2MMAB

Nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
VTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mmaB00
2KDNA 4PUIA 2NCLA 1NY8A 2MM9A 5LCIA 2MMAB 4PUHA 1XS3A 4PUGA 2MCQA 3O2EA 3TR3A 2KZ0A 2DHMA 1V60A
chains in the Genus database with same CATH superfamily
2Y4OA 1N2FA 4AQYC 2P2QA 2P2MA 3G7SA 4DV3C 4DV2C 2PT7G 5ADZA 4JI8C 1LCIA 2DYJA 2UXBC 3R44A 4FTFA 4BSZA 4I9GA 4ISBA 3RG2A 3A4IA 5AE2A 4K0KC 1WH9A 4FUTA 4LF8C 3UX3A 5KEIA 2ATWA 5KYTA 3I07A 4YY3C 1HNWC 2MCQA 1XNRC 3JAMD 4OYCA 5T8TA 4LFAC 2VQEC 1XMQC 3AF5A 4EATA 5AE3A 2OBVA 5KYVA 3CW9A 2D1QA 4LF4C 4BC7A 2E8EA 1UWDA 3A9UA 4NDNA 4RM2A 4DCTA 5LMUC 3GKUA 3H2TA 3TUFA 4PUGA 1N32C 4G1IA 5A19A 2OPLB 4NXMC 1QWIA 5BUSA 1AMUA 4BC9A 2CY1A 3O2EA 1J5EC 3CQ2A 1ML8A 3A25A 2DHMA 4X64C 4LF9C 3CQ3A 4JI4C 2M5HA 4BBYA 4DCUA 1IB8A 4PZPA 4LFCC 4KHPC 1RY2A 4L4QA 4RVOA 2QVXX 5CZXA 4GXQA 3TR3A 1UKKA 1PG3A 2VQFC 2JNVA 2KDNA 4R0MA 4RVNA 4OXIA 4MTNA 5BURA 3NYRA 3TQIA 2P2JA 2ASBA 3J80D 2Z51A 4ZJZA 1XRBA 2NCLA 3CW8X 3SO4A 5BSVA 4MH4A 1HH2P 2HJGA 1LQLA 5LCIA 1QM4A 2E8FA 4L7IA 4DR1C 1XRAA 3L8CA 4HPVA 3RV2A 3IEVA 4U5YD 1ULTA 2P02A 4DR6C 3IPLA 1GPMA 5BSWA 1K0RA 1P7LA 3N2QA 4X65C 1MXBA 1P4EA 2VSQA 4FUQA 4TPSB 3S82A 3A26A 3AF6A 1XHJA 1VEHA 5BR8C 4D56A 2UUAC 1V26A 2JMPA 3C5EA 4ZLPA 2P20A 3OTOC 4X62C 4PUIA 3LUSA 1XS3A 3FCEA 4JI6C 4YHHC 2KZFA 3VNQA 4LF5C 2YX1A 3T1YC 4LF6C 1P4EC 4RM3A 3R9XA 5IWAC 1ZB8A 3L95X 1N33C 1V60A 2Y27A 1JOSA 4NXNC 4JI1C 5BSRA 5T8SA 5H9UA 4JI0C 3PESA 4DR4C 1PA4A 2OO4A 1V25A 5IT9D 4R1MA 2YWCA 5AE1A 1IBLC 5IFIA 4L2ZA 4WS9A 1YJ7A 1O92A 5BSMA 1N36C 4JI5C 2QW0X 1MDBA 2BH1X 1N34C 3PBKA 4JM1A 4B3MC 3LGXA 2PN2A 3T1HC 1ZB9A 4LF7C 3ETOA 3EERA 1FUGA 4WV3A 2UXDC 4I9FA 5BSTA 3UEBA 4IR7A 4DG8A 2MM9A 2WP0C 4DG9A 3GPCA 1BA3A 4DV6C 1WCJA 1TH5A 3PROC 1EGAA 1NYEA 5BSUA 1T5DX 1USPA 3NPDA 4DV7C 4JI7C 2P2FA 2MMAB 2M5OA 2DPLA 3UX2A 3TDEA 5A1GA 1NY8A 2QVZX 1USPB 1I94C 1PG4A 1T5HX 2PROA 4GXRA 4RLFA 1FJGC 4OX9C 2QVYX 1XNQC 1MD9A 4JV5C 4GKJC 4B3RC 2F4VC 2UU9C 3LNVA 2YWBA 4KTVA 4KTTA 3KXWA 4JYAC 3E7WA 3FCCA 4DV5C 3ETCA 1KKGA 1MXCA 4JI3C 1MDFA 4G36A 3LAXA 2AYAA 4LE5A 3GR1A 4DCSA 4GKKC 4DCVA 2HHHC 1M6XA 4G37A 2Y4NA 5FLXD 2KZ0A 4DR3C 4K0BA 1VLAA 2V7BA 1IBKC 3B7WA 3K6RA 5A1IA 5JRHA 3CQ1A 4LFBC 3GR0A 4DV4C 1O90A 2BJOA 1HNXC 5CZVA 1O93A 3AY0A 2ZM6C 4XX2A 4DUZC 3CJEA 3LNOA 1M6XC 4BCAA 3DHVA 4D4IA 1RG9A 5K8FA 4DV1C 2CU6A 4PROC 5LMNC 1IBMC 4D57A 4DR7C 4DV0C 5GTDA 4JI2C 3VNSA 5DV9A 4PHTA 3R9WA 4DUYC 4B3TC 2E0GA 2OPLA 2XR1A 1L2FA 4IZ6A 2D1SA 4X66C 2WD9A 2UUCC 5A2QD 3VNRA 3N54B 3UZ0A 1MXAA 2E5LC 1MKYA 4DR5C 4D4GA 4NOZA 1O9TA 1PU1A 2CXCA 2D27A 4ODJA 5BUQA 3UOWA 2UUBC 3I08A 2UXCC 2YCBA 3A9VA 2D28C 4B3SC 4GS5A 4RMNA 2D1TA 4RLQA 3DLPX 3E7XA 3EQ6A 1HNZC 2E8CA 2E7GA 2ONFA 3IMLA 2VZEA 1XMOC 2ZZNA 1XRCA 5E7QA 1HR0C 5K85A 2D7VA 2QL8A 1FLOA 2EGTA 3NYQA 3J81D 4R1LA 3NI2A 3DAYA 3IEUA 2P2BA 4PUHA 1WF3A 4DR2C 2D1RA 2ZZMA
chains in the Genus database with same CATH topology
2KDNA 4PUIA 2NCLA 1NY8A 2MM9A 5LCIA 2MMAB 4PUHA 1XS3A 4PUGA 2MCQA 3O2EA 3TR3A 2KZ0A 2DHMA 1V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDN A;  4PUI A;  2NCL A;  1NY8 A;  2MM9 A;  5LCI A;  2MMA B;  4PUH A;  1XS3 A;  4PUG A;  2MCQ A;  3O2E A;  3TR3 A;  2KZ0 A;  2DHM A;  1V60 A; 
#chains in the Genus database with same CATH topology
 2Y4O A;  1N2F A;  4AQY C;  2P2Q A;  2P2M A;  3G7S A;  4DV3 C;  4DV2 C;  2PT7 G;  5ADZ A;  4JI8 C;  1LCI A;  2DYJ A;  2UXB C;  3R44 A;  4FTF A;  4BSZ A;  4I9G A;  4ISB A;  3RG2 A;  3A4I A;  5AE2 A;  4K0K C;  1WH9 A;  4FUT A;  4LF8 C;  3UX3 A;  5KEI A;  2ATW A;  5KYT A;  3I07 A;  4YY3 C;  1HNW C;  2MCQ A;  1XNR C;  3JAM D;  4OYC A;  5T8T A;  4LFA C;  2VQE C;  1XMQ C;  3AF5 A;  4EAT A;  5AE3 A;  2OBV A;  5KYV A;  3CW9 A;  2D1Q A;  4LF4 C;  4BC7 A;  2E8E A;  1UWD A;  3A9U A;  4NDN A;  4RM2 A;  4DCT A;  5LMU C;  3GKU A;  3H2T A;  3TUF A;  4PUG A;  1N32 C;  4G1I A;  5A19 A;  2OPL B;  4NXM C;  1QWI A;  5BUS A;  1AMU A;  4BC9 A;  2CY1 A;  3O2E A;  1J5E C;  3CQ2 A;  1ML8 A;  3A25 A;  2DHM A;  4X64 C;  4LF9 C;  3CQ3 A;  4JI4 C;  2M5H A;  4BBY A;  4DCU A;  1IB8 A;  4PZP A;  4LFC C;  4KHP C;  1RY2 A;  4L4Q A;  4RVO A;  2QVX X;  5CZX A;  4GXQ A;  3TR3 A;  1UKK A;  1PG3 A;  2VQF C;  2JNV A;  2KDN A;  4R0M A;  4RVN A;  4OXI A;  4MTN A;  5BUR A;  3NYR A;  3TQI A;  2P2J A;  2ASB A;  3J80 D;  2Z51 A;  4ZJZ A;  1XRB A;  2NCL A;  3CW8 X;  3SO4 A;  5BSV A;  4MH4 A;  1HH2 P;  2HJG A;  1LQL A;  5LCI A;  1QM4 A;  2E8F A;  4L7I A;  4DR1 C;  1XRA A;  3L8C A;  4HPV A;  3RV2 A;  3IEV A;  4U5Y D;  1ULT A;  2P02 A;  4DR6 C;  3IPL A;  1GPM A;  5BSW A;  1K0R A;  1P7L A;  3N2Q A;  4X65 C;  1MXB A;  1P4E A;  2VSQ A;  4FUQ A;  4TPS B;  3S82 A;  3A26 A;  3AF6 A;  1XHJ A;  1VEH A;  5BR8 C;  4D56 A;  2UUA C;  1V26 A;  2JMP A;  3C5E A;  4ZLP A;  2P20 A;  3OTO C;  4X62 C;  4PUI A;  3LUS A;  1XS3 A;  3FCE A;  4JI6 C;  4YHH C;  2KZF A;  3VNQ A;  4LF5 C;  2YX1 A;  3T1Y C;  4LF6 C;  1P4E C;  4RM3 A;  3R9X A;  5IWA C;  1ZB8 A;  3L95 X;  1N33 C;  1V60 A;  2Y27 A;  1JOS A;  4NXN C;  4JI1 C;  5BSR A;  5T8S A;  5H9U A;  4JI0 C;  3PES A;  4DR4 C;  1PA4 A;  2OO4 A;  1V25 A;  5IT9 D;  4R1M A;  2YWC A;  5AE1 A;  1IBL C;  5IFI A;  4L2Z A;  4WS9 A;  1YJ7 A;  1O92 A;  5BSM A;  1N36 C;  4JI5 C;  2QW0 X;  1MDB A;  2BH1 X;  1N34 C;  3PBK A;  4JM1 A;  4B3M C;  3LGX A;  2PN2 A;  3T1H C;  1ZB9 A;  4LF7 C;  3ETO A;  3EER A;  1FUG A;  4WV3 A;  2UXD C;  4I9F A;  5BST A;  3UEB A;  4IR7 A;  4DG8 A;  2MM9 A;  2WP0 C;  4DG9 A;  3GPC A;  1BA3 A;  4DV6 C;  1WCJ A;  1TH5 A;  3PRO C;  1EGA A;  1NYE A;  5BSU A;  1T5D X;  1USP A;  3NPD A;  4DV7 C;  4JI7 C;  2P2F A;  2MMA B;  2M5O A;  2DPL A;  3UX2 A;  3TDE A;  5A1G A;  1NY8 A;  2QVZ X;  1USP B;  1I94 C;  1PG4 A;  1T5H X;  2PRO A;  4GXR A;  4RLF A;  1FJG C;  4OX9 C;  2QVY X;  1XNQ C;  1MD9 A;  4JV5 C;  4GKJ C;  4B3R C;  2F4V C;  2UU9 C;  3LNV A;  2YWB A;  4KTV A;  4KTT A;  3KXW A;  4JYA C;  3E7W A;  3FCC A;  4DV5 C;  3ETC A;  1KKG A;  1MXC A;  4JI3 C;  1MDF A;  4G36 A;  3LAX A;  2AYA A;  4LE5 A;  3GR1 A;  4DCS A;  4GKK C;  4DCV A;  2HHH C;  1M6X A;  4G37 A;  2Y4N A;  5FLX D;  2KZ0 A;  4DR3 C;  4K0B A;  1VLA A;  2V7B A;  1IBK C;  3B7W A;  3K6R A;  5A1I A;  5JRH A;  3CQ1 A;  4LFB C;  3GR0 A;  4DV4 C;  1O90 A;  2BJO A;  1HNX C;  5CZV A;  1O93 A;  3AY0 A;  2ZM6 C;  4XX2 A;  4DUZ C;  3CJE A;  3LNO A;  1M6X C;  4BCA A;  3DHV A;  4D4I A;  1RG9 A;  5K8F A;  4DV1 C;  2CU6 A;  4PRO C;  5LMN C;  1IBM C;  4D57 A;  4DR7 C;  4DV0 C;  5GTD A;  4JI2 C;  3VNS A;  5DV9 A;  4PHT A;  3R9W A;  4DUY C;  4B3T C;  2E0G A;  2OPL A;  2XR1 A;  1L2F A;  4IZ6 A;  2D1S A;  4X66 C;  2WD9 A;  2UUC C;  5A2Q D;  3VNR A;  3N54 B;  3UZ0 A;  1MXA A;  2E5L C;  1MKY A;  4DR5 C;  4D4G A;  4NOZ A;  1O9T A;  1PU1 A;  2CXC A;  2D27 A;  4ODJ A;  5BUQ A;  3UOW A;  2UUB C;  3I08 A;  2UXC C;  2YCB A;  3A9V A;  2D28 C;  4B3S C;  4GS5 A;  4RMN A;  2D1T A;  4RLQ A;  3DLP X;  3E7X A;  3EQ6 A;  1HNZ C;  2E8C A;  2E7G A;  2ONF A;  3IML A;  2VZE A;  1XMO C;  2ZZN A;  1XRC A;  5E7Q A;  1HR0 C;  5K85 A;  2D7V A;  2QL8 A;  1FLO A;  2EGT A;  3NYQ A;  3J81 D;  4R1L A;  3NI2 A;  3DAY A;  3IEU A;  2P2B A;  4PUH A;  1WF3 A;  4DR2 C;  2D1R A;  2ZZM A; 
#chains in the Genus database with same CATH homology
 2KDN A;  4PUI A;  2NCL A;  1NY8 A;  2MM9 A;  5LCI A;  2MMA B;  4PUH A;  1XS3 A;  4PUG A;  2MCQ A;  3O2E A;  3TR3 A;  2KZ0 A;  2DHM A;  1V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...