4DV2 C;  1HH2 P;  4YHH C;  2OPL A;  4BSZ A;  5LMN C;  4LF8 C;  1USP A;  2BJO A;  4B3M C;  3T1H C;  2ATW A;  3I07 A;  4DUZ C;  4LF7 C;  4LF5 C;  3OTO C;  1FJG C;  4JI1 C;  4JI5 C;  4DV1 C;  1I94 C;  1HNX C;  2KZF A;  1JOS A;  2OPL B;  4GKJ C;  1L2F A;  4MH4 A;  1USP B;  2D7V A;  5IWA C;  1IBM C;  2HHH C;  3R9W A;  1IBK C;  1UKK A;  3LUS A;  4X66 C;  3T1Y C;  4DCS A;  2EGT A;  4JI0 C;  4YY3 C;  1EGA A;  1XMQ C;  1MKY A;  2E5L C;  2UXB C;  2YCB A;  4X64 C;  4B3S C;  2VQF C;  5LMU C;  2PN2 A;  1IBL C;  2CY1 A;  1HR0 C;  4B3T C;  3GKU A;  1N32 C;  4DV5 C;  2E8F A;  1ZB9 A;  1XMO C;  1K0R A;  4LFC C;  2UXD C;  1WH9 A;  4X62 C;  4DR1 C;  4NXN C;  4JYA C;  5A2Q D;  4B3R C;  1KKG A;  2UUA C;  3AF6 A;  4OX9 C;  1XNR C;  1N33 C;  4DUY C;  4DR5 C;  4LF4 C;  3AF5 A;  4JI2 C;  4DR4 C;  4LF6 C;  2UUC C;  1HNZ C;  2UXC C;  4LF9 C;  2VQE C;  1N36 C;  1ML8 A;  2QL8 A;  4NOZ A;  2E8E A;  4JI4 C;  2UUB C;  4DR2 C;  2CXC A;  4DCT A;  1N2F A;  2PT7 G;  4DV7 C;  3J81 D;  4KHP C;  3IEU A;  2E7G A;  4JI6 C;  2ASB A;  2F4V C;  2E8C A;  1VLA A;  5BR8 C;  4DV4 C;  2JMP A;  2ONF A;  2ZM6 C;  3IEV A;  1LQL A;  1WF3 A;  4DCU A;  3J80 D;  4X65 C;  3CJE A;  4DCV A;  4AQY C;  2DYJ A;  4LFB C; 
#chains in the Genus database with same CATH topology
 4RVN A;  1T5H X;  1J5E C;  3S82 A;  3A25 A;  4DR6 C;  4FUQ A;  2YX1 A;  1HNW C;  3ETC A;  1QWI A;  1XRA A;  2HJG A;  3N2Q A;  4DR7 C;  4XX2 A;  5IT9 D;  5DV9 A;  3R9X A;  4GKK C;  4K0K C;  3L8C A;  5GTD A;  2D1Q A;  3CW9 A;  5LMN C;  4RVO A;  1FLO A;  1T5D X;  2P02 A;  4I9G A;  1HNX C;  1JOS A;  5A1I A;  1M6X C;  4L4Q A;  1NY8 A;  1O90 A;  1IBM C;  3UX2 A;  4PUH A;  4X66 C;  2EGT A;  3GR1 A;  5E7Q A;  5BSR A;  3CQ3 A;  3TUF A;  4PZP A;  2UXB C;  2YCB A;  4B3S C;  1IB8 A;  4B3T C;  1N32 C;  1K0R A;  3FCE A;  2YWB A;  1MXC A;  1PU1 A;  4KTV A;  2D1R A;  4DR1 C;  3NYR A;  1O9T A;  5A2Q D;  4B3R C;  2KZ0 A;  3AF6 A;  4OX9 C;  1N33 C;  4DR5 C;  2QVX X;  3UEB A;  3CQ1 A;  3AF5 A;  2MM9 A;  4GXR A;  5KYV A;  2OBV A;  2VQE C;  1N36 C;  4LF9 C;  4JI4 C;  3VNS A;  4L2Z A;  5AE3 A;  4U5Y D;  5CZV A;  4G37 A;  5H9U A;  2PT7 G;  4PHT A;  2E7G A;  4JI6 C;  3R44 A;  5BR8 C;  4DV4 C;  3CQ2 A;  3PBK A;  1WF3 A;  5KYT A;  3J80 D;  3EQ6 A;  4K0B A;  3UX3 A;  1V25 A;  4JV5 C;  2AYA A;  2Z51 A;  3LGX A;  2KDN A;  2CU6 A;  1XNQ C;  4DV0 C;  2D28 C;  4LFA C;  2D1T A;  1PA4 A;  2XR1 A;  2Y27 A;  4JI3 C;  4YHH C;  1UWD A;  2OPL A;  4BSZ A;  4LF8 C;  2JNV A;  1USP A;  2D1S A;  2P2Q A;  4DUZ C;  5K85 A;  3OTO C;  4L7I A;  4R0M A;  3DHV A;  3N54 B;  1L2F A;  2PRO A;  3VNR A;  3DLP X;  4KTT A;  1PG3 A;  1UKK A;  4DCS A;  1EGA A;  3NI2 A;  2M5O A;  1FUG A;  1IBL C;  5BUR A;  4OXI A;  2VZE A;  1XMO C;  2ZZN A;  4LFC C;  5BSM A;  1WH9 A;  4BC7 A;  4NXN C;  3ETO A;  3PRO C;  1KKG A;  4TPS B;  1XNR C;  1XRB A;  4RM3 A;  5KEI A;  4IZ6 A;  4DR4 C;  1P4E A;  4LF6 C;  2UUC C;  4EAT A;  2QVZ X;  2OO4 A;  5CZX A;  4DR2 C;  3E7X A;  2CXC A;  4DV7 C;  3A4I A;  1XS3 A;  5K8F A;  3J81 D;  2ASB A;  1MDF A;  2MMA B;  1VLA A;  1VEH A;  3IEV A;  5BUQ A;  4DCU A;  4PUI A;  2DYJ A;  4DV6 C;  5T8T A;  2Y4N A;  3C5E A;  5AE1 A;  1NYE A;  4LE5 A;  3TQI A;  4D57 A;  2UU9 C;  4DR3 C;  1YJ7 A;  1V60 A;  3EER A;  4RLQ A;  4DV3 C;  3UZ0 A;  1ZB8 A;  2QVY X;  3H2T A;  4GS5 A;  2DHM A;  2NCL A;  1HH2 P;  2VSQ A;  2BJO A;  3O2E A;  5BSV A;  4G36 A;  3T1H C;  2DPL A;  2MCQ A;  4LF5 C;  5ADZ A;  2ZZM A;  4JI5 C;  4DV1 C;  2OPL B;  1MXA A;  4GKJ C;  4MH4 A;  1USP B;  2D7V A;  2P2F A;  4OYC A;  5IWA C;  3LAX A;  4ZLP A;  5JRH A;  3R9W A;  2M5H A;  1IBK C;  3LUS A;  4JI0 C;  1V26 A;  4YY3 C;  4R1M A;  1XMQ C;  1MKY A;  2E5L C;  3A9U A;  5LMU C;  1LCI A;  1HR0 C;  4RLF A;  1GPM A;  1O93 A;  3GKU A;  2E8F A;  1ZB9 A;  4GXQ A;  1WCJ A;  3IML A;  4BC9 A;  4I9F A;  4X62 C;  3FCC A;  5T8S A;  1ULT A;  3TR3 A;  5A19 A;  4FTF A;  4JI2 C;  2P2M A;  2Y4O A;  1BA3 A;  2UXC C;  1ML8 A;  4NDN A;  4NOZ A;  4DG8 A;  3I08 A;  5BSW A;  4DCT A;  1N2F A;  4PRO C;  4KHP C;  3IEU A;  4R1L A;  1RY2 A;  2E8C A;  4D56 A;  1MDB A;  2JMP A;  4ZJZ A;  2ZM6 C;  1LQL A;  2BH1 X;  4WS9 A;  4DCV A;  1AMU A;  3CW8 X;  4RMN A;  2P2B A;  4JI8 C;  4JI7 C;  2WP0 C;  1P4E C;  3JAM D;  4MTN A;  2V7B A;  3A9V A;  4ODJ A;  4RM2 A;  3B7W A;  3E7W A;  1M6X A;  5BUS A;  4JM1 A;  1RG9 A;  1MD9 A;  4NXM C;  5FLX D;  1N34 C;  4WV3 A;  4BCA A;  4DV2 C;  4DG9 A;  1MXB A;  5AE2 A;  4B3M C;  2ATW A;  1PG4 A;  3I07 A;  4LF7 C;  1XRC A;  2E0G A;  1FJG C;  4JI1 C;  1I94 C;  4G1I A;  2KZF A;  3LNV A;  3DAY A;  3K6R A;  2HHH C;  2P2J A;  3LNO A;  5BSU A;  3T1Y C;  3L95 X;  5IFI A;  3SO4 A;  3GR0 A;  5LCI A;  3TDE A;  3G7S A;  4X64 C;  4HPV A;  2VQF C;  2PN2 A;  2CY1 A;  4ISB A;  5BST A;  3GPC A;  2P20 A;  5A1G A;  4DV5 C;  4IR7 A;  2UXD C;  4JYA C;  2UUA C;  1QM4 A;  3RG2 A;  3VNQ A;  4DUY C;  4LF4 C;  3NYQ A;  2D27 A;  3RV2 A;  4BBY A;  4FUT A;  4D4G A;  3UOW A;  1HNZ C;  4PUG A;  2QL8 A;  3A26 A;  2UUB C;  2E8E A;  2QW0 X;  3KXW A;  4D4I A;  3PES A;  3NPD A;  1TH5 A;  2F4V C;  3IPL A;  2ONF A;  1O92 A;  1XHJ A;  3AY0 A;  2YWC A;  4X65 C;  1P7L A;  3CJE A;  2WD9 A;  4AQY C;  4LFB C; 
#chains in the Genus database with same CATH homology
 4RVN A;  1T5H X;  1J5E C;  3S82 A;  4DR6 C;  4FUQ A;  1HNW C;  3ETC A;  1QWI A;  1XRA A;  2HJG A;  3N2Q A;  4DR7 C;  4XX2 A;  5IT9 D;  5DV9 A;  3R9X A;  4GKK C;  4K0K C;  3L8C A;  5GTD A;  2D1Q A;  3CW9 A;  5LMN C;  4RVO A;  1T5D X;  2P02 A;  4I9G A;  1HNX C;  1JOS A;  5A1I A;  4L4Q A;  1O90 A;  1IBM C;  4X66 C;  2EGT A;  3GR1 A;  5E7Q A;  5BSR A;  3TUF A;  4PZP A;  2UXB C;  2YCB A;  4B3S C;  4B3T C;  1N32 C;  1K0R A;  3FCE A;  2YWB A;  1MXC A;  4KTV A;  2D1R A;  4DR1 C;  3NYR A;  1O9T A;  5A2Q D;  4B3R C;  3AF6 A;  4OX9 C;  1N33 C;  4DR5 C;  2QVX X;  3AF5 A;  4GXR A;  5KYV A;  2OBV A;  2VQE C;  1N36 C;  4LF9 C;  4JI4 C;  3VNS A;  4L2Z A;  5AE3 A;  4U5Y D;  5CZV A;  4G37 A;  5H9U A;  2PT7 G;  4PHT A;  2E7G A;  4JI6 C;  3R44 A;  5BR8 C;  4DV4 C;  3PBK A;  1WF3 A;  5KYT A;  3J80 D;  3EQ6 A;  4K0B A;  1V25 A;  4JV5 C;  2AYA A;  3LGX A;  1XNQ C;  4DV0 C;  2D28 C;  4LFA C;  2D1T A;  1PA4 A;  2XR1 A;  2Y27 A;  4JI3 C;  4YHH C;  2OPL A;  4BSZ A;  4LF8 C;  1USP A;  2D1S A;  2P2Q A;  4DUZ C;  5K85 A;  3OTO C;  4L7I A;  4R0M A;  3DHV A;  3N54 B;  1L2F A;  2PRO A;  3VNR A;  3DLP X;  4KTT A;  1PG3 A;  1UKK A;  4DCS A;  1EGA A;  3NI2 A;  1FUG A;  1IBL C;  5BUR A;  4OXI A;  2VZE A;  1XMO C;  4LFC C;  5BSM A;  1WH9 A;  4BC7 A;  4NXN C;  3ETO A;  3PRO C;  1KKG A;  4TPS B;  1XNR C;  1XRB A;  4RM3 A;  5KEI A;  4IZ6 A;  4DR4 C;  4LF6 C;  2UUC C;  4EAT A;  2QVZ X;  2OO4 A;  5CZX A;  4DR2 C;  3E7X A;  2CXC A;  3A4I A;  5K8F A;  3J81 D;  4DV7 C;  2ASB A;  1MDF A;  1VLA A;  3IEV A;  5BUQ A;  4DCU A;  2DYJ A;  4DV6 C;  5T8T A;  2Y4N A;  3C5E A;  5AE1 A;  1NYE A;  4LE5 A;  3TQI A;  4D57 A;  2UU9 C;  4DR3 C;  1YJ7 A;  3EER A;  4RLQ A;  4DV3 C;  3UZ0 A;  1ZB8 A;  2QVY X;  3H2T A;  4GS5 A;  1HH2 P;  2VSQ A;  2BJO A;  5BSV A;  4G36 A;  3T1H C;  2DPL A;  4LF5 C;  5ADZ A;  4JI5 C;  4DV1 C;  2OPL B;  1MXA A;  4GKJ C;  4MH4 A;  1USP B;  2D7V A;  2P2F A;  4OYC A;  5IWA C;  3LAX A;  4ZLP A;  5JRH A;  3R9W A;  1IBK C;  3LUS A;  4JI0 C;  1V26 A;  4YY3 C;  4R1M A;  1XMQ C;  1MKY A;  2E5L C;  3A9U A;  5LMU C;  1LCI A;  1HR0 C;  4RLF A;  1GPM A;  1O93 A;  3GKU A;  2E8F A;  1ZB9 A;  4GXQ A;  3IML A;  4BC9 A;  4I9F A;  4X62 C;  3FCC A;  5T8S A;  1ULT A;  5A19 A;  4FTF A;  4JI2 C;  2P2M A;  2Y4O A;  1BA3 A;  2UXC C;  1ML8 A;  4NDN A;  4NOZ A;  4DG8 A;  3I08 A;  5BSW A;  4DCT A;  1N2F A;  4PRO C;  4KHP C;  3IEU A;  4R1L A;  1RY2 A;  2E8C A;  4D56 A;  1MDB A;  2JMP A;  4ZJZ A;  2ZM6 C;  1LQL A;  2BH1 X;  4WS9 A;  4DCV A;  1AMU A;  3CW8 X;  4RMN A;  2P2B A;  4JI8 C;  4JI7 C;  2WP0 C;  3JAM D;  4MTN A;  2V7B A;  3A9V A;  4ODJ A;  4RM2 A;  3B7W A;  3E7W A;  5BUS A;  4JM1 A;  1RG9 A;  1MD9 A;  4NXM C;  5FLX D;  1N34 C;  4WV3 A;  4BCA A;  4DV2 C;  4DG9 A;  1MXB A;  5AE2 A;  4B3M C;  2ATW A;  1PG4 A;  3I07 A;  4LF7 C;  1XRC A;  2E0G A;  1FJG C;  4JI1 C;  1I94 C;  4G1I A;  2KZF A;  3LNV A;  3DAY A;  2HHH C;  2P2J A;  5BSU A;  3T1Y C;  3L95 X;  5IFI A;  3SO4 A;  3GR0 A;  3TDE A;  3G7S A;  4X64 C;  4HPV A;  2VQF C;  2PN2 A;  2CY1 A;  4ISB A;  5BST A;  3GPC A;  2P20 A;  5A1G A;  4DV5 C;  4IR7 A;  2UXD C;  4JYA C;  2UUA C;  1QM4 A;  3RG2 A;  3VNQ A;  4DUY C;  4LF4 C;  3NYQ A;  2D27 A;  3RV2 A;  4BBY A;  4FUT A;  4D4G A;  3UOW A;  1HNZ C;  2QL8 A;  2UUB C;  2E8E A;  2QW0 X;  3KXW A;  4D4I A;  3PES A;  3NPD A;  2F4V C;  3IPL A;  2ONF A;  1O92 A;  2YWC A;  4X65 C;  1P7L A;  3CJE A;  2WD9 A;  4AQY C;  4LFB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...