2MMAB

Nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
80
structure length
80
Chain Sequence
VTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 22
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mmaB00
1XS3A 2KDNA 2MM9A 5LCIA 1V60A 3TR3A 4PUGA 2MMAB 2KZ0A 4PUIA 2MCQA 1NY8A 2DHMA 3O2EA 2NCLA 4PUHA
chains in the Genus database with same CATH superfamily
4FUTA 2JNVA 4ZLPA 2YWCA 3A26A 2OBVA 3DLPX 1QM4A 3TQIA 2QVXX 3RV2A 2WD9A 3VNQA 1ZB9A 1UKKA 2DYJA 3KXWA 2QL8A 1N34C 1XMOC 1NYEA 4PHTA 3R9XA 2D27A 4BSZA 1TH5A 4LFBC 1K0RA 5A1GA 2YCBA 3L95X 1IBLC 3UX3A 4JI8C 2UUCC 4U5YD 3LGXA 2E8CA 3PBKA 2D28C 2YWBA 4JI7C 1RY2A 2E0GA 3R44A 5GTDA 4G37A 2KZ0A 1HH2P 2D1TA 3JAMD 4LF4C 2D1RA 1AMUA 1V26A 2P2FA 1MDFA 1PU1A 5K8FA 1T5HX 4G1IA 3B7WA 4OX9C 4JYAC 1FUGA 3J80D 4B3SC 4TPSB 2ZM6C 4DV2C 4D57A 5CZVA 4NDNA 2YX1A 1XS3A 5LCIA 4DG9A 2CY1A 1ML8A 4RLQA 2BH1X 1P7LA 4R1LA 2F4VC 4OYCA 4GS5A 4DV7C 1ULTA 5BUQA 4DV3C 2P2QA 4KTTA 3UX2A 5BSMA 5BSUA 1PG4A 1WCJA 4X66C 1O92A 3GKUA 1GPMA 4JI1C 1ZB8A 3TR3A 2PT7G 3N54B 2PROA 4KHPC 3FCEA 3A9VA 4MTNA 5BR8C 4LF8C 4GXRA 5IFIA 1O93A 3LAXA 4RMNA 3K6RA 4JI4C 4ISBA 3CQ1A 4LFAC 5CZXA 5BURA 4DV4C 4IR7A 4RM2A 4JI3C 1P4EC 2ONFA 4DR5C 3RG2A 1JOSA 3I07A 2V7BA 4L2ZA 1I94C 1VLAA 3J81D 2DHMA 1XNQC 5ADZA 4DUZC 1QWIA 1IBMC 4X65C 2OO4A 2UUAC 1USPB 4GKJC 1XRCA 5K85A 2VZEA 1HNZC 2UXDC 4LF9C 4XX2A 3E7WA 4D4GA 1XNRC 3IPLA 2AYAA 2EGTA 4DR2C 3H2TA 1BA3A 2HHHC 2E5LC 4LF7C 3N2QA 4BC9A 4OXIA 1HR0C 3EERA 4DV0C 3IEUA 4MH4A 5DV9A 4BBYA 4DCVA 3GR1A 2P20A 3A25A 1N32C 3G7SA 1PA4A 3AF6A 5KYVA 1MKYA 4RVNA 1USPA 4JI0C 3EQ6A 2MM9A 2Y4OA 2UXBC 3PESA 4B3RC 4D56A 4YY3C 4PROC 3A4IA 4B3TC 3R9WA 2UXCC 3VNRA 4DR7C 4LF6C 2D1QA 3DAYA 3CJEA 3DHVA 3TDEA 3UEBA 1RG9A 3ETOA 3FCCA 1WF3A 2D7VA 4DUYC 1N33C 3CQ3A 3T1YC 4DR4C 4DR3C 2KZFA 2BJOA 5KEIA 5A2QD 4JI5C 3IEVA 2JMPA 5A1IA 4RM3A 2M5OA 5BSVA 2MMAB 2P2MA 2P2JA 2E7GA 3UOWA 3CQ2A 1FJGC 4L4QA 2OPLB 5E7QA 2Y4NA 3I08A 1IB8A 3VNSA 5AE2A 2ASBA 4K0KC 4NXMC 2KDNA 3NPDA 4LFCC 2UUBC 2Y27A 2P2BA 5T8SA 1J5EC 4ZJZA 4JI2C 1LQLA 4LF5C 4WV3A 4D4IA 4RVOA 1P4EA 4I9FA 1MDBA 3ETCA 3AF5A 4NOZA 5A19A 2OPLA 1M6XA 1L2FA 1T5DX 4IZ6A 2UU9C 3A9UA 5H9UA 2E8FA 1V60A 4JV5C 3S82A 4X62C 3LNOA 4BC7A 3GPCA 4PUGA 4HPVA 5IWAC 4ODJA 4AQYC 2NCLA 4GKKC 1PG3A 2XR1A 1WH9A 5LMUC 4DCTA 1N2FA 2QVZX 4FUQA 3LNVA 3E7XA 4DV1C 4DG8A 2ATWA 4GXQA 1NY8A 4PZPA 2CU6A 1XMQC 4B3MC 4R0MA 1O90A 5BSRA 3CW8X 2Z51A 4K0BA 4DV6C 2P02A 3OTOC 2M5HA 2D1SA 3LUSA 1UWDA 2VQFC 2VSQA 1O9TA 3SO4A 2QVYX 1XRAA 4YHHC 2E8EA 4PUHA 1V25A 5LMNC 1LCIA 3NYRA 2MCQA 3T1HC 4X64C 1MXBA 3PROC 2ZZNA 3AY0A 4KTVA 4RLFA 5IT9D 4L7IA 1IBKC 3GR0A 4DCSA 3TUFA 1EGAA 1YJ7A 3C5EA 1HNWC 1N36C 4JM1A 4DR1C 4DCUA 3NYQA 1MXAA 4JI6C 2CXCA 5FLXD 4LE5A 4G36A 1MXCA 5AE3A 1XHJA 4NXNC 5BSTA 2DPLA 2HJGA 1HNXC 5BUSA 4WS9A 4FTFA 5BSWA 4I9GA 2PN2A 1KKGA 5KYTA 4BCAA 1MD9A 4PUIA 2QW0X 4R1MA 3L8CA 3CW9A 5JRHA 1XRBA 2VQEC 3NI2A 5AE1A 3IMLA 4EATA 3UZ0A 1VEHA 4DV5C 4DR6C 3O2EA 5T8TA 1M6XC 2WP0C 1FLOA 2ZZMA
chains in the Genus database with same CATH topology
1XS3A 2KDNA 2MM9A 5LCIA 1V60A 3TR3A 4PUGA 2MMAB 2KZ0A 4PUIA 2MCQA 1NY8A 2DHMA 3O2EA 2NCLA 4PUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XS3 A;  2KDN A;  2MM9 A;  5LCI A;  1V60 A;  3TR3 A;  4PUG A;  2MMA B;  2KZ0 A;  4PUI A;  2MCQ A;  1NY8 A;  2DHM A;  3O2E A;  2NCL A;  4PUH A; 
#chains in the Genus database with same CATH topology
 4FUT A;  2JNV A;  4ZLP A;  2YWC A;  3A26 A;  2OBV A;  3DLP X;  1QM4 A;  3TQI A;  2QVX X;  3RV2 A;  2WD9 A;  3VNQ A;  1ZB9 A;  1UKK A;  2DYJ A;  3KXW A;  2QL8 A;  1N34 C;  1XMO C;  1NYE A;  4PHT A;  3R9X A;  2D27 A;  4BSZ A;  1TH5 A;  4LFB C;  1K0R A;  5A1G A;  2YCB A;  3L95 X;  1IBL C;  3UX3 A;  4JI8 C;  2UUC C;  4U5Y D;  3LGX A;  2E8C A;  3PBK A;  2D28 C;  2YWB A;  4JI7 C;  1RY2 A;  2E0G A;  3R44 A;  5GTD A;  4G37 A;  2KZ0 A;  1HH2 P;  2D1T A;  3JAM D;  4LF4 C;  2D1R A;  1AMU A;  1V26 A;  2P2F A;  1MDF A;  1PU1 A;  5K8F A;  1T5H X;  4G1I A;  3B7W A;  4OX9 C;  4JYA C;  1FUG A;  3J80 D;  4B3S C;  4TPS B;  2ZM6 C;  4DV2 C;  4D57 A;  5CZV A;  4NDN A;  2YX1 A;  1XS3 A;  5LCI A;  4DG9 A;  2CY1 A;  1ML8 A;  4RLQ A;  2BH1 X;  1P7L A;  4R1L A;  2F4V C;  4OYC A;  4GS5 A;  4DV7 C;  1ULT A;  5BUQ A;  4DV3 C;  2P2Q A;  4KTT A;  3UX2 A;  5BSM A;  5BSU A;  1PG4 A;  1WCJ A;  4X66 C;  1O92 A;  3GKU A;  1GPM A;  4JI1 C;  1ZB8 A;  3TR3 A;  2PT7 G;  3N54 B;  2PRO A;  4KHP C;  3FCE A;  3A9V A;  4MTN A;  5BR8 C;  4LF8 C;  4GXR A;  5IFI A;  1O93 A;  3LAX A;  4RMN A;  3K6R A;  4JI4 C;  4ISB A;  3CQ1 A;  4LFA C;  5CZX A;  5BUR A;  4DV4 C;  4IR7 A;  4RM2 A;  4JI3 C;  1P4E C;  2ONF A;  4DR5 C;  3RG2 A;  1JOS A;  3I07 A;  2V7B A;  4L2Z A;  1I94 C;  1VLA A;  3J81 D;  2DHM A;  1XNQ C;  5ADZ A;  4DUZ C;  1QWI A;  1IBM C;  4X65 C;  2OO4 A;  2UUA C;  1USP B;  4GKJ C;  1XRC A;  5K85 A;  2VZE A;  1HNZ C;  2UXD C;  4LF9 C;  4XX2 A;  3E7W A;  4D4G A;  1XNR C;  3IPL A;  2AYA A;  2EGT A;  4DR2 C;  3H2T A;  1BA3 A;  2HHH C;  2E5L C;  4LF7 C;  3N2Q A;  4BC9 A;  4OXI A;  1HR0 C;  3EER A;  4DV0 C;  3IEU A;  4MH4 A;  5DV9 A;  4BBY A;  4DCV A;  3GR1 A;  2P20 A;  3A25 A;  1N32 C;  3G7S A;  1PA4 A;  3AF6 A;  5KYV A;  1MKY A;  4RVN A;  1USP A;  4JI0 C;  3EQ6 A;  2MM9 A;  2Y4O A;  2UXB C;  3PES A;  4B3R C;  4D56 A;  4YY3 C;  4PRO C;  3A4I A;  4B3T C;  3R9W A;  2UXC C;  3VNR A;  4DR7 C;  4LF6 C;  2D1Q A;  3DAY A;  3CJE A;  3DHV A;  3TDE A;  3UEB A;  1RG9 A;  3ETO A;  3FCC A;  1WF3 A;  2D7V A;  4DUY C;  1N33 C;  3CQ3 A;  3T1Y C;  4DR4 C;  4DR3 C;  2KZF A;  2BJO A;  5KEI A;  5A2Q D;  4JI5 C;  3IEV A;  2JMP A;  5A1I A;  4RM3 A;  2M5O A;  5BSV A;  2MMA B;  2P2M A;  2P2J A;  2E7G A;  3UOW A;  3CQ2 A;  1FJG C;  4L4Q A;  2OPL B;  5E7Q A;  2Y4N A;  3I08 A;  1IB8 A;  3VNS A;  5AE2 A;  2ASB A;  4K0K C;  4NXM C;  2KDN A;  3NPD A;  4LFC C;  2UUB C;  2Y27 A;  2P2B A;  5T8S A;  1J5E C;  4ZJZ A;  4JI2 C;  1LQL A;  4LF5 C;  4WV3 A;  4D4I A;  4RVO A;  1P4E A;  4I9F A;  1MDB A;  3ETC A;  3AF5 A;  4NOZ A;  5A19 A;  2OPL A;  1M6X A;  1L2F A;  1T5D X;  4IZ6 A;  2UU9 C;  3A9U A;  5H9U A;  2E8F A;  1V60 A;  4JV5 C;  3S82 A;  4X62 C;  3LNO A;  4BC7 A;  3GPC A;  4PUG A;  4HPV A;  5IWA C;  4ODJ A;  4AQY C;  2NCL A;  4GKK C;  1PG3 A;  2XR1 A;  1WH9 A;  5LMU C;  4DCT A;  1N2F A;  2QVZ X;  4FUQ A;  3LNV A;  3E7X A;  4DV1 C;  4DG8 A;  2ATW A;  4GXQ A;  1NY8 A;  4PZP A;  2CU6 A;  1XMQ C;  4B3M C;  4R0M A;  1O90 A;  5BSR A;  3CW8 X;  2Z51 A;  4K0B A;  4DV6 C;  2P02 A;  3OTO C;  2M5H A;  2D1S A;  3LUS A;  1UWD A;  2VQF C;  2VSQ A;  1O9T A;  3SO4 A;  2QVY X;  1XRA A;  4YHH C;  2E8E A;  4PUH A;  1V25 A;  5LMN C;  1LCI A;  3NYR A;  2MCQ A;  3T1H C;  4X64 C;  1MXB A;  3PRO C;  2ZZN A;  3AY0 A;  4KTV A;  4RLF A;  5IT9 D;  4L7I A;  1IBK C;  3GR0 A;  4DCS A;  3TUF A;  1EGA A;  1YJ7 A;  3C5E A;  1HNW C;  1N36 C;  4JM1 A;  4DR1 C;  4DCU A;  3NYQ A;  1MXA A;  4JI6 C;  2CXC A;  5FLX D;  4LE5 A;  4G36 A;  1MXC A;  5AE3 A;  1XHJ A;  4NXN C;  5BST A;  2DPL A;  2HJG A;  1HNX C;  5BUS A;  4WS9 A;  4FTF A;  5BSW A;  4I9G A;  2PN2 A;  1KKG A;  5KYT A;  4BCA A;  1MD9 A;  4PUI A;  2QW0 X;  4R1M A;  3L8C A;  3CW9 A;  5JRH A;  1XRB A;  2VQE C;  3NI2 A;  5AE1 A;  3IML A;  4EAT A;  3UZ0 A;  1VEH A;  4DV5 C;  4DR6 C;  3O2E A;  5T8T A;  1M6X C;  2WP0 C;  1FLO A;  2ZZM A; 
#chains in the Genus database with same CATH homology
 1XS3 A;  2KDN A;  2MM9 A;  5LCI A;  1V60 A;  3TR3 A;  4PUG A;  2MMA B;  2KZ0 A;  4PUI A;  2MCQ A;  1NY8 A;  2DHM A;  3O2E A;  2NCL A;  4PUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...