2MMAB

Nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
VTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mmaB00
2MM9A 2DHMA 3TR3A 1V60A 1NY8A 1XS3A 2KDNA 2KZ0A 4PUHA 4PUGA 5LCIA 2MCQA 4PUIA 2NCLA 3O2EA 2MMAB
chains in the Genus database with same CATH superfamily
1I94C 1HR0C 2UUBC 2EGTA 2UUCC 2ZZNA 2M5HA 4MH4A 1IBKC 4BBYA 5K8FA 3KXWA 4YHHC 3A26A 5CZVA 1YJ7A 2PT7G 3LNOA 2OPLB 4DV7C 2KZFA 1N34C 4LF7C 3LUSA 2VQFC 3IMLA 3VNRA 2UXDC 2E8EA 5FLXD 5BSWA 3N54B 5BURA 1MDBA 4JM1A 4DCSA 1PU1A 2ATWA 5BSMA 2CU6A 2DHMA 4RVNA 2M5OA 4HPVA 4JI2C 1MKYA 4WS9A 3UX3A 2HJGA 2JMPA 5LMNC 5KYTA 3L8CA 1O92A 5BUQA 4LF6C 3O2EA 4JYAC 5AE3A 3H2TA 4YY3C 3TR3A 2D27A 5AE1A 2E8FA 4NXMC 2ZM6C 1XMQC 4L4QA 2P20A 3CW9A 2NCLA 3E7XA 1XRBA 2D1TA 4G36A 3PROC 1VLAA 3N2QA 2MM9A 3EERA 4KTVA 4DV3C 5AE2A 4B3RC 2E5LC 3K6RA 3CJEA 3CW8X 4NDNA 2CY1A 1FLOA 1WH9A 2OPLA 4LF4C 4OYCA 2VZEA 1O93A 2P2MA 3R44A 4G1IA 2D1SA 4LFAC 1USPB 4LFBC 4IR7A 1L2FA 4LF5C 4JI6C 2D1RA 5KYVA 3RG2A 4BC7A 3VNQA 1M6XA 4RM3A 1KKGA 3NI2A 2E8CA 4PZPA 4RMNA 5JRHA 4JI7C 2JNVA 3PBKA 2PN2A 2YWCA 3OTOC 2KZ0A 4K0BA 4D56A 4R0MA 2BH1X 4GKKC 1ML8A 3B7WA 2BJOA 3NYQA 2KDNA 5BR8C 1USPA 5CZXA 4DUYC 2P2JA 3A9VA 3DAYA 4DV0C 4DCTA 2Y4OA 3GKUA 1V60A 4R1MA 1N33C 2UXCC 2QL8A 1PA4A 3S82A 4DR1C 1XS3A 1HH2P 4RVOA 5BSVA 3PESA 3DHVA 3IPLA 2P02A 4PHTA 4B3SC 1UWDA 5BSUA 4X64C 5T8SA 4DV1C 1QM4A 4I9GA 3T1YC 4XX2A 4ZLPA 4JI8C 2Y4NA 5KEIA 2V7BA 4ZJZA 4DV5C 1GPMA 1XRCA 1HNWC 2P2FA 5H9UA 1O90A 1N36C 3C5EA 3VNSA 3CQ1A 3LNVA 4JI4C 5A1IA 3GPCA 2DPLA 1MXAA 2AYAA 3TQIA 5IFIA 4JI5C 1BA3A 4GXQA 3AF5A 3G7SA 1UKKA 3GR1A 3AY0A 5BUSA 2WP0C 2CXCA 3A9UA 1HNZC 4RLFA 3ETCA 3CQ3A 3R9WA 5GTDA 1EGAA 5BSRA 2HHHC 5IT9D 4NOZA 4DCUA 1VEHA 3A25A 4ODJA 1ZB8A 5E7QA 3ETOA 2UU9C 1P7LA 1XHJA 2MCQA 3NYRA 2UUAC 1XMOC 4GKJC 3UOWA 2UXBC 2YCBA 1JOSA 4IZ6A 4OX9C 4D57A 5A19A 2D7VA 4EATA 4X62C 3LAXA 1NYEA 1MDFA 2E0GA 1P4EC 4DR7C 3EQ6A 1N32C 4BCAA 4R1LA 5DV9A 4JI1C 1T5DX 3FCCA 4DG9A 2OBVA 4DUZC 4BSZA 4ISBA 4FUQA 2OO4A 3AF6A 4LF8C 2Z51A 1P4EA 1MXBA 2PROA 3NPDA 3J81D 1PG4A 5IWAC 3E7WA 5T8TA 1ULTA 4DR3C 4G37A 5A2QD 5ADZA 4X66C 1AMUA 2ASBA 4RM2A 4DR4C 3LGXA 1FJGC 3JAMD 4AQYC 2ZZMA 4JV5C 4OXIA 2ONFA 3RV2A 3UX2A 1IBMC 3IEUA 4PUHA 2P2QA 4DCVA 3J80D 1K0RA 1WF3A 4LE5A 4B3MC 4PROC 1QWIA 4B3TC 3IEVA 4L2ZA 4WV3A 5K85A 5LCIA 1M6XC 1RY2A 2D28C 4FUTA 4DR2C 1RG9A 3L95X 1ZB9A 1MD9A 4L7IA 3FCEA 1TH5A 3TUFA 1N2FA 1XRAA 1LQLA 2DYJA 4KTTA 4PUIA 4DR5C 4DV6C 1XNRC 3UZ0A 4X65C 2F4VC 3A4IA 2QVYX 1J5EC 3R9XA 3T1HC 4DV4C 4DV2C 1O9TA 5A1GA 1NY8A 2Y27A 4JI0C 3GR0A 1V25A 4DR6C 4LFCC 4KHPC 4PUGA 4U5YD 1WCJA 2E7GA 1FUGA 4NXNC 3CQ2A 4GXRA 5LMUC 1IB8A 4TPSB 1HNXC 4BC9A 4K0KC 2YX1A 1XNQC 3TDEA 4JI3C 2MMAB 1IBLC 2QVZX 1MXCA 4D4IA 3I07A 2QVXX 5BSTA 3DLPX 4GS5A 2D1QA 4RLQA 4MTNA 4DG8A 1T5HX 3I08A 3SO4A 1LCIA 4FTFA 2YWBA 2VQEC 4D4GA 2QW0X 1V26A 2VSQA 3UEBA 4I9FA 4LF9C 2XR1A 2P2BA 2WD9A 1PG3A
chains in the Genus database with same CATH topology
2MM9A 2DHMA 3TR3A 1V60A 1NY8A 1XS3A 2KDNA 2KZ0A 4PUHA 4PUGA 5LCIA 2MCQA 4PUIA 2NCLA 3O2EA 2MMAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM9 A;  2DHM A;  3TR3 A;  1V60 A;  1NY8 A;  1XS3 A;  2KDN A;  2KZ0 A;  4PUH A;  4PUG A;  5LCI A;  2MCQ A;  4PUI A;  2NCL A;  3O2E A;  2MMA B; 
#chains in the Genus database with same CATH topology
 1I94 C;  1HR0 C;  2UUB C;  2EGT A;  2UUC C;  2ZZN A;  2M5H A;  4MH4 A;  1IBK C;  4BBY A;  5K8F A;  3KXW A;  4YHH C;  3A26 A;  5CZV A;  1YJ7 A;  2PT7 G;  3LNO A;  2OPL B;  4DV7 C;  2KZF A;  1N34 C;  4LF7 C;  3LUS A;  2VQF C;  3IML A;  3VNR A;  2UXD C;  2E8E A;  5FLX D;  5BSW A;  3N54 B;  5BUR A;  1MDB A;  4JM1 A;  4DCS A;  1PU1 A;  2ATW A;  5BSM A;  2CU6 A;  2DHM A;  4RVN A;  2M5O A;  4HPV A;  4JI2 C;  1MKY A;  4WS9 A;  3UX3 A;  2HJG A;  2JMP A;  5LMN C;  5KYT A;  3L8C A;  1O92 A;  5BUQ A;  4LF6 C;  3O2E A;  4JYA C;  5AE3 A;  3H2T A;  4YY3 C;  3TR3 A;  2D27 A;  5AE1 A;  2E8F A;  4NXM C;  2ZM6 C;  1XMQ C;  4L4Q A;  2P20 A;  3CW9 A;  2NCL A;  3E7X A;  1XRB A;  2D1T A;  4G36 A;  3PRO C;  1VLA A;  3N2Q A;  2MM9 A;  3EER A;  4KTV A;  4DV3 C;  5AE2 A;  4B3R C;  2E5L C;  3K6R A;  3CJE A;  3CW8 X;  4NDN A;  2CY1 A;  1FLO A;  1WH9 A;  2OPL A;  4LF4 C;  4OYC A;  2VZE A;  1O93 A;  2P2M A;  3R44 A;  4G1I A;  2D1S A;  4LFA C;  1USP B;  4LFB C;  4IR7 A;  1L2F A;  4LF5 C;  4JI6 C;  2D1R A;  5KYV A;  3RG2 A;  4BC7 A;  3VNQ A;  1M6X A;  4RM3 A;  1KKG A;  3NI2 A;  2E8C A;  4PZP A;  4RMN A;  5JRH A;  4JI7 C;  2JNV A;  3PBK A;  2PN2 A;  2YWC A;  3OTO C;  2KZ0 A;  4K0B A;  4D56 A;  4R0M A;  2BH1 X;  4GKK C;  1ML8 A;  3B7W A;  2BJO A;  3NYQ A;  2KDN A;  5BR8 C;  1USP A;  5CZX A;  4DUY C;  2P2J A;  3A9V A;  3DAY A;  4DV0 C;  4DCT A;  2Y4O A;  3GKU A;  1V60 A;  4R1M A;  1N33 C;  2UXC C;  2QL8 A;  1PA4 A;  3S82 A;  4DR1 C;  1XS3 A;  1HH2 P;  4RVO A;  5BSV A;  3PES A;  3DHV A;  3IPL A;  2P02 A;  4PHT A;  4B3S C;  1UWD A;  5BSU A;  4X64 C;  5T8S A;  4DV1 C;  1QM4 A;  4I9G A;  3T1Y C;  4XX2 A;  4ZLP A;  4JI8 C;  2Y4N A;  5KEI A;  2V7B A;  4ZJZ A;  4DV5 C;  1GPM A;  1XRC A;  1HNW C;  2P2F A;  5H9U A;  1O90 A;  1N36 C;  3C5E A;  3VNS A;  3CQ1 A;  3LNV A;  4JI4 C;  5A1I A;  3GPC A;  2DPL A;  1MXA A;  2AYA A;  3TQI A;  5IFI A;  4JI5 C;  1BA3 A;  4GXQ A;  3AF5 A;  3G7S A;  1UKK A;  3GR1 A;  3AY0 A;  5BUS A;  2WP0 C;  2CXC A;  3A9U A;  1HNZ C;  4RLF A;  3ETC A;  3CQ3 A;  3R9W A;  5GTD A;  1EGA A;  5BSR A;  2HHH C;  5IT9 D;  4NOZ A;  4DCU A;  1VEH A;  3A25 A;  4ODJ A;  1ZB8 A;  5E7Q A;  3ETO A;  2UU9 C;  1P7L A;  1XHJ A;  2MCQ A;  3NYR A;  2UUA C;  1XMO C;  4GKJ C;  3UOW A;  2UXB C;  2YCB A;  1JOS A;  4IZ6 A;  4OX9 C;  4D57 A;  5A19 A;  2D7V A;  4EAT A;  4X62 C;  3LAX A;  1NYE A;  1MDF A;  2E0G A;  1P4E C;  4DR7 C;  3EQ6 A;  1N32 C;  4BCA A;  4R1L A;  5DV9 A;  4JI1 C;  1T5D X;  3FCC A;  4DG9 A;  2OBV A;  4DUZ C;  4BSZ A;  4ISB A;  4FUQ A;  2OO4 A;  3AF6 A;  4LF8 C;  2Z51 A;  1P4E A;  1MXB A;  2PRO A;  3NPD A;  3J81 D;  1PG4 A;  5IWA C;  3E7W A;  5T8T A;  1ULT A;  4DR3 C;  4G37 A;  5A2Q D;  5ADZ A;  4X66 C;  1AMU A;  2ASB A;  4RM2 A;  4DR4 C;  3LGX A;  1FJG C;  3JAM D;  4AQY C;  2ZZM A;  4JV5 C;  4OXI A;  2ONF A;  3RV2 A;  3UX2 A;  1IBM C;  3IEU A;  4PUH A;  2P2Q A;  4DCV A;  3J80 D;  1K0R A;  1WF3 A;  4LE5 A;  4B3M C;  4PRO C;  1QWI A;  4B3T C;  3IEV A;  4L2Z A;  4WV3 A;  5K85 A;  5LCI A;  1M6X C;  1RY2 A;  2D28 C;  4FUT A;  4DR2 C;  1RG9 A;  3L95 X;  1ZB9 A;  1MD9 A;  4L7I A;  3FCE A;  1TH5 A;  3TUF A;  1N2F A;  1XRA A;  1LQL A;  2DYJ A;  4KTT A;  4PUI A;  4DR5 C;  4DV6 C;  1XNR C;  3UZ0 A;  4X65 C;  2F4V C;  3A4I A;  2QVY X;  1J5E C;  3R9X A;  3T1H C;  4DV4 C;  4DV2 C;  1O9T A;  5A1G A;  1NY8 A;  2Y27 A;  4JI0 C;  3GR0 A;  1V25 A;  4DR6 C;  4LFC C;  4KHP C;  4PUG A;  4U5Y D;  1WCJ A;  2E7G A;  1FUG A;  4NXN C;  3CQ2 A;  4GXR A;  5LMU C;  1IB8 A;  4TPS B;  1HNX C;  4BC9 A;  4K0K C;  2YX1 A;  1XNQ C;  3TDE A;  4JI3 C;  2MMA B;  1IBL C;  2QVZ X;  1MXC A;  4D4I A;  3I07 A;  2QVX X;  5BST A;  3DLP X;  4GS5 A;  2D1Q A;  4RLQ A;  4MTN A;  4DG8 A;  1T5H X;  3I08 A;  3SO4 A;  1LCI A;  4FTF A;  2YWB A;  2VQE C;  4D4G A;  2QW0 X;  1V26 A;  2VSQ A;  3UEB A;  4I9F A;  4LF9 C;  2XR1 A;  2P2B A;  2WD9 A;  1PG3 A; 
#chains in the Genus database with same CATH homology
 2MM9 A;  2DHM A;  3TR3 A;  1V60 A;  1NY8 A;  1XS3 A;  2KDN A;  2KZ0 A;  4PUH A;  4PUG A;  5LCI A;  2MCQ A;  4PUI A;  2NCL A;  3O2E A;  2MMA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...