3O2EA

Crystal structure of a bol-like protein from babesia bovis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
PGSMVSKSIVEERLRSMLSPQFLKVTDNSGGCGAAFNAYIVSQQFEGKGLLDRQRLVNSAIAAEMPQIHAFTMKCLTPGEWEAKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BolA-like protein
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
source organism Babesia bovis
molecule tags Unknown function
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 3o2eA00
1V60A 4PUHA 2KDNA 2KZ0A 2MCQA 3TR3A 2DHMA 1NY8A 2MM9A 2MMAB 1XS3A 3O2EA 2NCLA 4PUGA 5LCIA 4PUIA
chains in the Genus database with same CATH superfamily
2DHMA 2QVXX 5KYVA 2UUAC 2YWBA 3DHVA 4RLQA 3S82A 4B3RC 1MKYA 3UEBA 2JNVA 5CZVA 1N33C 2CY1A 4FUQA 1T5HX 4DV5C 1L2FA 2BJOA 3I08A 1N36C 2V7BA 2CU6A 4JI8C 2DYJA 4DR6C 2E8EA 1PA4A 1XRCA 4WS9A 4PUGA 4MTNA 4OYCA 2M5HA 2OO4A 4I9FA 4DV3C 1NYEA 1XNRC 4DV0C 4LF6C 4GXRA 1QWIA 5IT9D 1FLOA 2ONFA 3I07A 1XNQC 4BC9A 4DV4C 2OPLB 3FCCA 1XS3A 3T1YC 2F4VC 4L2ZA 2OPLA 1J5EC 2VQEC 4U5YD 3GPCA 2QVZX 4MH4A 1XRBA 3TDEA 4DCSA 4OXIA 2P2JA 1AMUA 2M5OA 3AF5A 5BSRA 2YWCA 4X65C 1USPB 1N2FA 4KTTA 4D56A 4KTVA 1RY2A 3IEVA 1MDBA 4JI0C 1HH2P 3PBKA 3LUSA 3AF6A 2D1RA 2D27A 5K85A 4X64C 4NXNC 1HR0C 2D28C 4X62C 3CQ1A 4LF5C 2E0GA 4BCAA 4RVOA 2WD9A 2Y4NA 3EERA 1O92A 3VNRA 4WV3A 1P7LA 1O93A 4BBYA 2UXBC 1KKGA 3K6RA 1MD9A 4BSZA 2OBVA 3VNQA 2P2BA 3PESA 4L7IA 2ATWA 5A19A 3LNOA 5LMUC 4R0MA 3CJEA 2VQFC 3GR0A 2E5LC 3L95X 1BA3A 3C5EA 1ZB8A 5GTDA 4JI4C 3NPDA 4ODJA 4DR4C 1TH5A 3CW9A 1WCJA 5BSWA 4OX9C 4DCVA 4DG8A 1HNXC 2Y4OA 5CZXA 4IR7A 3A25A 2VSQA 2DPLA 2WP0C 1XMQC 2P20A 3LNVA 3R44A 2MCQA 1NY8A 3E7XA 4DV6C 5BSMA 4JI6C 2YCBA 3IMLA 1M6XC 4DR5C 2HHHC 3UZ0A 4JV5C 1WH9A 2D1QA 2E7GA 1WF3A 4I9GA 5LCIA 1LCIA 3N2QA 2Y27A 1JOSA 4RM2A 3DAYA 3E7WA 4IZ6A 4LF7C 1HNZC 1M6XA 4JYAC 2PROA 4JM1A 4JI3C 2VZEA 5BURA 4DV7C 2CXCA 2MMAB 3LAXA 4AQYC 4DR1C 2P2MA 2D1TA 4GKKC 1MXAA 4PUHA 3L8CA 2KZ0A 3ETOA 3TQIA 4R1LA 1ZB9A 4RVNA 4DV2C 3TR3A 3RV2A 1IBLC 4DR7C 4DCTA 3FCEA 2YX1A 4L4QA 5JRHA 5LMNC 5IFIA 4GKJC 1IB8A 5H9UA 2UXDC 4LF8C 2ZM6C 1HNWC 5BSTA 5T8TA 1VEHA 3UX3A 1USPA 4ISBA 4LF9C 5AE1A 2QVYX 5BUQA 3DLPX 2ZZMA 4TPSB 3R9WA 3LGXA 4LFCC 3A9VA 2UU9C 2ASBA 5KYTA 3N54B 4JI7C 4DV1C 1RG9A 2P02A 1XHJA 2E8CA 2P2FA 2HJGA 3PROC 5K8FA 1FUGA 1FJGC 2BH1X 3VNSA 4KHPC 4LE5A 5AE2A 4DR2C 2QL8A 1MXBA 4X66C 4D4GA 5A1IA 1O9TA 1XRAA 4RM3A 4R1MA 3B7WA 2NCLA 4XX2A 4BC7A 2UXCC 4DCUA 1PG3A 1T5DX 3KXWA 5T8SA 5IWAC 2KDNA 3CQ3A 3J80D 1UWDA 1P4EC 3NYQA 4DUZC 2P2QA 2XR1A 4JI5C 1QM4A 4LFAC 4FUTA 2KZFA 1PU1A 1IBMC 3T1HC 4LF4C 2EGTA 4EATA 4YY3C 3GR1A 4PROC 4K0KC 4DUYC 1EGAA 3OTOC 4ZLPA 5FLXD 5AE3A 4K0BA 4PUIA 4B3TC 4GS5A 4NDNA 1ULTA 3TUFA 3H2TA 1I94C 4B3MC 1O90A 3CQ2A 3O2EA 4D4IA 5A1GA 2QW0X 4YHHC 2ZZNA 4GXQA 2D7VA 2D1SA 4G37A 3UX2A 3A26A 4JI2C 1MDFA 4G1IA 3R9XA 4NOZA 4HPVA 3NI2A 1MXCA 4RLFA 5DV9A 4LFBC 4PZPA 4DG9A 3RG2A 1K0RA 3NYRA 3JAMD 3IPLA 3G7SA 4G36A 5BUSA 1XMOC 1IBKC 1UKKA 1V60A 4D57A 5BR8C 5KEIA 4JI1C 4NXMC 2PN2A 4ZJZA 5BSVA 3AY0A 3SO4A 1LQLA 3A9UA 2UUCC 2Z51A 2PT7G 1GPMA 3ETCA 3J81D 5BSUA 5A2QD 2E8FA 5E7QA 1V26A 2AYAA 4FTFA 2UUBC 1YJ7A 2JMPA 4DR3C 1VLAA 3A4IA 3UOWA 4B3SC 1N32C 1ML8A 1V25A 3CW8X 4PHTA 4RMNA 1N34C 3GKUA 3EQ6A 2MM9A 5ADZA 1P4EA 3IEUA 1PG4A
chains in the Genus database with same CATH topology
1V60A 4PUHA 2KDNA 2KZ0A 2MCQA 3TR3A 2DHMA 1NY8A 2MM9A 2MMAB 1XS3A 3O2EA 2NCLA 4PUGA 5LCIA 4PUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V60 A;  4PUH A;  2KDN A;  2KZ0 A;  2MCQ A;  3TR3 A;  2DHM A;  1NY8 A;  2MM9 A;  2MMA B;  1XS3 A;  3O2E A;  2NCL A;  4PUG A;  5LCI A;  4PUI A; 
#chains in the Genus database with same CATH topology
 2DHM A;  2QVX X;  5KYV A;  2UUA C;  2YWB A;  3DHV A;  4RLQ A;  3S82 A;  4B3R C;  1MKY A;  3UEB A;  2JNV A;  5CZV A;  1N33 C;  2CY1 A;  4FUQ A;  1T5H X;  4DV5 C;  1L2F A;  2BJO A;  3I08 A;  1N36 C;  2V7B A;  2CU6 A;  4JI8 C;  2DYJ A;  4DR6 C;  2E8E A;  1PA4 A;  1XRC A;  4WS9 A;  4PUG A;  4MTN A;  4OYC A;  2M5H A;  2OO4 A;  4I9F A;  4DV3 C;  1NYE A;  1XNR C;  4DV0 C;  4LF6 C;  4GXR A;  1QWI A;  5IT9 D;  1FLO A;  2ONF A;  3I07 A;  1XNQ C;  4BC9 A;  4DV4 C;  2OPL B;  3FCC A;  1XS3 A;  3T1Y C;  2F4V C;  4L2Z A;  2OPL A;  1J5E C;  2VQE C;  4U5Y D;  3GPC A;  2QVZ X;  4MH4 A;  1XRB A;  3TDE A;  4DCS A;  4OXI A;  2P2J A;  1AMU A;  2M5O A;  3AF5 A;  5BSR A;  2YWC A;  4X65 C;  1USP B;  1N2F A;  4KTT A;  4D56 A;  4KTV A;  1RY2 A;  3IEV A;  1MDB A;  4JI0 C;  1HH2 P;  3PBK A;  3LUS A;  3AF6 A;  2D1R A;  2D27 A;  5K85 A;  4X64 C;  4NXN C;  1HR0 C;  2D28 C;  4X62 C;  3CQ1 A;  4LF5 C;  2E0G A;  4BCA A;  4RVO A;  2WD9 A;  2Y4N A;  3EER A;  1O92 A;  3VNR A;  4WV3 A;  1P7L A;  1O93 A;  4BBY A;  2UXB C;  1KKG A;  3K6R A;  1MD9 A;  4BSZ A;  2OBV A;  3VNQ A;  2P2B A;  3PES A;  4L7I A;  2ATW A;  5A19 A;  3LNO A;  5LMU C;  4R0M A;  3CJE A;  2VQF C;  3GR0 A;  2E5L C;  3L95 X;  1BA3 A;  3C5E A;  1ZB8 A;  5GTD A;  4JI4 C;  3NPD A;  4ODJ A;  4DR4 C;  1TH5 A;  3CW9 A;  1WCJ A;  5BSW A;  4OX9 C;  4DCV A;  4DG8 A;  1HNX C;  2Y4O A;  5CZX A;  4IR7 A;  3A25 A;  2VSQ A;  2DPL A;  2WP0 C;  1XMQ C;  2P20 A;  3LNV A;  3R44 A;  2MCQ A;  1NY8 A;  3E7X A;  4DV6 C;  5BSM A;  4JI6 C;  2YCB A;  3IML A;  1M6X C;  4DR5 C;  2HHH C;  3UZ0 A;  4JV5 C;  1WH9 A;  2D1Q A;  2E7G A;  1WF3 A;  4I9G A;  5LCI A;  1LCI A;  3N2Q A;  2Y27 A;  1JOS A;  4RM2 A;  3DAY A;  3E7W A;  4IZ6 A;  4LF7 C;  1HNZ C;  1M6X A;  4JYA C;  2PRO A;  4JM1 A;  4JI3 C;  2VZE A;  5BUR A;  4DV7 C;  2CXC A;  2MMA B;  3LAX A;  4AQY C;  4DR1 C;  2P2M A;  2D1T A;  4GKK C;  1MXA A;  4PUH A;  3L8C A;  2KZ0 A;  3ETO A;  3TQI A;  4R1L A;  1ZB9 A;  4RVN A;  4DV2 C;  3TR3 A;  3RV2 A;  1IBL C;  4DR7 C;  4DCT A;  3FCE A;  2YX1 A;  4L4Q A;  5JRH A;  5LMN C;  5IFI A;  4GKJ C;  1IB8 A;  5H9U A;  2UXD C;  4LF8 C;  2ZM6 C;  1HNW C;  5BST A;  5T8T A;  1VEH A;  3UX3 A;  1USP A;  4ISB A;  4LF9 C;  5AE1 A;  2QVY X;  5BUQ A;  3DLP X;  2ZZM A;  4TPS B;  3R9W A;  3LGX A;  4LFC C;  3A9V A;  2UU9 C;  2ASB A;  5KYT A;  3N54 B;  4JI7 C;  4DV1 C;  1RG9 A;  2P02 A;  1XHJ A;  2E8C A;  2P2F A;  2HJG A;  3PRO C;  5K8F A;  1FUG A;  1FJG C;  2BH1 X;  3VNS A;  4KHP C;  4LE5 A;  5AE2 A;  4DR2 C;  2QL8 A;  1MXB A;  4X66 C;  4D4G A;  5A1I A;  1O9T A;  1XRA A;  4RM3 A;  4R1M A;  3B7W A;  2NCL A;  4XX2 A;  4BC7 A;  2UXC C;  4DCU A;  1PG3 A;  1T5D X;  3KXW A;  5T8S A;  5IWA C;  2KDN A;  3CQ3 A;  3J80 D;  1UWD A;  1P4E C;  3NYQ A;  4DUZ C;  2P2Q A;  2XR1 A;  4JI5 C;  1QM4 A;  4LFA C;  4FUT A;  2KZF A;  1PU1 A;  1IBM C;  3T1H C;  4LF4 C;  2EGT A;  4EAT A;  4YY3 C;  3GR1 A;  4PRO C;  4K0K C;  4DUY C;  1EGA A;  3OTO C;  4ZLP A;  5FLX D;  5AE3 A;  4K0B A;  4PUI A;  4B3T C;  4GS5 A;  4NDN A;  1ULT A;  3TUF A;  3H2T A;  1I94 C;  4B3M C;  1O90 A;  3CQ2 A;  3O2E A;  4D4I A;  5A1G A;  2QW0 X;  4YHH C;  2ZZN A;  4GXQ A;  2D7V A;  2D1S A;  4G37 A;  3UX2 A;  3A26 A;  4JI2 C;  1MDF A;  4G1I A;  3R9X A;  4NOZ A;  4HPV A;  3NI2 A;  1MXC A;  4RLF A;  5DV9 A;  4LFB C;  4PZP A;  4DG9 A;  3RG2 A;  1K0R A;  3NYR A;  3JAM D;  3IPL A;  3G7S A;  4G36 A;  5BUS A;  1XMO C;  1IBK C;  1UKK A;  1V60 A;  4D57 A;  5BR8 C;  5KEI A;  4JI1 C;  4NXM C;  2PN2 A;  4ZJZ A;  5BSV A;  3AY0 A;  3SO4 A;  1LQL A;  3A9U A;  2UUC C;  2Z51 A;  2PT7 G;  1GPM A;  3ETC A;  3J81 D;  5BSU A;  5A2Q D;  2E8F A;  5E7Q A;  1V26 A;  2AYA A;  4FTF A;  2UUB C;  1YJ7 A;  2JMP A;  4DR3 C;  1VLA A;  3A4I A;  3UOW A;  4B3S C;  1N32 C;  1ML8 A;  1V25 A;  3CW8 X;  4PHT A;  4RMN A;  1N34 C;  3GKU A;  3EQ6 A;  2MM9 A;  5ADZ A;  1P4E A;  3IEU A;  1PG4 A; 
#chains in the Genus database with same CATH homology
 1V60 A;  4PUH A;  2KDN A;  2KZ0 A;  2MCQ A;  3TR3 A;  2DHM A;  1NY8 A;  2MM9 A;  2MMA B;  1XS3 A;  3O2E A;  2NCL A;  4PUG A;  5LCI A;  4PUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...