2CXCA

Crystal structure of archaeal transcription termination factor nusa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
138
structure length
138
Chain Sequence
ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVKRARLVLSKLFGVEKVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NusA
publication title Crystal structure and RNA-binding analysis of the archaeal transcription factor NusA
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transcription
total genus 42
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cxcA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cxcA02
4JI5C 2JMPA 2UUAC 1HR0C 4JV5C 1WF3A 1JOSA 4DUZC 4DCSA 2OPLB 2ASBA 3GKUA 4GKJC 4JI4C 4DV1C 4DV7C 4DR4C 1QWIA 1XNRC 4B3RC 1FJGC 3CJEA 2HJGA 3R9XA 2PN2A 4DR5C 4LFCC 4DV6C 4DR6C 1VLAA 4MTNA 5BR8C 4DV2C 2F4VC 4DV5C 4DCVA 4JI0C 3I07A 1XNQC 1IBMC 2UUCC 4NXMC 1MKYA 1XMOC 3J80D 2VQEC 2XR1A 3IEUA 1ML8A 2CY1A 2ZM6C 4AQYC 2YCBA 4MH4A 4LF9C 4GKKC 4X62C 4DV0C 1ZB8A 1L2FA 2OPLA 2EGTA 4KHPC 1I94C 4LFBC 5IWAC 4JYAC 1EGAA 4DR2C 4LF6C 3T1HC 4DR3C 4OX9C 2E5LC 4LF4C 2ATWA 2BJOA 2PT7G 4JI3C 2KZFA 3EERA 4DV4C 1IBKC 2UU9C 2UUBC 1N2FA 3OTOC 2HHHC 4X66C 4DCUA 1N36C 4B3TC 4JI7C 1IBLC 1HH2P 1WH9A 4DR7C 1K0RA 2UXBC 1NYEA 1N32C 4BSZA 4YY3C 2E7GA 4X65C 1HNXC 4JI6C 3LUSA 4DUYC 1ZB9A 4LF8C 4JI8C 3AF5A 4B3MC 4K0KC 4LFAC 1LQLA 2CXCA 5FLXD 3JAMD 2UXCC 2VQFC 4NXNC 4DR1C 1HNZC 2E8EA 1UKKA 4YHHC 5IT9D 4DCTA 2ONFA 1PA4A 4JI1C 1HNWC 1N33C 3AF6A 5LMUC 2DYJA 4NOZA 4X64C 2D7VA 5A2QD 1XMQC 4LF5C 2UXDC 4LF7C 1KKGA 4DV3C 3R9WA 3IEVA 4B3SC 3T1YC 1J5EC 1USPB 4XX2A 3J81D 1N34C 4JI2C 2QL8A 2E8FA 5LMNC 2E8CA 1USPA
chains in the Genus database with same CATH superfamily
4BC9A 1HR0C 1WF3A 1JOSA 3DHVA 3K6RA 4DV1C 3LGXA 2ZZMA 3CJEA 1RY2A 4FUQA 4LFCC 1VLAA 5BR8C 3PROC 2V7BA 4DV2C 2MCQA 4JI0C 2UUCC 4NXMC 1MKYA 1MD9A 1ML8A 2CY1A 4LF9C 4X62C 4BC7A 1ZB8A 4RM2A 1I94C 4KHPC 3KXWA 2P2BA 4ISBA 2DPLA 4LF6C 4DR3C 1BA3A 4LF4C 2VSQA 5JRHA 3GR0A 2UUBC 2UU9C 3OTOC 3E7XA 4B3TC 5A19A 1IBLC 1WH9A 3A25A 4LF8C 3CQ3A 1ZB9A 4JI8C 2ZZNA 4DG8A 4K0KC 1V60A 2P2MA 4DG9A 3LNVA 2YWBA 1P7LA 2QVYX 2E8EA 4G1IA 3A9UA 2P20A 4FUTA 1XRCA 2E0GA 1HNWC 3CQ1A 4G37A 3A9VA 1ULTA 2PROA 5BUSA 3IMLA 3IEVA 3T1YC 1J5EC 2D1QA 3J81D 1N34C 3RG2A 2QL8A 5LMNC 5BSRA 5ADZA 1USPA 3TR3A 3G7SA 3RV2A 4DUZC 5K85A 2NCLA 4DV7C 4B3RC 1FJGC 4FTFA 4GXRA 4I9GA 2HJGA 3I08A 4WS9A 3R9XA 3LAXA 3DLPX 1O93A 2KZ0A 5A1GA 5LCIA 3R44A 2F4VC 1V25A 4DCVA 5KYVA 2YWCA 1XNQC 1IBMC 3C5EA 2VQEC 3UZ0A 2ZM6C 4AQYC 2YCBA 2QW0X 4R1MA 1L2FA 2OPLA 3TUFA 4LFBC 1FUGA 4RM3A 4L7IA 4ZLPA 4R0MA 1EGAA 2ATWA 5BSVA 4JI3C 1RG9A 2P2JA 4X66C 4DCUA 3GPCA 4D4IA 1N36C 3UX2A 2VZEA 3AY0A 2MM9A 1O9TA 3H2TA 1K0RA 3LNOA 2E7GA 4JI6C 3LUSA 5E7QA 5CZVA 4LFAC 1LQLA 5FLXD 1O92A 3FCCA 2VQFC 1HNZC 3CW8X 1UKKA 5H9UA 4HPVA 5T8TA 4YHHC 1TH5A 3NYQA 5IT9D 1UWDA 2ONFA 4PHTA 4L2ZA 4JI1C 3AF6A 1PU1A 4TPSB 1M6XC 4NOZA 4X64C 3E7WA 1KKGA 5KEIA 4DV3C 3A4IA 2QVZX 1MXCA 4IR7A 3PESA 4B3SC 2Y4OA 3GR1A 1MDBA 2WP0C 1AMUA 1YJ7A 2DHMA 3UEBA 5BUQA 4RLFA 2JMPA 4ODJA 2Y27A 4WV3A 2OPLB 5BSMA 4GKJC 4U5YD 4DR4C 5BSTA 1XNRC 4BCAA 3DAYA 3CW9A 5IFIA 3FCEA 4DR5C 1GPMA 4DR6C 4MTNA 4PZPA 4RMNA 4R1LA 3ETCA 3UOWA 3I07A 2OBVA 4GKKC 4DV0C 2Y4NA 3VNQA 2EGTA 2P2FA 2D27A 2D1RA 4PROC 1XS3A 1NY8A 4JYAC 4BBYA 4DR2C 2JNVA 3T1HC 1T5HX 4OX9C 4OXIA 2BJOA 2PT7G 3VNRA 2KZFA 4RLQA 4KTTA 1N2FA 5AE3A 2P2QA 2OO4A 4JI7C 4ZJZA 5KYTA 2QVXX 2UXBC 1N32C 1V26A 4YY3C 3S82A 4X65C 1HNXC 4DUYC 1QM4A 5K8FA 3AF5A 4B3MC 5BURA 2BH1X 4DR1C 2MMAB 3UX3A 5DV9A 3A26A 1P4EA 1M6XA 4IZ6A 1IB8A 1PG3A 1FLOA 4DCTA 1PA4A 4RVOA 5LMUC 1MXAA 2D7VA 1XMQC 3L8CA 4LF5C 2UXDC 4NDNA 3R9WA 1USPB 4XX2A 4JI2C 2E8FA 2D28C 4D56A 4JI5C 5AE1A 2UUAC 3N2QA 4JV5C 3VNSA 4DCSA 4RVNA 2ASBA 3GKUA 3N54B 4JI4C 1QWIA 4PUHA 1P4EC 4I9FA 5A1IA 4KTVA 4GS5A 1WCJA 2D1TA 2PN2A 3B7WA 5BSWA 4DV6C 4LE5A 4L4QA 4DV5C 2P02A 3TDEA 3PBKA 1XMOC 3J80D 1XRBA 2M5OA 2XR1A 3IEUA 4OYCA 2M5HA 1PG4A 4MH4A 1O90A 4G36A 3L95X 2YX1A 2KDNA 5IWAC 1LCIA 2Z51A 3TQIA 2E5LC 4JM1A 4PUGA 1IBKC 3EERA 4DV4C 4D4GA 2HHHC 3NPDA 4D57A 1VEHA 1T5DX 1HH2P 4DR7C 1XHJA 1NYEA 4BSZA 5GTDA 3EQ6A 5CZXA 2WD9A 3NYRA 2CXCA 3JAMD 2UXCC 2AYAA 4K0BA 4NXNC 5AE2A 3NI2A 1XRAA 3ETOA 4GXQA 5BSUA 3SO4A 1N33C 5T8SA 2DYJA 4PUIA 1MXBA 1MDFA 5A2QD 4LF7C 3IPLA 2CU6A 2D1SA 3CQ2A 4EATA 3O2EA 2E8CA
chains in the Genus database with same CATH topology
4BC9A 1HR0C 1WF3A 1JOSA 3DHVA 4DV1C 3LGXA 3CJEA 1RY2A 4FUQA 4LFCC 1VLAA 5BR8C 3PROC 2V7BA 4DV2C 4JI0C 2UUCC 4NXMC 1MKYA 1MD9A 1ML8A 2CY1A 4LF9C 4X62C 4BC7A 1ZB8A 4RM2A 1I94C 4KHPC 3KXWA 2P2BA 4ISBA 2DPLA 4LF6C 4DR3C 1BA3A 4LF4C 2VSQA 5JRHA 3GR0A 2UUBC 2UU9C 3OTOC 3E7XA 4B3TC 5A19A 1IBLC 1WH9A 4LF8C 1ZB9A 4JI8C 4DG8A 4K0KC 2P2MA 4DG9A 3LNVA 2YWBA 1P7LA 2QVYX 2E8EA 4G1IA 3A9UA 2P20A 4FUTA 1XRCA 2E0GA 1HNWC 4G37A 3A9VA 1ULTA 2PROA 5BUSA 3IMLA 3IEVA 3T1YC 1J5EC 2D1QA 3J81D 1N34C 3RG2A 2QL8A 5LMNC 5BSRA 5ADZA 1USPA 3G7SA 3RV2A 4DUZC 5K85A 4DV7C 4B3RC 1FJGC 4FTFA 4GXRA 4I9GA 2HJGA 3I08A 4WS9A 3R9XA 3LAXA 3DLPX 1O93A 5A1GA 3R44A 2F4VC 1V25A 4DCVA 5KYVA 2YWCA 1XNQC 1IBMC 3C5EA 2VQEC 3UZ0A 2ZM6C 4AQYC 2YCBA 2QW0X 4R1MA 1L2FA 2OPLA 3TUFA 4LFBC 1FUGA 4RM3A 4L7IA 4ZLPA 4R0MA 1EGAA 2ATWA 5BSVA 4JI3C 1RG9A 2P2JA 4X66C 4DCUA 3GPCA 4D4IA 1N36C 2VZEA 1O9TA 3H2TA 1K0RA 2E7GA 4JI6C 3LUSA 5E7QA 5CZVA 4LFAC 1LQLA 5FLXD 1O92A 3FCCA 2VQFC 1HNZC 3CW8X 1UKKA 5H9UA 4HPVA 5T8TA 4YHHC 3NYQA 5IT9D 2ONFA 4PHTA 4L2ZA 4JI1C 3AF6A 4TPSB 4NOZA 4X64C 3E7WA 1KKGA 5KEIA 4DV3C 3A4IA 2QVZX 1MXCA 4IR7A 3PESA 4B3SC 2Y4OA 3GR1A 1MDBA 2WP0C 1AMUA 1YJ7A 5BUQA 4RLFA 2JMPA 4ODJA 2Y27A 4WV3A 2OPLB 5BSMA 4GKJC 4U5YD 4DR4C 5BSTA 1XNRC 4BCAA 3DAYA 3CW9A 5IFIA 3FCEA 4DR5C 1GPMA 4DR6C 4MTNA 4PZPA 4RMNA 4R1LA 3ETCA 3UOWA 3I07A 2OBVA 4GKKC 4DV0C 2Y4NA 3VNQA 2EGTA 2P2FA 2D27A 2D1RA 4PROC 4JYAC 4BBYA 4DR2C 3T1HC 1T5HX 4OX9C 4OXIA 2BJOA 2PT7G 3VNRA 2KZFA 4RLQA 4KTTA 1N2FA 5AE3A 2P2QA 2OO4A 4JI7C 4ZJZA 5KYTA 2QVXX 2UXBC 1N32C 1V26A 4YY3C 3S82A 4X65C 1HNXC 4DUYC 1QM4A 5K8FA 3AF5A 4B3MC 5BURA 2BH1X 4DR1C 5DV9A 4IZ6A 1PG3A 4DCTA 1PA4A 4RVOA 5LMUC 1MXAA 2D7VA 1XMQC 3L8CA 4LF5C 2UXDC 4NDNA 3R9WA 1USPB 4XX2A 4JI2C 2E8FA 2D28C 4D56A 4JI5C 5AE1A 2UUAC 3N2QA 4JV5C 3VNSA 4DCSA 4RVNA 2ASBA 3GKUA 3N54B 4JI4C 1QWIA 4I9FA 5A1IA 4KTVA 4GS5A 2D1TA 2PN2A 3B7WA 5BSWA 4DV6C 4LE5A 4L4QA 4DV5C 2P02A 3TDEA 3PBKA 1XMOC 3J80D 1XRBA 2XR1A 3IEUA 4OYCA 1PG4A 4MH4A 1O90A 4G36A 3L95X 5IWAC 1LCIA 3TQIA 2E5LC 4JM1A 1IBKC 3EERA 4DV4C 4D4GA 2HHHC 3NPDA 4D57A 1T5DX 1HH2P 4DR7C 1NYEA 4BSZA 5GTDA 3EQ6A 5CZXA 2WD9A 3NYRA 2CXCA 3JAMD 2UXCC 2AYAA 4K0BA 4NXNC 5AE2A 3NI2A 1XRAA 3ETOA 4GXQA 5BSUA 3SO4A 1N33C 5T8SA 2DYJA 1MXBA 1MDFA 5A2QD 4LF7C 3IPLA 2D1SA 4EATA 2E8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 C;  2JMP A;  2UUA C;  1HR0 C;  4JV5 C;  1WF3 A;  1JOS A;  4DUZ C;  4DCS A;  2OPL B;  2ASB A;  3GKU A;  4GKJ C;  4JI4 C;  4DV1 C;  4DV7 C;  4DR4 C;  1QWI A;  1XNR C;  4B3R C;  1FJG C;  3CJE A;  2HJG A;  3R9X A;  2PN2 A;  4DR5 C;  4LFC C;  4DV6 C;  4DR6 C;  1VLA A;  4MTN A;  5BR8 C;  4DV2 C;  2F4V C;  4DV5 C;  4DCV A;  4JI0 C;  3I07 A;  1XNQ C;  1IBM C;  2UUC C;  4NXM C;  1MKY A;  1XMO C;  3J80 D;  2VQE C;  2XR1 A;  3IEU A;  1ML8 A;  2CY1 A;  2ZM6 C;  4AQY C;  2YCB A;  4MH4 A;  4LF9 C;  4GKK C;  4X62 C;  4DV0 C;  1ZB8 A;  1L2F A;  2OPL A;  2EGT A;  4KHP C;  1I94 C;  4LFB C;  5IWA C;  4JYA C;  1EGA A;  4DR2 C;  4LF6 C;  3T1H C;  4DR3 C;  4OX9 C;  2E5L C;  4LF4 C;  2ATW A;  2BJO A;  2PT7 G;  4JI3 C;  2KZF A;  3EER A;  4DV4 C;  1IBK C;  2UU9 C;  2UUB C;  1N2F A;  3OTO C;  2HHH C;  4X66 C;  4DCU A;  1N36 C;  4B3T C;  4JI7 C;  1IBL C;  1HH2 P;  1WH9 A;  4DR7 C;  1K0R A;  2UXB C;  1NYE A;  1N32 C;  4BSZ A;  4YY3 C;  2E7G A;  4X65 C;  1HNX C;  4JI6 C;  3LUS A;  4DUY C;  1ZB9 A;  4LF8 C;  4JI8 C;  3AF5 A;  4B3M C;  4K0K C;  4LFA C;  1LQL A;  2CXC A;  5FLX D;  3JAM D;  2UXC C;  2VQF C;  4NXN C;  4DR1 C;  1HNZ C;  2E8E A;  1UKK A;  4YHH C;  5IT9 D;  4DCT A;  2ONF A;  1PA4 A;  4JI1 C;  1HNW C;  1N33 C;  3AF6 A;  5LMU C;  2DYJ A;  4NOZ A;  4X64 C;  2D7V A;  5A2Q D;  1XMQ C;  4LF5 C;  2UXD C;  4LF7 C;  1KKG A;  4DV3 C;  3R9W A;  3IEV A;  4B3S C;  3T1Y C;  1J5E C;  1USP B;  4XX2 A;  3J81 D;  1N34 C;  4JI2 C;  2QL8 A;  2E8F A;  5LMN C;  2E8C A;  1USP A; 
#chains in the Genus database with same CATH topology
 4BC9 A;  1HR0 C;  1WF3 A;  1JOS A;  3DHV A;  3K6R A;  4DV1 C;  3LGX A;  2ZZM A;  3CJE A;  1RY2 A;  4FUQ A;  4LFC C;  1VLA A;  5BR8 C;  3PRO C;  2V7B A;  4DV2 C;  2MCQ A;  4JI0 C;  2UUC C;  4NXM C;  1MKY A;  1MD9 A;  1ML8 A;  2CY1 A;  4LF9 C;  4X62 C;  4BC7 A;  1ZB8 A;  4RM2 A;  1I94 C;  4KHP C;  3KXW A;  2P2B A;  4ISB A;  2DPL A;  4LF6 C;  4DR3 C;  1BA3 A;  4LF4 C;  2VSQ A;  5JRH A;  3GR0 A;  2UUB C;  2UU9 C;  3OTO C;  3E7X A;  4B3T C;  5A19 A;  1IBL C;  1WH9 A;  3A25 A;  4LF8 C;  3CQ3 A;  1ZB9 A;  4JI8 C;  2ZZN A;  4DG8 A;  4K0K C;  1V60 A;  2P2M A;  4DG9 A;  3LNV A;  2YWB A;  1P7L A;  2QVY X;  2E8E A;  4G1I A;  3A9U A;  2P20 A;  4FUT A;  1XRC A;  2E0G A;  1HNW C;  3CQ1 A;  4G37 A;  3A9V A;  1ULT A;  2PRO A;  5BUS A;  3IML A;  3IEV A;  3T1Y C;  1J5E C;  2D1Q A;  3J81 D;  1N34 C;  3RG2 A;  2QL8 A;  5LMN C;  5BSR A;  5ADZ A;  1USP A;  3TR3 A;  3G7S A;  3RV2 A;  4DUZ C;  5K85 A;  2NCL A;  4DV7 C;  4B3R C;  1FJG C;  4FTF A;  4GXR A;  4I9G A;  2HJG A;  3I08 A;  4WS9 A;  3R9X A;  3LAX A;  3DLP X;  1O93 A;  2KZ0 A;  5A1G A;  5LCI A;  3R44 A;  2F4V C;  1V25 A;  4DCV A;  5KYV A;  2YWC A;  1XNQ C;  1IBM C;  3C5E A;  2VQE C;  3UZ0 A;  2ZM6 C;  4AQY C;  2YCB A;  2QW0 X;  4R1M A;  1L2F A;  2OPL A;  3TUF A;  4LFB C;  1FUG A;  4RM3 A;  4L7I A;  4ZLP A;  4R0M A;  1EGA A;  2ATW A;  5BSV A;  4JI3 C;  1RG9 A;  2P2J A;  4X66 C;  4DCU A;  3GPC A;  4D4I A;  1N36 C;  3UX2 A;  2VZE A;  3AY0 A;  2MM9 A;  1O9T A;  3H2T A;  1K0R A;  3LNO A;  2E7G A;  4JI6 C;  3LUS A;  5E7Q A;  5CZV A;  4LFA C;  1LQL A;  5FLX D;  1O92 A;  3FCC A;  2VQF C;  1HNZ C;  3CW8 X;  1UKK A;  5H9U A;  4HPV A;  5T8T A;  4YHH C;  1TH5 A;  3NYQ A;  5IT9 D;  1UWD A;  2ONF A;  4PHT A;  4L2Z A;  4JI1 C;  3AF6 A;  1PU1 A;  4TPS B;  1M6X C;  4NOZ A;  4X64 C;  3E7W A;  1KKG A;  5KEI A;  4DV3 C;  3A4I A;  2QVZ X;  1MXC A;  4IR7 A;  3PES A;  4B3S C;  2Y4O A;  3GR1 A;  1MDB A;  2WP0 C;  1AMU A;  1YJ7 A;  2DHM A;  3UEB A;  5BUQ A;  4RLF A;  2JMP A;  4ODJ A;  2Y27 A;  4WV3 A;  2OPL B;  5BSM A;  4GKJ C;  4U5Y D;  4DR4 C;  5BST A;  1XNR C;  4BCA A;  3DAY A;  3CW9 A;  5IFI A;  3FCE A;  4DR5 C;  1GPM A;  4DR6 C;  4MTN A;  4PZP A;  4RMN A;  4R1L A;  3ETC A;  3UOW A;  3I07 A;  2OBV A;  4GKK C;  4DV0 C;  2Y4N A;  3VNQ A;  2EGT A;  2P2F A;  2D27 A;  2D1R A;  4PRO C;  1XS3 A;  1NY8 A;  4JYA C;  4BBY A;  4DR2 C;  2JNV A;  3T1H C;  1T5H X;  4OX9 C;  4OXI A;  2BJO A;  2PT7 G;  3VNR A;  2KZF A;  4RLQ A;  4KTT A;  1N2F A;  5AE3 A;  2P2Q A;  2OO4 A;  4JI7 C;  4ZJZ A;  5KYT A;  2QVX X;  2UXB C;  1N32 C;  1V26 A;  4YY3 C;  3S82 A;  4X65 C;  1HNX C;  4DUY C;  1QM4 A;  5K8F A;  3AF5 A;  4B3M C;  5BUR A;  2BH1 X;  4DR1 C;  2MMA B;  3UX3 A;  5DV9 A;  3A26 A;  1P4E A;  1M6X A;  4IZ6 A;  1IB8 A;  1PG3 A;  1FLO A;  4DCT A;  1PA4 A;  4RVO A;  5LMU C;  1MXA A;  2D7V A;  1XMQ C;  3L8C A;  4LF5 C;  2UXD C;  4NDN A;  3R9W A;  1USP B;  4XX2 A;  4JI2 C;  2E8F A;  2D28 C;  4D56 A;  4JI5 C;  5AE1 A;  2UUA C;  3N2Q A;  4JV5 C;  3VNS A;  4DCS A;  4RVN A;  2ASB A;  3GKU A;  3N54 B;  4JI4 C;  1QWI A;  4PUH A;  1P4E C;  4I9F A;  5A1I A;  4KTV A;  4GS5 A;  1WCJ A;  2D1T A;  2PN2 A;  3B7W A;  5BSW A;  4DV6 C;  4LE5 A;  4L4Q A;  4DV5 C;  2P02 A;  3TDE A;  3PBK A;  1XMO C;  3J80 D;  1XRB A;  2M5O A;  2XR1 A;  3IEU A;  4OYC A;  2M5H A;  1PG4 A;  4MH4 A;  1O90 A;  4G36 A;  3L95 X;  2YX1 A;  2KDN A;  5IWA C;  1LCI A;  2Z51 A;  3TQI A;  2E5L C;  4JM1 A;  4PUG A;  1IBK C;  3EER A;  4DV4 C;  4D4G A;  2HHH C;  3NPD A;  4D57 A;  1VEH A;  1T5D X;  1HH2 P;  4DR7 C;  1XHJ A;  1NYE A;  4BSZ A;  5GTD A;  3EQ6 A;  5CZX A;  2WD9 A;  3NYR A;  2CXC A;  3JAM D;  2UXC C;  2AYA A;  4K0B A;  4NXN C;  5AE2 A;  3NI2 A;  1XRA A;  3ETO A;  4GXQ A;  5BSU A;  3SO4 A;  1N33 C;  5T8S A;  2DYJ A;  4PUI A;  1MXB A;  1MDF A;  5A2Q D;  4LF7 C;  3IPL A;  2CU6 A;  2D1S A;  3CQ2 A;  4EAT A;  3O2E A;  2E8C A; 
#chains in the Genus database with same CATH homology
 4BC9 A;  1HR0 C;  1WF3 A;  1JOS A;  3DHV A;  4DV1 C;  3LGX A;  3CJE A;  1RY2 A;  4FUQ A;  4LFC C;  1VLA A;  5BR8 C;  3PRO C;  2V7B A;  4DV2 C;  4JI0 C;  2UUC C;  4NXM C;  1MKY A;  1MD9 A;  1ML8 A;  2CY1 A;  4LF9 C;  4X62 C;  4BC7 A;  1ZB8 A;  4RM2 A;  1I94 C;  4KHP C;  3KXW A;  2P2B A;  4ISB A;  2DPL A;  4LF6 C;  4DR3 C;  1BA3 A;  4LF4 C;  2VSQ A;  5JRH A;  3GR0 A;  2UUB C;  2UU9 C;  3OTO C;  3E7X A;  4B3T C;  5A19 A;  1IBL C;  1WH9 A;  4LF8 C;  1ZB9 A;  4JI8 C;  4DG8 A;  4K0K C;  2P2M A;  4DG9 A;  3LNV A;  2YWB A;  1P7L A;  2QVY X;  2E8E A;  4G1I A;  3A9U A;  2P20 A;  4FUT A;  1XRC A;  2E0G A;  1HNW C;  4G37 A;  3A9V A;  1ULT A;  2PRO A;  5BUS A;  3IML A;  3IEV A;  3T1Y C;  1J5E C;  2D1Q A;  3J81 D;  1N34 C;  3RG2 A;  2QL8 A;  5LMN C;  5BSR A;  5ADZ A;  1USP A;  3G7S A;  3RV2 A;  4DUZ C;  5K85 A;  4DV7 C;  4B3R C;  1FJG C;  4FTF A;  4GXR A;  4I9G A;  2HJG A;  3I08 A;  4WS9 A;  3R9X A;  3LAX A;  3DLP X;  1O93 A;  5A1G A;  3R44 A;  2F4V C;  1V25 A;  4DCV A;  5KYV A;  2YWC A;  1XNQ C;  1IBM C;  3C5E A;  2VQE C;  3UZ0 A;  2ZM6 C;  4AQY C;  2YCB A;  2QW0 X;  4R1M A;  1L2F A;  2OPL A;  3TUF A;  4LFB C;  1FUG A;  4RM3 A;  4L7I A;  4ZLP A;  4R0M A;  1EGA A;  2ATW A;  5BSV A;  4JI3 C;  1RG9 A;  2P2J A;  4X66 C;  4DCU A;  3GPC A;  4D4I A;  1N36 C;  2VZE A;  1O9T A;  3H2T A;  1K0R A;  2E7G A;  4JI6 C;  3LUS A;  5E7Q A;  5CZV A;  4LFA C;  1LQL A;  5FLX D;  1O92 A;  3FCC A;  2VQF C;  1HNZ C;  3CW8 X;  1UKK A;  5H9U A;  4HPV A;  5T8T A;  4YHH C;  3NYQ A;  5IT9 D;  2ONF A;  4PHT A;  4L2Z A;  4JI1 C;  3AF6 A;  4TPS B;  4NOZ A;  4X64 C;  3E7W A;  1KKG A;  5KEI A;  4DV3 C;  3A4I A;  2QVZ X;  1MXC A;  4IR7 A;  3PES A;  4B3S C;  2Y4O A;  3GR1 A;  1MDB A;  2WP0 C;  1AMU A;  1YJ7 A;  5BUQ A;  4RLF A;  2JMP A;  4ODJ A;  2Y27 A;  4WV3 A;  2OPL B;  5BSM A;  4GKJ C;  4U5Y D;  4DR4 C;  5BST A;  1XNR C;  4BCA A;  3DAY A;  3CW9 A;  5IFI A;  3FCE A;  4DR5 C;  1GPM A;  4DR6 C;  4MTN A;  4PZP A;  4RMN A;  4R1L A;  3ETC A;  3UOW A;  3I07 A;  2OBV A;  4GKK C;  4DV0 C;  2Y4N A;  3VNQ A;  2EGT A;  2P2F A;  2D27 A;  2D1R A;  4PRO C;  4JYA C;  4BBY A;  4DR2 C;  3T1H C;  1T5H X;  4OX9 C;  4OXI A;  2BJO A;  2PT7 G;  3VNR A;  2KZF A;  4RLQ A;  4KTT A;  1N2F A;  5AE3 A;  2P2Q A;  2OO4 A;  4JI7 C;  4ZJZ A;  5KYT A;  2QVX X;  2UXB C;  1N32 C;  1V26 A;  4YY3 C;  3S82 A;  4X65 C;  1HNX C;  4DUY C;  1QM4 A;  5K8F A;  3AF5 A;  4B3M C;  5BUR A;  2BH1 X;  4DR1 C;  5DV9 A;  4IZ6 A;  1PG3 A;  4DCT A;  1PA4 A;  4RVO A;  5LMU C;  1MXA A;  2D7V A;  1XMQ C;  3L8C A;  4LF5 C;  2UXD C;  4NDN A;  3R9W A;  1USP B;  4XX2 A;  4JI2 C;  2E8F A;  2D28 C;  4D56 A;  4JI5 C;  5AE1 A;  2UUA C;  3N2Q A;  4JV5 C;  3VNS A;  4DCS A;  4RVN A;  2ASB A;  3GKU A;  3N54 B;  4JI4 C;  1QWI A;  4I9F A;  5A1I A;  4KTV A;  4GS5 A;  2D1T A;  2PN2 A;  3B7W A;  5BSW A;  4DV6 C;  4LE5 A;  4L4Q A;  4DV5 C;  2P02 A;  3TDE A;  3PBK A;  1XMO C;  3J80 D;  1XRB A;  2XR1 A;  3IEU A;  4OYC A;  1PG4 A;  4MH4 A;  1O90 A;  4G36 A;  3L95 X;  5IWA C;  1LCI A;  3TQI A;  2E5L C;  4JM1 A;  1IBK C;  3EER A;  4DV4 C;  4D4G A;  2HHH C;  3NPD A;  4D57 A;  1T5D X;  1HH2 P;  4DR7 C;  1NYE A;  4BSZ A;  5GTD A;  3EQ6 A;  5CZX A;  2WD9 A;  3NYR A;  2CXC A;  3JAM D;  2UXC C;  2AYA A;  4K0B A;  4NXN C;  5AE2 A;  3NI2 A;  1XRA A;  3ETO A;  4GXQ A;  5BSU A;  3SO4 A;  1N33 C;  5T8S A;  2DYJ A;  1MXB A;  1MDF A;  5A2Q D;  4LF7 C;  3IPL A;  2D1S A;  4EAT A;  2E8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...