2MMAB

Nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
VTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mmaB00
2DHMA 5LCIA 2KDNA 4PUGA 1V60A 4PUIA 2MMAB 2MM9A 2NCLA 2KZ0A 1XS3A 3TR3A 1NY8A 2MCQA 4PUHA 3O2EA
chains in the Genus database with same CATH superfamily
1GPMA 5KYVA 4TPSB 2BH1X 3E7XA 1M6XA 1P4EA 4JI5C 2KZFA 4RM2A 1RG9A 2OPLB 1FJGC 3JAMD 1UKKA 3FCCA 4RM3A 4RVOA 1P4EC 4L2ZA 3GR0A 5E7QA 3EQ6A 1FUGA 1XNRC 3J80D 2VQFC 5FLXD 4LE5A 3LAXA 2AYAA 2P2FA 2YWCA 4FUTA 2D1TA 2QVYX 5A2QD 3UX2A 1YJ7A 3CJEA 5BR8C 4PUGA 2CY1A 3H2TA 3K6RA 5BSVA 5CZXA 4JI2C 4X64C 2UU9C 4JI3C 4LFCC 2MMAB 1N33C 1XRBA 1IBLC 1MXBA 2UUBC 3LNOA 4BSZA 2Y27A 4GXRA 1VLAA 5IWAC 4DV7C 1N2FA 5K8FA 4DUYC 3DAYA 4JM1A 5CZVA 4DCVA 3CQ3A 3A4IA 5H9UA 3TDEA 4MH4A 4DR3C 4PROC 4DV4C 4DV0C 2WP0C 3UZ0A 4NOZA 4ZLPA 1IBMC 1O93A 2PROA 4LF5C 1O92A 4DV1C 4JYAC 1PG4A 5BUQA 2HJGA 4BC9A 2V7BA 2UXCC 4IR7A 1NYEA 2NCLA 2E8CA 1P7LA 2YWBA 3VNQA 1VEHA 2VZEA 3ETCA 4ZJZA 3IPLA 3O2EA 1T5DX 2E7GA 3IEVA 1JOSA 1XRAA 4X62C 5BSTA 2YCBA 3FCEA 2OPLA 3A9VA 1WCJA 3CQ1A 2UUAC 1I94C 2BJOA 3N54B 5BSMA 4DUZC 3B7WA 4OYCA 3VNRA 3PESA 4KTTA 4YY3C 5A1IA 3A9UA 4NXMC 1V60A 2P02A 4PUIA 2P20A 1ZB9A 3UOWA 3J81D 2UXDC 3E7WA 3LNVA 2HHHC 2KZ0A 3NI2A 4ISBA 1USPB 5LMUC 4LF7C 1HH2P 5BSUA 4NXNC 1BA3A 1MDBA 4LF4C 2QL8A 4DV2C 5K85A 2VSQA 5LMNC 4JV5C 1TH5A 2E5LC 1NY8A 1ULTA 4RMNA 2UUCC 1RY2A 4K0BA 1HNWC 2D1QA 4BC7A 3OTOC 4D4IA 3A25A 2DYJA 4GKKC 3GKUA 4AQYC 4HPVA 5BSWA 2ATWA 2ZZNA 2KDNA 2CXCA 4DCUA 3CW9A 1N34C 3PBKA 4JI6C 1LCIA 3TQIA 4G1IA 2OBVA 2QVXX 4X66C 3S82A 4G36A 2QVZX 4G37A 3A26A 3SO4A 2D1SA 2Z51A 4I9FA 1PG3A 4B3SC 3UX3A 1XMOC 3UEBA 4NDNA 1ZB8A 2ZM6C 2DHMA 5LCIA 2M5OA 1MKYA 2E0GA 4LFBC 3DHVA 4PUHA 3R44A 4EATA 4DCTA 4XX2A 2D28C 3TR3A 2JMPA 2WD9A 4U5YD 2D7VA 4JI1C 2JNVA 4JI4C 2MM9A 3GPCA 3L8CA 5BURA 4D57A 2ONFA 3G7SA 1UWDA 4RLQA 4BCAA 4JI8C 1MD9A 2P2MA 4YHHC 3TUFA 5JRHA 3LGXA 2PN2A 4GS5A 4OX9C 1QWIA 1K0RA 4JI0C 4B3MC 3PROC 2OO4A 4JI7C 3ETOA 3T1HC 1KKGA 1USPA 1V26A 2VQEC 1MDFA 2D27A 5KYTA 1QM4A 4IZ6A 1AMUA 1WF3A 4LF8C 3KXWA 4PHTA 2UXBC 2QW0X 4PZPA 4DV6C 1EGAA 1PU1A 4DCSA 2P2JA 1XMQC 1M6XC 1FLOA 4WS9A 3AF6A 4GXQA 1J5EC 1O90A 5AE2A 3CW8X 1LQLA 1WH9A 4DR2C 2ASBA 4L4QA 4ODJA 5ADZA 4GKJC 1XNQC 4X65C 1T5HX 1XS3A 5BUSA 5A1GA 3GR1A 3N2QA 1N36C 3AY0A 3I07A 4I9GA 5KEIA 3R9WA 3NPDA 4DV3C 4OXIA 2Y4NA 4RVNA 4L7IA 2MCQA 2P2QA 4KTVA 2D1RA 2DPLA 1ML8A 4D56A 4DR6C 3RV2A 4FUQA 4DR4C 3C5EA 1MXAA 3LUSA 3T1YC 4DR7C 3RG2A 3R9XA 2E8EA 1HNZC 1HR0C 2ZZMA 4D4GA 4R1MA 1IBKC 4DG9A 2P2BA 2XR1A 2E8FA 4R1LA 1MXCA 4LF6C 2M5HA 5T8TA 2YX1A 4RLFA 3IEUA 2Y4OA 1V25A 3NYQA 4B3RC 3NYRA 4K0KC 3VNSA 4B3TC 2EGTA 3IMLA 1IB8A 5DV9A 5AE1A 4R0MA 4BBYA 5IT9D 3DLPX 1N32C 4DV5C 3L95X 1PA4A 1L2FA 3AF5A 1HNXC 2CU6A 5BSRA 4LFAC 4DR5C 4LF9C 2PT7G 4DG8A 5GTDA 5IFIA 4KHPC 1XHJA 4WV3A 1O9TA 4MTNA 4DR1C 5AE3A 3EERA 4FTFA 3I08A 5A19A 3CQ2A 2F4VC 5T8SA 1XRCA
chains in the Genus database with same CATH topology
2DHMA 5LCIA 2KDNA 4PUGA 1V60A 4PUIA 2MMAB 2MM9A 2NCLA 2KZ0A 1XS3A 3TR3A 1NY8A 2MCQA 4PUHA 3O2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DHM A;  5LCI A;  2KDN A;  4PUG A;  1V60 A;  4PUI A;  2MMA B;  2MM9 A;  2NCL A;  2KZ0 A;  1XS3 A;  3TR3 A;  1NY8 A;  2MCQ A;  4PUH A;  3O2E A; 
#chains in the Genus database with same CATH topology
 1GPM A;  5KYV A;  4TPS B;  2BH1 X;  3E7X A;  1M6X A;  1P4E A;  4JI5 C;  2KZF A;  4RM2 A;  1RG9 A;  2OPL B;  1FJG C;  3JAM D;  1UKK A;  3FCC A;  4RM3 A;  4RVO A;  1P4E C;  4L2Z A;  3GR0 A;  5E7Q A;  3EQ6 A;  1FUG A;  1XNR C;  3J80 D;  2VQF C;  5FLX D;  4LE5 A;  3LAX A;  2AYA A;  2P2F A;  2YWC A;  4FUT A;  2D1T A;  2QVY X;  5A2Q D;  3UX2 A;  1YJ7 A;  3CJE A;  5BR8 C;  4PUG A;  2CY1 A;  3H2T A;  3K6R A;  5BSV A;  5CZX A;  4JI2 C;  4X64 C;  2UU9 C;  4JI3 C;  4LFC C;  2MMA B;  1N33 C;  1XRB A;  1IBL C;  1MXB A;  2UUB C;  3LNO A;  4BSZ A;  2Y27 A;  4GXR A;  1VLA A;  5IWA C;  4DV7 C;  1N2F A;  5K8F A;  4DUY C;  3DAY A;  4JM1 A;  5CZV A;  4DCV A;  3CQ3 A;  3A4I A;  5H9U A;  3TDE A;  4MH4 A;  4DR3 C;  4PRO C;  4DV4 C;  4DV0 C;  2WP0 C;  3UZ0 A;  4NOZ A;  4ZLP A;  1IBM C;  1O93 A;  2PRO A;  4LF5 C;  1O92 A;  4DV1 C;  4JYA C;  1PG4 A;  5BUQ A;  2HJG A;  4BC9 A;  2V7B A;  2UXC C;  4IR7 A;  1NYE A;  2NCL A;  2E8C A;  1P7L A;  2YWB A;  3VNQ A;  1VEH A;  2VZE A;  3ETC A;  4ZJZ A;  3IPL A;  3O2E A;  1T5D X;  2E7G A;  3IEV A;  1JOS A;  1XRA A;  4X62 C;  5BST A;  2YCB A;  3FCE A;  2OPL A;  3A9V A;  1WCJ A;  3CQ1 A;  2UUA C;  1I94 C;  2BJO A;  3N54 B;  5BSM A;  4DUZ C;  3B7W A;  4OYC A;  3VNR A;  3PES A;  4KTT A;  4YY3 C;  5A1I A;  3A9U A;  4NXM C;  1V60 A;  2P02 A;  4PUI A;  2P20 A;  1ZB9 A;  3UOW A;  3J81 D;  2UXD C;  3E7W A;  3LNV A;  2HHH C;  2KZ0 A;  3NI2 A;  4ISB A;  1USP B;  5LMU C;  4LF7 C;  1HH2 P;  5BSU A;  4NXN C;  1BA3 A;  1MDB A;  4LF4 C;  2QL8 A;  4DV2 C;  5K85 A;  2VSQ A;  5LMN C;  4JV5 C;  1TH5 A;  2E5L C;  1NY8 A;  1ULT A;  4RMN A;  2UUC C;  1RY2 A;  4K0B A;  1HNW C;  2D1Q A;  4BC7 A;  3OTO C;  4D4I A;  3A25 A;  2DYJ A;  4GKK C;  3GKU A;  4AQY C;  4HPV A;  5BSW A;  2ATW A;  2ZZN A;  2KDN A;  2CXC A;  4DCU A;  3CW9 A;  1N34 C;  3PBK A;  4JI6 C;  1LCI A;  3TQI A;  4G1I A;  2OBV A;  2QVX X;  4X66 C;  3S82 A;  4G36 A;  2QVZ X;  4G37 A;  3A26 A;  3SO4 A;  2D1S A;  2Z51 A;  4I9F A;  1PG3 A;  4B3S C;  3UX3 A;  1XMO C;  3UEB A;  4NDN A;  1ZB8 A;  2ZM6 C;  2DHM A;  5LCI A;  2M5O A;  1MKY A;  2E0G A;  4LFB C;  3DHV A;  4PUH A;  3R44 A;  4EAT A;  4DCT A;  4XX2 A;  2D28 C;  3TR3 A;  2JMP A;  2WD9 A;  4U5Y D;  2D7V A;  4JI1 C;  2JNV A;  4JI4 C;  2MM9 A;  3GPC A;  3L8C A;  5BUR A;  4D57 A;  2ONF A;  3G7S A;  1UWD A;  4RLQ A;  4BCA A;  4JI8 C;  1MD9 A;  2P2M A;  4YHH C;  3TUF A;  5JRH A;  3LGX A;  2PN2 A;  4GS5 A;  4OX9 C;  1QWI A;  1K0R A;  4JI0 C;  4B3M C;  3PRO C;  2OO4 A;  4JI7 C;  3ETO A;  3T1H C;  1KKG A;  1USP A;  1V26 A;  2VQE C;  1MDF A;  2D27 A;  5KYT A;  1QM4 A;  4IZ6 A;  1AMU A;  1WF3 A;  4LF8 C;  3KXW A;  4PHT A;  2UXB C;  2QW0 X;  4PZP A;  4DV6 C;  1EGA A;  1PU1 A;  4DCS A;  2P2J A;  1XMQ C;  1M6X C;  1FLO A;  4WS9 A;  3AF6 A;  4GXQ A;  1J5E C;  1O90 A;  5AE2 A;  3CW8 X;  1LQL A;  1WH9 A;  4DR2 C;  2ASB A;  4L4Q A;  4ODJ A;  5ADZ A;  4GKJ C;  1XNQ C;  4X65 C;  1T5H X;  1XS3 A;  5BUS A;  5A1G A;  3GR1 A;  3N2Q A;  1N36 C;  3AY0 A;  3I07 A;  4I9G A;  5KEI A;  3R9W A;  3NPD A;  4DV3 C;  4OXI A;  2Y4N A;  4RVN A;  4L7I A;  2MCQ A;  2P2Q A;  4KTV A;  2D1R A;  2DPL A;  1ML8 A;  4D56 A;  4DR6 C;  3RV2 A;  4FUQ A;  4DR4 C;  3C5E A;  1MXA A;  3LUS A;  3T1Y C;  4DR7 C;  3RG2 A;  3R9X A;  2E8E A;  1HNZ C;  1HR0 C;  2ZZM A;  4D4G A;  4R1M A;  1IBK C;  4DG9 A;  2P2B A;  2XR1 A;  2E8F A;  4R1L A;  1MXC A;  4LF6 C;  2M5H A;  5T8T A;  2YX1 A;  4RLF A;  3IEU A;  2Y4O A;  1V25 A;  3NYQ A;  4B3R C;  3NYR A;  4K0K C;  3VNS A;  4B3T C;  2EGT A;  3IML A;  1IB8 A;  5DV9 A;  5AE1 A;  4R0M A;  4BBY A;  5IT9 D;  3DLP X;  1N32 C;  4DV5 C;  3L95 X;  1PA4 A;  1L2F A;  3AF5 A;  1HNX C;  2CU6 A;  5BSR A;  4LFA C;  4DR5 C;  4LF9 C;  2PT7 G;  4DG8 A;  5GTD A;  5IFI A;  4KHP C;  1XHJ A;  4WV3 A;  1O9T A;  4MTN A;  4DR1 C;  5AE3 A;  3EER A;  4FTF A;  3I08 A;  5A19 A;  3CQ2 A;  2F4V C;  5T8S A;  1XRC A; 
#chains in the Genus database with same CATH homology
 2DHM A;  5LCI A;  2KDN A;  4PUG A;  1V60 A;  4PUI A;  2MMA B;  2MM9 A;  2NCL A;  2KZ0 A;  1XS3 A;  3TR3 A;  1NY8 A;  2MCQ A;  4PUH A;  3O2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...