2MMAB

Nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
VTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mmaB00
4PUHA 3TR3A 1V60A 2DHMA 2MMAB 1NY8A 2KZ0A 2MM9A 2MCQA 5LCIA 2NCLA 2KDNA 1XS3A 4PUIA 3O2EA 4PUGA
chains in the Genus database with same CATH superfamily
4DCUA 3LUSA 1XHJA 3CW9A 4LFBC 1M6XA 3DHVA 1ZB8A 4DR2C 4YHHC 1BA3A 2PN2A 4NXNC 4G36A 4L7IA 5T8TA 2BH1X 3B7WA 1IBKC 1RG9A 1IBLC 4JI2C 2JMPA 3I07A 1IBMC 2WD9A 4EATA 2P02A 4G1IA 4U5YD 2P2BA 1WF3A 4JM1A 4JI6C 4JV5C 4BC7A 2D7VA 2YWCA 3LAXA 1HH2P 2PROA 3LNOA 3PROC 3K6RA 5AE2A 3E7WA 2VZEA 4RM2A 3AY0A 2D27A 2D1SA 4X62C 4RVNA 2MMAB 3AF6A 1WCJA 3VNQA 4R1LA 4BBYA 4LF5C 3O2EA 4B3RC 1I94C 5AE3A 4ODJA 1VEHA 4DG9A 4LF8C 3H2TA 1M6XC 1HNXC 2UU9C 2QW0X 2BJOA 3TUFA 2KZFA 2ZM6C 4D4GA 4PUHA 2QVYX 5BURA 1LQLA 3E7XA 2Y4OA 5IT9D 2P2FA 1HR0C 1P4EA 1XNQC 3R9WA 5BSUA 5IWAC 3N54B 2AYAA 2OO4A 1AMUA 1N34C 4LF6C 4GKJC 3CQ1A 4RVOA 3N2QA 1FJGC 4DCSA 3NYRA 4OXIA 4L4QA 2ONFA 1PA4A 1XRBA 3OTOC 4B3MC 4XX2A 1T5DX 4DR6C 3UOWA 5BUSA 1LCIA 1QM4A 4DV6C 2E5LC 3IMLA 2DYJA 4L2ZA 4LF7C 3FCCA 5A2QD 4JI4C 4ZLPA 5DV9A 1NYEA 4B3SC 5T8SA 5LMUC 1PG3A 4IR7A 2P2MA 4NDNA 5KYTA 4G37A 4TPSB 4DR5C 3EERA 4DG8A 2Y27A 1N36C 1MXAA 4DV0C 2MCQA 4PROC 3S82A 3NPDA 3JAMD 3A9UA 1RY2A 2E8EA 3C5EA 3T1HC 2EGTA 2YWBA 4NXMC 2V7BA 2OPLB 2YX1A 3DAYA 2ZZMA 4K0KC 3IEVA 2D1QA 2CXCA 1KKGA 5A1GA 3RG2A 4DR3C 4R1MA 5AE1A 5ADZA 1N33C 1MDFA 3DLPX 4DCTA 1USPA 3GR1A 1J5EC 4LFAC 3R44A 1NY8A 3VNRA 4RM3A 3FCEA 4K0BA 1HNZC 5BSMA 4X66C 2D28C 2VQFC 5CZVA 3LGXA 4PZPA 1JOSA 1P7LA 2F4VC 4LF9C 3TQIA 4B3TC 3SO4A 4PHTA 2NCLA 4DCVA 4KHPC 4DV2C 5GTDA 4JYAC 2P2QA 1WH9A 2CU6A 3PBKA 1XNRC 4JI5C 1PG4A 5H9UA 3L95X 4DV5C 1PU1A 2UUCC 1USPB 2QL8A 2E8FA 2D1RA 1EGAA 3IEUA 1O90A 4FUQA 4WV3A 1T5HX 2VSQA 4MTNA 1TH5A 4FTFA 4DR7C 4GKKC 3NYQA 1MXCA 3AF5A 1V26A 3NI2A 4DUYC 4DUZC 2Z51A 1L2FA 4BCAA 1O92A 4LE5A 2KDNA 4DR4C 1GPMA 1O93A 5KEIA 3GR0A 4GXQA 5FLXD 2WP0C 1XMQC 1UWDA 2Y4NA 2DPLA 2XR1A 1MKYA 3A26A 5LCIA 3A4IA 1N32C 3UEBA 1MD9A 2YCBA 2UUAC 3LNVA 1FLOA 3KXWA 3J80D 2UXDC 3A9VA 1V25A 3VNSA 2P2JA 3T1YC 4DR1C 4DV3C 1ZB9A 2UXCC 2M5HA 4AQYC 1XRAA 4X65C 2E7GA 3IPLA 4JI0C 1MXBA 4BSZA 5IFIA 2DHMA 2E0GA 5A1IA 4LFCC 5LMNC 1FUGA 1QWIA 2MM9A 2ZZNA 1XS3A 5KYVA 1XMOC 2ASBA 5JRHA 5BSRA 3CQ3A 4ZJZA 4WS9A 2KZ0A 3CQ2A 3UZ0A 4OYCA 4X64C 5E7QA 3TR3A 4LF4C 3GPCA 1YJ7A 5BSVA 4I9GA 4RLFA 2JNVA 2UUBC 2PT7G 1ULTA 2OPLA 2QVXX 4JI3C 4RMNA 1MDBA 5BUQA 2UXBC 4DV7C 4IZ6A 4PUIA 3R9XA 5K8FA 4OX9C 1V60A 5BSTA 4FUTA 3GKUA 4I9FA 3ETCA 4YY3C 4GS5A 1XRCA 3A25A 2E8CA 4KTTA 2P20A 2HHHC 4R0MA 5CZXA 1ML8A 3ETOA 1VLAA 4JI8C 3G7SA 1UKKA 4HPVA 3PESA 4D56A 4DV4C 3UX2A 5BR8C 3UX3A 2CY1A 2M5OA 4JI7C 4PUGA 2ATWA 2OBVA 4D4IA 5A19A 2D1TA 3TDEA 3I08A 3EQ6A 4ISBA 3RV2A 5K85A 4DV1C 4BC9A 1P4EC 1N2FA 4RLQA 4JI1C 4GXRA 4NOZA 2HJGA 3CJEA 3CW8X 4MH4A 1O9TA 4D57A 3L8CA 2VQEC 5BSWA 1IB8A 2QVZX 1HNWC 1K0RA 3J81D 4KTVA
chains in the Genus database with same CATH topology
4PUHA 3TR3A 1V60A 2DHMA 2MMAB 1NY8A 2KZ0A 2MM9A 2MCQA 5LCIA 2NCLA 2KDNA 1XS3A 4PUIA 3O2EA 4PUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUH A;  3TR3 A;  1V60 A;  2DHM A;  2MMA B;  1NY8 A;  2KZ0 A;  2MM9 A;  2MCQ A;  5LCI A;  2NCL A;  2KDN A;  1XS3 A;  4PUI A;  3O2E A;  4PUG A; 
#chains in the Genus database with same CATH topology
 4DCU A;  3LUS A;  1XHJ A;  3CW9 A;  4LFB C;  1M6X A;  3DHV A;  1ZB8 A;  4DR2 C;  4YHH C;  1BA3 A;  2PN2 A;  4NXN C;  4G36 A;  4L7I A;  5T8T A;  2BH1 X;  3B7W A;  1IBK C;  1RG9 A;  1IBL C;  4JI2 C;  2JMP A;  3I07 A;  1IBM C;  2WD9 A;  4EAT A;  2P02 A;  4G1I A;  4U5Y D;  2P2B A;  1WF3 A;  4JM1 A;  4JI6 C;  4JV5 C;  4BC7 A;  2D7V A;  2YWC A;  3LAX A;  1HH2 P;  2PRO A;  3LNO A;  3PRO C;  3K6R A;  5AE2 A;  3E7W A;  2VZE A;  4RM2 A;  3AY0 A;  2D27 A;  2D1S A;  4X62 C;  4RVN A;  2MMA B;  3AF6 A;  1WCJ A;  3VNQ A;  4R1L A;  4BBY A;  4LF5 C;  3O2E A;  4B3R C;  1I94 C;  5AE3 A;  4ODJ A;  1VEH A;  4DG9 A;  4LF8 C;  3H2T A;  1M6X C;  1HNX C;  2UU9 C;  2QW0 X;  2BJO A;  3TUF A;  2KZF A;  2ZM6 C;  4D4G A;  4PUH A;  2QVY X;  5BUR A;  1LQL A;  3E7X A;  2Y4O A;  5IT9 D;  2P2F A;  1HR0 C;  1P4E A;  1XNQ C;  3R9W A;  5BSU A;  5IWA C;  3N54 B;  2AYA A;  2OO4 A;  1AMU A;  1N34 C;  4LF6 C;  4GKJ C;  3CQ1 A;  4RVO A;  3N2Q A;  1FJG C;  4DCS A;  3NYR A;  4OXI A;  4L4Q A;  2ONF A;  1PA4 A;  1XRB A;  3OTO C;  4B3M C;  4XX2 A;  1T5D X;  4DR6 C;  3UOW A;  5BUS A;  1LCI A;  1QM4 A;  4DV6 C;  2E5L C;  3IML A;  2DYJ A;  4L2Z A;  4LF7 C;  3FCC A;  5A2Q D;  4JI4 C;  4ZLP A;  5DV9 A;  1NYE A;  4B3S C;  5T8S A;  5LMU C;  1PG3 A;  4IR7 A;  2P2M A;  4NDN A;  5KYT A;  4G37 A;  4TPS B;  4DR5 C;  3EER A;  4DG8 A;  2Y27 A;  1N36 C;  1MXA A;  4DV0 C;  2MCQ A;  4PRO C;  3S82 A;  3NPD A;  3JAM D;  3A9U A;  1RY2 A;  2E8E A;  3C5E A;  3T1H C;  2EGT A;  2YWB A;  4NXM C;  2V7B A;  2OPL B;  2YX1 A;  3DAY A;  2ZZM A;  4K0K C;  3IEV A;  2D1Q A;  2CXC A;  1KKG A;  5A1G A;  3RG2 A;  4DR3 C;  4R1M A;  5AE1 A;  5ADZ A;  1N33 C;  1MDF A;  3DLP X;  4DCT A;  1USP A;  3GR1 A;  1J5E C;  4LFA C;  3R44 A;  1NY8 A;  3VNR A;  4RM3 A;  3FCE A;  4K0B A;  1HNZ C;  5BSM A;  4X66 C;  2D28 C;  2VQF C;  5CZV A;  3LGX A;  4PZP A;  1JOS A;  1P7L A;  2F4V C;  4LF9 C;  3TQI A;  4B3T C;  3SO4 A;  4PHT A;  2NCL A;  4DCV A;  4KHP C;  4DV2 C;  5GTD A;  4JYA C;  2P2Q A;  1WH9 A;  2CU6 A;  3PBK A;  1XNR C;  4JI5 C;  1PG4 A;  5H9U A;  3L95 X;  4DV5 C;  1PU1 A;  2UUC C;  1USP B;  2QL8 A;  2E8F A;  2D1R A;  1EGA A;  3IEU A;  1O90 A;  4FUQ A;  4WV3 A;  1T5H X;  2VSQ A;  4MTN A;  1TH5 A;  4FTF A;  4DR7 C;  4GKK C;  3NYQ A;  1MXC A;  3AF5 A;  1V26 A;  3NI2 A;  4DUY C;  4DUZ C;  2Z51 A;  1L2F A;  4BCA A;  1O92 A;  4LE5 A;  2KDN A;  4DR4 C;  1GPM A;  1O93 A;  5KEI A;  3GR0 A;  4GXQ A;  5FLX D;  2WP0 C;  1XMQ C;  1UWD A;  2Y4N A;  2DPL A;  2XR1 A;  1MKY A;  3A26 A;  5LCI A;  3A4I A;  1N32 C;  3UEB A;  1MD9 A;  2YCB A;  2UUA C;  3LNV A;  1FLO A;  3KXW A;  3J80 D;  2UXD C;  3A9V A;  1V25 A;  3VNS A;  2P2J A;  3T1Y C;  4DR1 C;  4DV3 C;  1ZB9 A;  2UXC C;  2M5H A;  4AQY C;  1XRA A;  4X65 C;  2E7G A;  3IPL A;  4JI0 C;  1MXB A;  4BSZ A;  5IFI A;  2DHM A;  2E0G A;  5A1I A;  4LFC C;  5LMN C;  1FUG A;  1QWI A;  2MM9 A;  2ZZN A;  1XS3 A;  5KYV A;  1XMO C;  2ASB A;  5JRH A;  5BSR A;  3CQ3 A;  4ZJZ A;  4WS9 A;  2KZ0 A;  3CQ2 A;  3UZ0 A;  4OYC A;  4X64 C;  5E7Q A;  3TR3 A;  4LF4 C;  3GPC A;  1YJ7 A;  5BSV A;  4I9G A;  4RLF A;  2JNV A;  2UUB C;  2PT7 G;  1ULT A;  2OPL A;  2QVX X;  4JI3 C;  4RMN A;  1MDB A;  5BUQ A;  2UXB C;  4DV7 C;  4IZ6 A;  4PUI A;  3R9X A;  5K8F A;  4OX9 C;  1V60 A;  5BST A;  4FUT A;  3GKU A;  4I9F A;  3ETC A;  4YY3 C;  4GS5 A;  1XRC A;  3A25 A;  2E8C A;  4KTT A;  2P20 A;  2HHH C;  4R0M A;  5CZX A;  1ML8 A;  3ETO A;  1VLA A;  4JI8 C;  3G7S A;  1UKK A;  4HPV A;  3PES A;  4D56 A;  4DV4 C;  3UX2 A;  5BR8 C;  3UX3 A;  2CY1 A;  2M5O A;  4JI7 C;  4PUG A;  2ATW A;  2OBV A;  4D4I A;  5A19 A;  2D1T A;  3TDE A;  3I08 A;  3EQ6 A;  4ISB A;  3RV2 A;  5K85 A;  4DV1 C;  4BC9 A;  1P4E C;  1N2F A;  4RLQ A;  4JI1 C;  4GXR A;  4NOZ A;  2HJG A;  3CJE A;  3CW8 X;  4MH4 A;  1O9T A;  4D57 A;  3L8C A;  2VQE C;  5BSW A;  1IB8 A;  2QVZ X;  1HNW C;  1K0R A;  3J81 D;  4KTV A; 
#chains in the Genus database with same CATH homology
 4PUH A;  3TR3 A;  1V60 A;  2DHM A;  2MMA B;  1NY8 A;  2KZ0 A;  2MM9 A;  2MCQ A;  5LCI A;  2NCL A;  2KDN A;  1XS3 A;  4PUI A;  3O2E A;  4PUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...