3UEBA

Crystal structure of ton_0450 from thermococcus onnurineus na1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
102
Chain Sequence
GSSGKRVIHIGLPELSEEQLIEIGELAQETIIDYVFDHLTRSEVKDIEVTMRINREETLDLEIEVYLEVPIFVKVDVDKLIDEAVERAYEIVERKLREIANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Crystal structure of an Euryarchaeota-specific protein, TON_0450 from Thermococcus onnurineus NA1
rcsb
source organism Thermococcus onnurineus
total genus 32
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11419 DUF3194 Protein of unknown function (DUF3194)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.100 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 MTH677-like 3uebA00
1PU1A 3UEBA
chains in the Genus database with same CATH superfamily
5CZXA 1PA4A 2QVYX 2P02A 5ADZA 1N34C 4DV1C 3GR1A 1M6XC 1PU1A 2YWBA 3DAYA 5KEIA 5FLXD 1P4EC 4WV3A 1MKYA 4DUZC 3R9WA 4MH4A 4B3TC 4U5YD 3LUSA 5A1IA 2D1TA 1RY2A 3FCEA 5BURA 4BBYA 5BSUA 3I07A 4D57A 2E5LC 4GXQA 3LNOA 5E7QA 1VEHA 1QWIA 3CQ1A 3GR0A 2ONFA 3A4IA 2ATWA 3R9XA 4DR3C 4NXMC 4DG9A 5H9UA 5GTDA 1PG4A 3AY0A 2ZZMA 2CU6A 2DPLA 1N2FA 1ULTA 2E8FA 2P2JA 4RM3A 5A1GA 3AF6A 2UXBC 4JV5C 3A9VA 3G7SA 4DV3C 4PUGA 1IBLC 2JNVA 5BR8C 2E8CA 4JI3C 1IBMC 2PN2A 1VLAA 1HNXC 1T5DX 4DR7C 2QW0X 2PT7G 1IB8A 3RG2A 1O90A 1ZB9A 4HPVA 4DV4C 3NYQA 4BC9A 3IPLA 1XMQC 1WF3A 4BC7A 4BSZA 4OYCA 2VZEA 4FUQA 1YJ7A 4DUYC 4DV6C 4NXNC 2D28C 4B3RC 3J80D 1USPB 3B7WA 2OPLA 4K0BA 2MM9A 2OO4A 3CQ2A 4LFAC 3VNQA 1EGAA 5CZVA 5IFIA 1FUGA 3UZ0A 4PUIA 1O93A 4R0MA 3LAXA 5LMNC 1XS3A 1MXCA 3NYRA 4GKJC 2UUBC 4NDNA 4DR2C 4PROC 2Y4NA 4X66C 1I94C 1HNWC 3CQ3A 1HR0C 2E7GA 3KXWA 4RVOA 2CY1A 1GPMA 1JOSA 4ZLPA 3PBKA 2QVXX 1UWDA 2ASBA 1NY8A 2HJGA 4B3SC 1PG3A 4ISBA 4IR7A 2VSQA 1MXBA 1HH2P 1MXAA 1MDFA 4NOZA 1WH9A 2HHHC 1XRBA 4X64C 4LF8C 2CXCA 3UX2A 2Z51A 3IEVA 4JI1C 3UOWA 4DV0C 4AQYC 4RLQA 4DR1C 2M5OA 3VNSA 1RG9A 3I08A 3H2TA 4FUTA 1XRAA 3CJEA 2WP0C 3TDEA 2MCQA 1XHJA 1O92A 4L4QA 4DCVA 1XRCA 1ZB8A 5BUQA 2VQFC 4DG8A 5IT9D 1QM4A 5BSMA 3DHVA 4JI5C 1O9TA 4I9FA 4DCUA 4OX9C 4JI8C 1V60A 3K6RA 3A26A 2QVZX 2YCBA 2PROA 3GPCA 4DCTA 5BSVA 1FJGC 4R1LA 3PESA 3SO4A 4JI4C 4JI6C 3UEBA 3L8CA 1N36C 4JI2C 4ODJA 4GS5A 4G36A 3ETOA 4D4IA 3J81D 2Y27A 2UUCC 1IBKC 2DHMA 4G37A 4BCAA 3CW8X 3L95X 2E0GA 3DLPX 3UX3A 3T1HC 2D1QA 4PHTA 4TPSB 5BSTA 3TUFA 4PZPA 3ETCA 2BJOA 2P2MA 2Y4OA 5KYTA 4DR4C 3EQ6A 4X62C 3A9UA 2EGTA 3GKUA 1BA3A 2V7BA 1MD9A 1J5EC 1N33C 2AYAA 4JI0C 4RLFA 2F4VC 4LF9C 3LGXA 2XR1A 2YX1A 3RV2A 3E7WA 4KTVA 3CW9A 4DR6C 4LFBC 4JM1A 1XNRC 1AMUA 4EATA 5K85A 4G1IA 3O2EA 4D56A 2UXDC 2NCLA 5DV9A 5KYVA 4YY3C 1P7LA 1V25A 2UUAC 4LFCC 2DYJA 4JI7C 5A2QD 4LE5A 5BUSA 4D4GA 3NPDA 4DCSA 3VNRA 3A25A 4B3MC 4LF6C 3N54B 4LF5C 1XNQC 2KZ0A 4DV5C 5BSWA 1V26A 5A19A 5JRHA 5AE2A 5LMUC 2KZFA 4GKKC 4DR5C 4KTTA 2P20A 3EERA 4KHPC 3IEUA 1HNZC 2UXCC 4LF7C 3LNVA 4YHHC 4XX2A 4WS9A 2D1SA 1L2FA 2QL8A 3TR3A 5LCIA 3TQIA 1M6XA 2P2BA 4RVNA 2VQEC 2BH1X 4OXIA 2D27A 1N32C 1P4EA 5T8TA 3S82A 2YWCA 2D1RA 1FLOA 2P2FA 1UKKA 5AE1A 2ZZNA 3IMLA 1T5HX 3C5EA 1WCJA 1TH5A 4R1MA 5K8FA 5T8SA 3PROC 3T1YC 2JMPA 1K0RA 1LQLA 4JYAC 1XMOC 3AF5A 5AE3A 5BSRA 4ZJZA 2WD9A 4DV7C 1LCIA 4L7IA 2OPLB 2M5HA 3JAMD 4GXRA 2OBVA 2D7VA 2E8EA 4L2ZA 3FCCA 4I9GA 3N2QA 3OTOC 4MTNA 1ML8A 4DV2C 1USPA 4RMNA 2MMAB 3R44A 1KKGA 4K0KC 2UU9C 4IZ6A 4X65C 4FTFA 4PUHA 4LF4C 2ZM6C 2P2QA 4RM2A 1MDBA 5IWAC 3E7XA 3NI2A 1NYEA 2KDNA
chains in the Genus database with same CATH topology
1PU1A 3UEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU1 A;  3UEB A; 
#chains in the Genus database with same CATH topology
 5CZX A;  1PA4 A;  2QVY X;  2P02 A;  5ADZ A;  1N34 C;  4DV1 C;  3GR1 A;  1M6X C;  1PU1 A;  2YWB A;  3DAY A;  5KEI A;  5FLX D;  1P4E C;  4WV3 A;  1MKY A;  4DUZ C;  3R9W A;  4MH4 A;  4B3T C;  4U5Y D;  3LUS A;  5A1I A;  2D1T A;  1RY2 A;  3FCE A;  5BUR A;  4BBY A;  5BSU A;  3I07 A;  4D57 A;  2E5L C;  4GXQ A;  3LNO A;  5E7Q A;  1VEH A;  1QWI A;  3CQ1 A;  3GR0 A;  2ONF A;  3A4I A;  2ATW A;  3R9X A;  4DR3 C;  4NXM C;  4DG9 A;  5H9U A;  5GTD A;  1PG4 A;  3AY0 A;  2ZZM A;  2CU6 A;  2DPL A;  1N2F A;  1ULT A;  2E8F A;  2P2J A;  4RM3 A;  5A1G A;  3AF6 A;  2UXB C;  4JV5 C;  3A9V A;  3G7S A;  4DV3 C;  4PUG A;  1IBL C;  2JNV A;  5BR8 C;  2E8C A;  4JI3 C;  1IBM C;  2PN2 A;  1VLA A;  1HNX C;  1T5D X;  4DR7 C;  2QW0 X;  2PT7 G;  1IB8 A;  3RG2 A;  1O90 A;  1ZB9 A;  4HPV A;  4DV4 C;  3NYQ A;  4BC9 A;  3IPL A;  1XMQ C;  1WF3 A;  4BC7 A;  4BSZ A;  4OYC A;  2VZE A;  4FUQ A;  1YJ7 A;  4DUY C;  4DV6 C;  4NXN C;  2D28 C;  4B3R C;  3J80 D;  1USP B;  3B7W A;  2OPL A;  4K0B A;  2MM9 A;  2OO4 A;  3CQ2 A;  4LFA C;  3VNQ A;  1EGA A;  5CZV A;  5IFI A;  1FUG A;  3UZ0 A;  4PUI A;  1O93 A;  4R0M A;  3LAX A;  5LMN C;  1XS3 A;  1MXC A;  3NYR A;  4GKJ C;  2UUB C;  4NDN A;  4DR2 C;  4PRO C;  2Y4N A;  4X66 C;  1I94 C;  1HNW C;  3CQ3 A;  1HR0 C;  2E7G A;  3KXW A;  4RVO A;  2CY1 A;  1GPM A;  1JOS A;  4ZLP A;  3PBK A;  2QVX X;  1UWD A;  2ASB A;  1NY8 A;  2HJG A;  4B3S C;  1PG3 A;  4ISB A;  4IR7 A;  2VSQ A;  1MXB A;  1HH2 P;  1MXA A;  1MDF A;  4NOZ A;  1WH9 A;  2HHH C;  1XRB A;  4X64 C;  4LF8 C;  2CXC A;  3UX2 A;  2Z51 A;  3IEV A;  4JI1 C;  3UOW A;  4DV0 C;  4AQY C;  4RLQ A;  4DR1 C;  2M5O A;  3VNS A;  1RG9 A;  3I08 A;  3H2T A;  4FUT A;  1XRA A;  3CJE A;  2WP0 C;  3TDE A;  2MCQ A;  1XHJ A;  1O92 A;  4L4Q A;  4DCV A;  1XRC A;  1ZB8 A;  5BUQ A;  2VQF C;  4DG8 A;  5IT9 D;  1QM4 A;  5BSM A;  3DHV A;  4JI5 C;  1O9T A;  4I9F A;  4DCU A;  4OX9 C;  4JI8 C;  1V60 A;  3K6R A;  3A26 A;  2QVZ X;  2YCB A;  2PRO A;  3GPC A;  4DCT A;  5BSV A;  1FJG C;  4R1L A;  3PES A;  3SO4 A;  4JI4 C;  4JI6 C;  3UEB A;  3L8C A;  1N36 C;  4JI2 C;  4ODJ A;  4GS5 A;  4G36 A;  3ETO A;  4D4I A;  3J81 D;  2Y27 A;  2UUC C;  1IBK C;  2DHM A;  4G37 A;  4BCA A;  3CW8 X;  3L95 X;  2E0G A;  3DLP X;  3UX3 A;  3T1H C;  2D1Q A;  4PHT A;  4TPS B;  5BST A;  3TUF A;  4PZP A;  3ETC A;  2BJO A;  2P2M A;  2Y4O A;  5KYT A;  4DR4 C;  3EQ6 A;  4X62 C;  3A9U A;  2EGT A;  3GKU A;  1BA3 A;  2V7B A;  1MD9 A;  1J5E C;  1N33 C;  2AYA A;  4JI0 C;  4RLF A;  2F4V C;  4LF9 C;  3LGX A;  2XR1 A;  2YX1 A;  3RV2 A;  3E7W A;  4KTV A;  3CW9 A;  4DR6 C;  4LFB C;  4JM1 A;  1XNR C;  1AMU A;  4EAT A;  5K85 A;  4G1I A;  3O2E A;  4D56 A;  2UXD C;  2NCL A;  5DV9 A;  5KYV A;  4YY3 C;  1P7L A;  1V25 A;  2UUA C;  4LFC C;  2DYJ A;  4JI7 C;  5A2Q D;  4LE5 A;  5BUS A;  4D4G A;  3NPD A;  4DCS A;  3VNR A;  3A25 A;  4B3M C;  4LF6 C;  3N54 B;  4LF5 C;  1XNQ C;  2KZ0 A;  4DV5 C;  5BSW A;  1V26 A;  5A19 A;  5JRH A;  5AE2 A;  5LMU C;  2KZF A;  4GKK C;  4DR5 C;  4KTT A;  2P20 A;  3EER A;  4KHP C;  3IEU A;  1HNZ C;  2UXC C;  4LF7 C;  3LNV A;  4YHH C;  4XX2 A;  4WS9 A;  2D1S A;  1L2F A;  2QL8 A;  3TR3 A;  5LCI A;  3TQI A;  1M6X A;  2P2B A;  4RVN A;  2VQE C;  2BH1 X;  4OXI A;  2D27 A;  1N32 C;  1P4E A;  5T8T A;  3S82 A;  2YWC A;  2D1R A;  1FLO A;  2P2F A;  1UKK A;  5AE1 A;  2ZZN A;  3IML A;  1T5H X;  3C5E A;  1WCJ A;  1TH5 A;  4R1M A;  5K8F A;  5T8S A;  3PRO C;  3T1Y C;  2JMP A;  1K0R A;  1LQL A;  4JYA C;  1XMO C;  3AF5 A;  5AE3 A;  5BSR A;  4ZJZ A;  2WD9 A;  4DV7 C;  1LCI A;  4L7I A;  2OPL B;  2M5H A;  3JAM D;  4GXR A;  2OBV A;  2D7V A;  2E8E A;  4L2Z A;  3FCC A;  4I9G A;  3N2Q A;  3OTO C;  4MTN A;  1ML8 A;  4DV2 C;  1USP A;  4RMN A;  2MMA B;  3R44 A;  1KKG A;  4K0K C;  2UU9 C;  4IZ6 A;  4X65 C;  4FTF A;  4PUH A;  4LF4 C;  2ZM6 C;  2P2Q A;  4RM2 A;  1MDB A;  5IWA C;  3E7X A;  3NI2 A;  1NYE A;  2KDN A; 
#chains in the Genus database with same CATH homology
 1PU1 A;  3UEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...