3UEBA

Crystal structure of ton_0450 from thermococcus onnurineus na1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
102
Chain Sequence
GSSGKRVIHIGLPELSEEQLIEIGELAQETIIDYVFDHLTRSEVKDIEVTMRINREETLDLEIEVYLEVPIFVKVDVDKLIDEAVERAYEIVERKLREIANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of an Euryarchaeota-specific protein, TON_0450 from Thermococcus onnurineus NA1
rcsb
source organism Thermococcus onnurineus
molecule tags Unknown function
total genus 32
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11419 DUF3194 Protein of unknown function (DUF3194)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.100 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 MTH677-like 3uebA00
1PU1A 3UEBA
chains in the Genus database with same CATH superfamily
3UEBA 4K0KC 4BSZA 3L8CA 4R1LA 4WS9A 1N33C 3O2EA 5AE3A 1HNZC 2BJOA 2VQFC 4WV3A 3CW9A 4KHPC 1XMQC 4JI7C 1PG4A 2CY1A 3B7WA 5GTDA 5FLXD 2JMPA 2P20A 4DCUA 2P02A 1QM4A 3R9WA 4EATA 1NY8A 1QWIA 4L4QA 3UX2A 4LFAC 4BC7A 2QL8A 1O9TA 5LCIA 4JM1A 1XMOC 5LMUC 4DR6C 3FCCA 4BBYA 2VSQA 3GKUA 1USPA 1V60A 3LNOA 1HR0C 3T1HC 4JI2C 4FUTA 1FJGC 5KYVA 4LFBC 1XRAA 1VEHA 2OPLA 3PBKA 5H9UA 2XR1A 1P4EA 4IZ6A 2ONFA 4LE5A 1V26A 1K0RA 5T8SA 5BR8C 2MMAB 2YWCA 2QVYX 3PESA 2F4VC 1I94C 3E7WA 4ODJA 3TUFA 1RY2A 2UXBC 2OO4A 4RM2A 1M6XA 1T5HX 1UKKA 3I07A 3A4IA 2ATWA 3TR3A 4JI1C 4IR7A 1RG9A 5A1GA 3A26A 1P4EC 4OX9C 3KXWA 2QVXX 3SO4A 2ZZNA 5CZVA 3LUSA 1WH9A 3A25A 1N36C 1P7LA 2KDNA 3JAMD 1O93A 1VLAA 2DPLA 3CJEA 5E7QA 3E7XA 1LCIA 4DCSA 4RVOA 1GPMA 5AE2A 3NPDA 4ZJZA 1ML8A 2MM9A 4ZLPA 4B3TC 2D27A 4HPVA 3A9VA 4L7IA 4X66C 1PA4A 2DYJA 4ISBA 4RLFA 1TH5A 4DR5C 4RLQA 4DCVA 3NYQA 3N54B 4DR2C 4JI6C 4JI0C 4LF7C 2KZFA 2D1QA 4XX2A 2WD9A 2HJGA 4K0BA 2MCQA 3LGXA 2Y4NA 3H2TA 2UUBC 4NOZA 3R9XA 1XS3A 4DV4C 2M5HA 4X64C 3CW8X 1IBKC 4JI4C 2ZM6C 5ADZA 1ZB8A 1N2FA 4NDNA 4GXRA 2UUAC 1EGAA 4B3SC 5KYTA 4JI3C 4DR3C 1BA3A 4PUIA 1L2FA 2PN2A 4R1MA 3I08A 1IBLC 2ASBA 3C5EA 1V25A 5T8TA 4D4IA 2P2JA 4R0MA 4JV5C 1MXBA 4L2ZA 3S82A 1IB8A 3DAYA 4NXNC 3A9UA 2CU6A 4JYAC 2QVZX 1IBMC 1MDFA 3K6RA 4PUHA 3UZ0A 4MTNA 2P2MA 3RG2A 4DV0C 1J5EC 5BSUA 2P2FA 1WCJA 5BUQA 2D1SA 1MKYA 4DUYC 3CQ1A 4B3MC 2E8CA 2JNVA 4U5YD 2D1TA 2Z51A 2EGTA 1XNQC 5K85A 5IFIA 4OXIA 1MXCA 3CQ2A 4DG8A 2P2QA 4YHHC 4D4GA 2E7GA 2M5OA 3FCEA 2UXDC 1ZB9A 2OBVA 1HNWC 3NYRA 1PG3A 3ETOA 2D1RA 5LMNC 4LF5C 1N32C 2E0GA 1XRBA 1XRCA 1MD9A 1HNXC 3TQIA 1NYEA 3R44A 4LF8C 3VNQA 2E8FA 2BH1X 4B3RC 3CQ3A 4RM3A 3GR1A 1XHJA 2Y27A 3LAXA 2ZZMA 4D57A 4DV3C 2UXCC 3J81D 3GPCA 4RMNA 5BSRA 3VNSA 4G36A 4LF4C 3EERA 4LF6C 4DV1C 3N2QA 2UUCC 4LFCC 2PT7G 3AF5A 3UOWA 5BSWA 5K8FA 2YX1A 1T5DX 1MXAA 4PZPA 2HHHC 2PROA 1USPB 2E8EA 2YCBA 5DV9A 3IEUA 1O90A 5CZXA 2OPLB 3TDEA 1MDBA 4TPSB 5BUSA 4DV2C 2CXCA 3AY0A 2NCLA 5IT9D 4DV6C 1O92A 4G37A 3VNRA 5A1IA 3LNVA 4JI8C 4AQYC 1KKGA 4DUZC 5BSTA 4DR1C 3DLPX 2D28C 5IWAC 5A19A 4D56A 3DHVA 4PHTA 2P2BA 3NI2A 3RV2A 4DG9A 2YWBA 3IEVA 4YY3C 4OYCA 4KTTA 3EQ6A 5A2QD 2AYAA 2KZ0A 4DCTA 4RVNA 3L95X 5JRHA 5BSMA 4NXMC 1XNRC 4G1IA 4X62C 3AF6A 5BSVA 4I9FA 1AMUA 4GKJC 2VZEA 3GR0A 3J80D 4LF9C 3IPLA 3UX3A 2Y4OA 4BC9A 3ETCA 4I9GA 1FLOA 1ULTA 1JOSA 4GXQA 3IMLA 1HH2P 2D7VA 1WF3A 4FTFA 2VQEC 4GKKC 1YJ7A 5AE1A 1LQLA 2E5LC 1M6XC 5BURA 4DR4C 4GS5A 2QW0X 4PUGA 2WP0C 4DV7C 1N34C 2DHMA 3OTOC 4BCAA 4X65C 4DR7C 4DV5C 4KTVA 1UWDA 3T1YC 4PROC 3G7SA 2V7BA 4FUQA 3PROC 4MH4A 1FUGA 4JI5C 2UU9C 1PU1A 5KEIA
chains in the Genus database with same CATH topology
1PU1A 3UEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU1 A;  3UEB A; 
#chains in the Genus database with same CATH topology
 3UEB A;  4K0K C;  4BSZ A;  3L8C A;  4R1L A;  4WS9 A;  1N33 C;  3O2E A;  5AE3 A;  1HNZ C;  2BJO A;  2VQF C;  4WV3 A;  3CW9 A;  4KHP C;  1XMQ C;  4JI7 C;  1PG4 A;  2CY1 A;  3B7W A;  5GTD A;  5FLX D;  2JMP A;  2P20 A;  4DCU A;  2P02 A;  1QM4 A;  3R9W A;  4EAT A;  1NY8 A;  1QWI A;  4L4Q A;  3UX2 A;  4LFA C;  4BC7 A;  2QL8 A;  1O9T A;  5LCI A;  4JM1 A;  1XMO C;  5LMU C;  4DR6 C;  3FCC A;  4BBY A;  2VSQ A;  3GKU A;  1USP A;  1V60 A;  3LNO A;  1HR0 C;  3T1H C;  4JI2 C;  4FUT A;  1FJG C;  5KYV A;  4LFB C;  1XRA A;  1VEH A;  2OPL A;  3PBK A;  5H9U A;  2XR1 A;  1P4E A;  4IZ6 A;  2ONF A;  4LE5 A;  1V26 A;  1K0R A;  5T8S A;  5BR8 C;  2MMA B;  2YWC A;  2QVY X;  3PES A;  2F4V C;  1I94 C;  3E7W A;  4ODJ A;  3TUF A;  1RY2 A;  2UXB C;  2OO4 A;  4RM2 A;  1M6X A;  1T5H X;  1UKK A;  3I07 A;  3A4I A;  2ATW A;  3TR3 A;  4JI1 C;  4IR7 A;  1RG9 A;  5A1G A;  3A26 A;  1P4E C;  4OX9 C;  3KXW A;  2QVX X;  3SO4 A;  2ZZN A;  5CZV A;  3LUS A;  1WH9 A;  3A25 A;  1N36 C;  1P7L A;  2KDN A;  3JAM D;  1O93 A;  1VLA A;  2DPL A;  3CJE A;  5E7Q A;  3E7X A;  1LCI A;  4DCS A;  4RVO A;  1GPM A;  5AE2 A;  3NPD A;  4ZJZ A;  1ML8 A;  2MM9 A;  4ZLP A;  4B3T C;  2D27 A;  4HPV A;  3A9V A;  4L7I A;  4X66 C;  1PA4 A;  2DYJ A;  4ISB A;  4RLF A;  1TH5 A;  4DR5 C;  4RLQ A;  4DCV A;  3NYQ A;  3N54 B;  4DR2 C;  4JI6 C;  4JI0 C;  4LF7 C;  2KZF A;  2D1Q A;  4XX2 A;  2WD9 A;  2HJG A;  4K0B A;  2MCQ A;  3LGX A;  2Y4N A;  3H2T A;  2UUB C;  4NOZ A;  3R9X A;  1XS3 A;  4DV4 C;  2M5H A;  4X64 C;  3CW8 X;  1IBK C;  4JI4 C;  2ZM6 C;  5ADZ A;  1ZB8 A;  1N2F A;  4NDN A;  4GXR A;  2UUA C;  1EGA A;  4B3S C;  5KYT A;  4JI3 C;  4DR3 C;  1BA3 A;  4PUI A;  1L2F A;  2PN2 A;  4R1M A;  3I08 A;  1IBL C;  2ASB A;  3C5E A;  1V25 A;  5T8T A;  4D4I A;  2P2J A;  4R0M A;  4JV5 C;  1MXB A;  4L2Z A;  3S82 A;  1IB8 A;  3DAY A;  4NXN C;  3A9U A;  2CU6 A;  4JYA C;  2QVZ X;  1IBM C;  1MDF A;  3K6R A;  4PUH A;  3UZ0 A;  4MTN A;  2P2M A;  3RG2 A;  4DV0 C;  1J5E C;  5BSU A;  2P2F A;  1WCJ A;  5BUQ A;  2D1S A;  1MKY A;  4DUY C;  3CQ1 A;  4B3M C;  2E8C A;  2JNV A;  4U5Y D;  2D1T A;  2Z51 A;  2EGT A;  1XNQ C;  5K85 A;  5IFI A;  4OXI A;  1MXC A;  3CQ2 A;  4DG8 A;  2P2Q A;  4YHH C;  4D4G A;  2E7G A;  2M5O A;  3FCE A;  2UXD C;  1ZB9 A;  2OBV A;  1HNW C;  3NYR A;  1PG3 A;  3ETO A;  2D1R A;  5LMN C;  4LF5 C;  1N32 C;  2E0G A;  1XRB A;  1XRC A;  1MD9 A;  1HNX C;  3TQI A;  1NYE A;  3R44 A;  4LF8 C;  3VNQ A;  2E8F A;  2BH1 X;  4B3R C;  3CQ3 A;  4RM3 A;  3GR1 A;  1XHJ A;  2Y27 A;  3LAX A;  2ZZM A;  4D57 A;  4DV3 C;  2UXC C;  3J81 D;  3GPC A;  4RMN A;  5BSR A;  3VNS A;  4G36 A;  4LF4 C;  3EER A;  4LF6 C;  4DV1 C;  3N2Q A;  2UUC C;  4LFC C;  2PT7 G;  3AF5 A;  3UOW A;  5BSW A;  5K8F A;  2YX1 A;  1T5D X;  1MXA A;  4PZP A;  2HHH C;  2PRO A;  1USP B;  2E8E A;  2YCB A;  5DV9 A;  3IEU A;  1O90 A;  5CZX A;  2OPL B;  3TDE A;  1MDB A;  4TPS B;  5BUS A;  4DV2 C;  2CXC A;  3AY0 A;  2NCL A;  5IT9 D;  4DV6 C;  1O92 A;  4G37 A;  3VNR A;  5A1I A;  3LNV A;  4JI8 C;  4AQY C;  1KKG A;  4DUZ C;  5BST A;  4DR1 C;  3DLP X;  2D28 C;  5IWA C;  5A19 A;  4D56 A;  3DHV A;  4PHT A;  2P2B A;  3NI2 A;  3RV2 A;  4DG9 A;  2YWB A;  3IEV A;  4YY3 C;  4OYC A;  4KTT A;  3EQ6 A;  5A2Q D;  2AYA A;  2KZ0 A;  4DCT A;  4RVN A;  3L95 X;  5JRH A;  5BSM A;  4NXM C;  1XNR C;  4G1I A;  4X62 C;  3AF6 A;  5BSV A;  4I9F A;  1AMU A;  4GKJ C;  2VZE A;  3GR0 A;  3J80 D;  4LF9 C;  3IPL A;  3UX3 A;  2Y4O A;  4BC9 A;  3ETC A;  4I9G A;  1FLO A;  1ULT A;  1JOS A;  4GXQ A;  3IML A;  1HH2 P;  2D7V A;  1WF3 A;  4FTF A;  2VQE C;  4GKK C;  1YJ7 A;  5AE1 A;  1LQL A;  2E5L C;  1M6X C;  5BUR A;  4DR4 C;  4GS5 A;  2QW0 X;  4PUG A;  2WP0 C;  4DV7 C;  1N34 C;  2DHM A;  3OTO C;  4BCA A;  4X65 C;  4DR7 C;  4DV5 C;  4KTV A;  1UWD A;  3T1Y C;  4PRO C;  3G7S A;  2V7B A;  4FUQ A;  3PRO C;  4MH4 A;  1FUG A;  4JI5 C;  2UU9 C;  1PU1 A;  5KEI A; 
#chains in the Genus database with same CATH homology
 1PU1 A;  3UEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...