3UEBA

Crystal structure of ton_0450 from thermococcus onnurineus na1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
102
structure length
102
Chain Sequence
b'GSSGKRVIHIGLPELSEEQLIEIGELAQETIIDYVFDHLTRSEVKDIEVTMRINREETLDLEIEVYLEVPIFVKVDVDKLIDEAVERAYEIVERKLREIANE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of an Euryarchaeota-specific protein, TON_0450 from Thermococcus onnurineus NA1
rcsb
source organism Thermococcus onnurineus
molecule tags Unknown function
total genus 32
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11419 DUF3194 Protein of unknown function (DUF3194)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.100 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 MTH677-like 3uebA00
3UEBA 1PU1A
chains in the Genus database with same CATH superfamily
4KTVA 4ZLPA 1I94C 3LNOA 4X65C 4IR7A 5IT9D 1V26A 1VLAA 2WP0C 5BUSA 2PT7G 1ZB8A 5LCIA 4RLFA 4DV2C 1HR0C 2MCQA 1WH9A 4OYCA 4FUTA 1ULTA 4I9FA 3NYRA 1O92A 2OBVA 5T8SA 4GKJC 4DR2C 2YWCA 2HHHC 2UUAC 4MTNA 3CW8X 1MDBA 3TQIA 1XRCA 3CW9A 2XR1A 3CQ3A 5K8FA 1K0RA 2Y27A 4DV0C 4BC9A 1XNQC 5CZVA 1J5EC 4NXMC 2OPLA 1HH2P 5IWAC 3PESA 4LF4C 5GTDA 1XNRC 4XX2A 4RVNA 1IB8A 3UEBA 1UWDA 1XRAA 3IMLA 4DUZC 2D1SA 1JOSA 1XHJA 2JMPA 2M5HA 2QW0X 1IBLC 1LCIA 2Z51A 2VQFC 2D1QA 3DLPX 4B3MC 1WCJA 1P4EC 1ZB9A 2D1RA 2V7BA 4EATA 4ISBA 3ETOA 2ONFA 3NYQA 4JI4C 4D57A 2DHMA 4JI5C 3LAXA 4DCVA 3VNQA 4TPSB 5DV9A 4DCTA 4ODJA 2P2BA 1V25A 4L2ZA 3UOWA 4DG9A 2E0GA 4DR4C 4PUGA 2E8CA 2P2QA 4K0BA 2ATWA 4JI2C 5IFIA 3VNSA 2CU6A 2DYJA 2MMAB 3TDEA 1IBMC 3G7SA 2UUCC 2M5OA 2YCBA 4NDNA 4B3SC 5KYVA 4YHHC 1FUGA 1USPA 4X64C 5CZXA 3B7WA 4RLQA 4DCUA 5FLXD 3UZ0A 4PROC 3R44A 4PUHA 2E8FA 1MD9A 3CJEA 3EERA 4LFCC 5BSRA 4DR7C 5BSMA 2ZZNA 5BSVA 4JI3C 4GXQA 2UUBC 1BA3A 3N54B 2UXDC 3IEUA 4R1MA 4DV7C 4WS9A 4ZJZA 2Y4NA 1LQLA 4G36A 1V60A 1T5DX 4JYAC 3NPDA 2P2FA 4L4QA 4JI7C 3IPLA 1O93A 2ZZMA 2NCLA 1HNXC 1GPMA 4NOZA 5BSTA 3AF6A 3UX3A 1MXAA 5BURA 1N32C 3J81D 3TR3A 1PG4A 5BSUA 5JRHA 4DR6C 3ETCA 3RV2A 4JI1C 3E7WA 1M6XC 1L2FA 3PBKA 4DR3C 4LF7C 1N33C 3GPCA 4X62C 4LF5C 1WF3A 4MH4A 1HNWC 1YJ7A 1N2FA 3DAYA 2EGTA 2P20A 5K85A 5BSWA 3J80D 3AF5A 4JI0C 1T5HX 2DPLA 5LMNC 5H9UA 2KZ0A 3A9UA 5AE1A 3IEVA 2D27A 3R9XA 4BSZA 4B3RC 5A2QD 4DR5C 4K0KC 2PROA 4FUQA 1XMOC 3NI2A 2E8EA 4D4GA 5A19A 3PROC 4DV4C 3K6RA 5ADZA 5BUQA 2WD9A 5LMUC 3OTOC 3A26A 3R9WA 4KHPC 1UKKA 2KZFA 2YX1A 4JM1A 5A1GA 4LFAC 2ASBA 4D4IA 1RG9A 1IBKC 2JNVA 4DR1C 2BH1X 2D28C 2E7GA 1MXBA 5E7QA 4PHTA 4KTTA 4R1LA 4YY3C 4BC7A 4GS5A 4BBYA 4JI6C 4B3TC 4DG8A 3GR0A 1RY2A 1QWIA 1PG3A 2D7VA 3GR1A 2QVYX 1O9TA 1MKYA 3FCEA 4R0MA 2P2JA 4PUIA 2P2MA 5AE2A 5T8TA 2UU9C 3LUSA 2OO4A 4RM2A 4LF9C 1EGAA 2D1TA 1KKGA 2VZEA 4DV5C 4WV3A 3T1YC 3GKUA 4DV1C 2AYAA 3AY0A 4IZ6A 4JV5C 3A9VA 1AMUA 1P7LA 1P4EA 3T1HC 3KXWA 1MDFA 3CQ2A 1XRBA 4RM3A 2VSQA 3TUFA 3RG2A 5A1IA 2KDNA 4DCSA 4DV3C 3SO4A 2HJGA 2OPLB 2Y4OA 2VQEC 5AE3A 5KYTA 1QM4A 4JI8C 5BR8C 4RVOA 1N34C 3DHVA 4FTFA 2MM9A 3EQ6A 2E5LC 4DV6C 1N36C 4NXNC 1NYEA 2QVXX 4I9GA 4GXRA 2QL8A 3JAMD 1FJGC 3A4IA 1TH5A 4BCAA 4D56A 4RMNA 4AQYC 1PU1A 3N2QA 4HPVA 2ZM6C 3UX2A 4LF6C 3E7XA 1MXCA 2CY1A 4X66C 4OX9C 4LFBC 4L7IA 1VEHA 4LF8C 4DUYC 3C5EA 4OXIA 2F4VC 3VNRA 2P02A 1ML8A 3L95X 2QVZX 3LGXA 4G1IA 2YWBA 3H2TA 3I08A 3L8CA 4PZPA 3A25A 3CQ1A 1PA4A 3O2EA 3I07A 1USPB 1HNZC 4G37A 2UXCC 1XS3A 5KEIA 2UXBC 2CXCA 1NY8A 2BJOA 3S82A 4U5YD 1O90A 1FLOA 3FCCA 4GKKC 3LNVA 1XMQC 4LE5A 1M6XA 2PN2A
chains in the Genus database with same CATH topology
3UEBA 1PU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEB A;  1PU1 A; 
#chains in the Genus database with same CATH topology
 4KTV A;  4ZLP A;  1I94 C;  3LNO A;  4X65 C;  4IR7 A;  5IT9 D;  1V26 A;  1VLA A;  2WP0 C;  5BUS A;  2PT7 G;  1ZB8 A;  5LCI A;  4RLF A;  4DV2 C;  1HR0 C;  2MCQ A;  1WH9 A;  4OYC A;  4FUT A;  1ULT A;  4I9F A;  3NYR A;  1O92 A;  2OBV A;  5T8S A;  4GKJ C;  4DR2 C;  2YWC A;  2HHH C;  2UUA C;  4MTN A;  3CW8 X;  1MDB A;  3TQI A;  1XRC A;  3CW9 A;  2XR1 A;  3CQ3 A;  5K8F A;  1K0R A;  2Y27 A;  4DV0 C;  4BC9 A;  1XNQ C;  5CZV A;  1J5E C;  4NXM C;  2OPL A;  1HH2 P;  5IWA C;  3PES A;  4LF4 C;  5GTD A;  1XNR C;  4XX2 A;  4RVN A;  1IB8 A;  3UEB A;  1UWD A;  1XRA A;  3IML A;  4DUZ C;  2D1S A;  1JOS A;  1XHJ A;  2JMP A;  2M5H A;  2QW0 X;  1IBL C;  1LCI A;  2Z51 A;  2VQF C;  2D1Q A;  3DLP X;  4B3M C;  1WCJ A;  1P4E C;  1ZB9 A;  2D1R A;  2V7B A;  4EAT A;  4ISB A;  3ETO A;  2ONF A;  3NYQ A;  4JI4 C;  4D57 A;  2DHM A;  4JI5 C;  3LAX A;  4DCV A;  3VNQ A;  4TPS B;  5DV9 A;  4DCT A;  4ODJ A;  2P2B A;  1V25 A;  4L2Z A;  3UOW A;  4DG9 A;  2E0G A;  4DR4 C;  4PUG A;  2E8C A;  2P2Q A;  4K0B A;  2ATW A;  4JI2 C;  5IFI A;  3VNS A;  2CU6 A;  2DYJ A;  2MMA B;  3TDE A;  1IBM C;  3G7S A;  2UUC C;  2M5O A;  2YCB A;  4NDN A;  4B3S C;  5KYV A;  4YHH C;  1FUG A;  1USP A;  4X64 C;  5CZX A;  3B7W A;  4RLQ A;  4DCU A;  5FLX D;  3UZ0 A;  4PRO C;  3R44 A;  4PUH A;  2E8F A;  1MD9 A;  3CJE A;  3EER A;  4LFC C;  5BSR A;  4DR7 C;  5BSM A;  2ZZN A;  5BSV A;  4JI3 C;  4GXQ A;  2UUB C;  1BA3 A;  3N54 B;  2UXD C;  3IEU A;  4R1M A;  4DV7 C;  4WS9 A;  4ZJZ A;  2Y4N A;  1LQL A;  4G36 A;  1V60 A;  1T5D X;  4JYA C;  3NPD A;  2P2F A;  4L4Q A;  4JI7 C;  3IPL A;  1O93 A;  2ZZM A;  2NCL A;  1HNX C;  1GPM A;  4NOZ A;  5BST A;  3AF6 A;  3UX3 A;  1MXA A;  5BUR A;  1N32 C;  3J81 D;  3TR3 A;  1PG4 A;  5BSU A;  5JRH A;  4DR6 C;  3ETC A;  3RV2 A;  4JI1 C;  3E7W A;  1M6X C;  1L2F A;  3PBK A;  4DR3 C;  4LF7 C;  1N33 C;  3GPC A;  4X62 C;  4LF5 C;  1WF3 A;  4MH4 A;  1HNW C;  1YJ7 A;  1N2F A;  3DAY A;  2EGT A;  2P20 A;  5K85 A;  5BSW A;  3J80 D;  3AF5 A;  4JI0 C;  1T5H X;  2DPL A;  5LMN C;  5H9U A;  2KZ0 A;  3A9U A;  5AE1 A;  3IEV A;  2D27 A;  3R9X A;  4BSZ A;  4B3R C;  5A2Q D;  4DR5 C;  4K0K C;  2PRO A;  4FUQ A;  1XMO C;  3NI2 A;  2E8E A;  4D4G A;  5A19 A;  3PRO C;  4DV4 C;  3K6R A;  5ADZ A;  5BUQ A;  2WD9 A;  5LMU C;  3OTO C;  3A26 A;  3R9W A;  4KHP C;  1UKK A;  2KZF A;  2YX1 A;  4JM1 A;  5A1G A;  4LFA C;  2ASB A;  4D4I A;  1RG9 A;  1IBK C;  2JNV A;  4DR1 C;  2BH1 X;  2D28 C;  2E7G A;  1MXB A;  5E7Q A;  4PHT A;  4KTT A;  4R1L A;  4YY3 C;  4BC7 A;  4GS5 A;  4BBY A;  4JI6 C;  4B3T C;  4DG8 A;  3GR0 A;  1RY2 A;  1QWI A;  1PG3 A;  2D7V A;  3GR1 A;  2QVY X;  1O9T A;  1MKY A;  3FCE A;  4R0M A;  2P2J A;  4PUI A;  2P2M A;  5AE2 A;  5T8T A;  2UU9 C;  3LUS A;  2OO4 A;  4RM2 A;  4LF9 C;  1EGA A;  2D1T A;  1KKG A;  2VZE A;  4DV5 C;  4WV3 A;  3T1Y C;  3GKU A;  4DV1 C;  2AYA A;  3AY0 A;  4IZ6 A;  4JV5 C;  3A9V A;  1AMU A;  1P7L A;  1P4E A;  3T1H C;  3KXW A;  1MDF A;  3CQ2 A;  1XRB A;  4RM3 A;  2VSQ A;  3TUF A;  3RG2 A;  5A1I A;  2KDN A;  4DCS A;  4DV3 C;  3SO4 A;  2HJG A;  2OPL B;  2Y4O A;  2VQE C;  5AE3 A;  5KYT A;  1QM4 A;  4JI8 C;  5BR8 C;  4RVO A;  1N34 C;  3DHV A;  4FTF A;  2MM9 A;  3EQ6 A;  2E5L C;  4DV6 C;  1N36 C;  4NXN C;  1NYE A;  2QVX X;  4I9G A;  4GXR A;  2QL8 A;  3JAM D;  1FJG C;  3A4I A;  1TH5 A;  4BCA A;  4D56 A;  4RMN A;  4AQY C;  1PU1 A;  3N2Q A;  4HPV A;  2ZM6 C;  3UX2 A;  4LF6 C;  3E7X A;  1MXC A;  2CY1 A;  4X66 C;  4OX9 C;  4LFB C;  4L7I A;  1VEH A;  4LF8 C;  4DUY C;  3C5E A;  4OXI A;  2F4V C;  3VNR A;  2P02 A;  1ML8 A;  3L95 X;  2QVZ X;  3LGX A;  4G1I A;  2YWB A;  3H2T A;  3I08 A;  3L8C A;  4PZP A;  3A25 A;  3CQ1 A;  1PA4 A;  3O2E A;  3I07 A;  1USP B;  1HNZ C;  4G37 A;  2UXC C;  1XS3 A;  5KEI A;  2UXB C;  2CXC A;  1NY8 A;  2BJO A;  3S82 A;  4U5Y D;  1O90 A;  1FLO A;  3FCC A;  4GKK C;  3LNV A;  1XMQ C;  4LE5 A;  1M6X A;  2PN2 A; 
#chains in the Genus database with same CATH homology
 3UEB A;  1PU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...