3O2EA

Crystal structure of a bol-like protein from babesia bovis
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
86
structure length
86
Chain Sequence
PGSMVSKSIVEERLRSMLSPQFLKVTDNSGGCGAAFNAYIVSQQFEGKGLLDRQRLVNSAIAAEMPQIHAFTMKCLTPGEWEAKNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords BolA-like protein
publication title SAD phasing using iodide ions in a high-throughput structural genomics environment.
pubmed doi rcsb
source organism Babesia bovis
total genus 26
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 3o2eA00
2MCQA 2KDNA 5LCIA 2MM9A 2DHMA 2NCLA 2MMAB 1NY8A 2KZ0A 4PUGA 4PUHA 1XS3A 1V60A 3O2EA 4PUIA 3TR3A
chains in the Genus database with same CATH superfamily
4XX2A 2D27A 1IBMC 2ATWA 3TQIA 3AY0A 4HPVA 2D1SA 2DHMA 4OYCA 4DCSA 3A9VA 1MD9A 2OPLB 1N2FA 1XRBA 4PZPA 1HNZC 4DR6C 5KYVA 4ZLPA 4BC9A 3A26A 3KXWA 1KKGA 4L4QA 2PROA 4NDNA 3N2QA 1I94C 4X64C 3R9WA 4IR7A 5K85A 4DCUA 2BH1X 1RG9A 5AE3A 2P2MA 1NYEA 1VEHA 3UOWA 3J81D 2CU6A 4R1MA 1PG4A 3CW9A 3SO4A 2P2JA 2V7BA 5A1IA 2MM9A 2F4VC 3UX2A 4NOZA 3EERA 3GR1A 1P4EA 1MXBA 4FUQA 4LFAC 2QL8A 2D1RA 1UKKA 4GKKC 4RMNA 2WD9A 3S82A 1ML8A 3CQ1A 1ZB9A 4PUIA 3UZ0A 2EGTA 4KHPC 4JV5C 1V60A 4JI0C 5A2QD 3PROC 1PA4A 3C5EA 2ASBA 3LAXA 3L8CA 1V25A 4DR7C 3RV2A 4NXNC 4B3SC 5A19A 4JI6C 5KEIA 4DV0C 3DAYA 2QVYX 2Y4NA 4B3TC 2E8CA 3NYQA 5AE2A 4D4GA 4BBYA 4DR4C 4LF8C 2E5LC 1N33C 1WF3A 3IEVA 3E7WA 4X66C 5KYTA 5BUSA 1IB8A 4DV4C 5AE1A 1FUGA 1HNWC 2D7VA 4EATA 2WP0C 3IEUA 3ETCA 2UUCC 5LMNC 1N36C 3PBKA 4RM2A 3NPDA 5CZXA 3O2EA 4RLQA 1XMOC 3J80D 4DUZC 5FLXD 3R9XA 4X65C 4I9FA 3GR0A 4JI1C 5GTDA 4YY3C 4GKJC 3LNOA 2OPLA 1IBKC 4DR3C 1P7LA 4LE5A 1QM4A 3TR3A 3DHVA 1K0RA 2E7GA 3CQ3A 3AF6A 4DUYC 4LF9C 3T1YC 2JNVA 4DV7C 4OX9C 2YX1A 3G7SA 3FCCA 4DCTA 1RY2A 2XR1A 4ISBA 4JI3C 2HHHC 4RM3A 2KZ0A 3CQ2A 3T1HC 3JAMD 4JI2C 2UXBC 2P20A 2Y4OA 5IFIA 2VSQA 4D57A 1LQLA 5A1GA 1JOSA 4G36A 1O90A 3NI2A 2YWBA 3R44A 4BCAA 1IBLC 2UXDC 5BSRA 1HR0C 1AMUA 3A4IA 3UEBA 5T8SA 2M5HA 3OTOC 4DV3C 4KTTA 2Y27A 2D1TA 3EQ6A 4AQYC 1EGAA 1M6XA 1N34C 1XHJA 1XMQC 3AF5A 2UU9C 2DPLA 2PT7G 4MTNA 4GS5A 2MCQA 4ZJZA 1WH9A 4PROC 4B3MC 2E8FA 5BSTA 4PUGA 2P02A 2DYJA 2YCBA 1USPA 1NY8A 4WV3A 4JI4C 4K0BA 1HH2P 3FCEA 4K0KC 4L2ZA 1HNXC 2M5OA 1O92A 3DLPX 4TPSB 4LF5C 1MDBA 2QW0X 3GPCA 4I9GA 5BURA 4GXQA 5IWAC 4GXRA 5ADZA 1O93A 1T5DX 4DV6C 4JM1A 5IT9D 2E0GA 4RLFA 5BR8C 5JRHA 2QVZX 4DG9A 2D1QA 4DV2C 1VLAA 4JI8C 3TUFA 2VQEC 5LCIA 1PG3A 4JYAC 3VNSA 4NXMC 4LF6C 4LF4C 3CJEA 5BUQA 5H9UA 4X62C 5LMUC 2CXCA 3UX3A 3LUSA 1N32C 5CZVA 1L2FA 1XRCA 4OXIA 2BJOA 2P2BA 4JI7C 2HJGA 4D56A 4BC7A 1P4EC 1GPMA 4RVNA 3IMLA 4LF7C 4G37A 1XNQC 2P2FA 2AYAA 3LGXA 1FJGC 4R1LA 1QWIA 1M6XC 2D28C 3A9UA 2CY1A 3L95X 4D4IA 4DG8A 4DR2C 1XNRC 1O9TA 3K6RA 3A25A 4PHTA 2YWCA 4PUHA 1XS3A 4FTFA 2ZM6C 4R0MA 3N54B 1ULTA 2ONFA 3RG2A 1LCIA 1PU1A 1WCJA 1MXCA 1ZB8A 2MMAB 1XRAA 1FLOA 2KZFA 1T5HX 1TH5A 2Z51A 4DCVA 2UUAC 2UXCC 4KTVA 3PESA 3VNRA 4BSZA 4RVOA 4WS9A 1BA3A 2OBVA 2NCLA 5E7QA 3NYRA 1V26A 1UWDA 1YJ7A 2VZEA 4L7IA 3LNVA 4ODJA 3I07A 4YHHC 3VNQA 4DR1C 2VQFC 5T8TA 3TDEA 4DV5C 2UUBC 2OO4A 1J5EC 2ZZMA 2JMPA 4DV1C 3E7XA 5BSVA 4LFCC 5DV9A 4FUTA 3IPLA 4DR5C 1USPB 1MXAA 3I08A 1MDFA 5K8FA 4U5YD 4LFBC 5BSWA 4G1IA 3CW8X 2P2QA 2PN2A 2ZZNA 1MKYA 4B3RC 5BSMA 3H2TA 2E8EA 5BSUA 4JI5C 3B7WA 3GKUA 2QVXX 4IZ6A 4MH4A 3ETOA 2KDNA
chains in the Genus database with same CATH topology
2MCQA 2KDNA 5LCIA 2MM9A 2DHMA 2NCLA 2MMAB 1NY8A 2KZ0A 4PUGA 4PUHA 1XS3A 1V60A 3O2EA 4PUIA 3TR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MCQ A;  2KDN A;  5LCI A;  2MM9 A;  2DHM A;  2NCL A;  2MMA B;  1NY8 A;  2KZ0 A;  4PUG A;  4PUH A;  1XS3 A;  1V60 A;  3O2E A;  4PUI A;  3TR3 A; 
#chains in the Genus database with same CATH topology
 4XX2 A;  2D27 A;  1IBM C;  2ATW A;  3TQI A;  3AY0 A;  4HPV A;  2D1S A;  2DHM A;  4OYC A;  4DCS A;  3A9V A;  1MD9 A;  2OPL B;  1N2F A;  1XRB A;  4PZP A;  1HNZ C;  4DR6 C;  5KYV A;  4ZLP A;  4BC9 A;  3A26 A;  3KXW A;  1KKG A;  4L4Q A;  2PRO A;  4NDN A;  3N2Q A;  1I94 C;  4X64 C;  3R9W A;  4IR7 A;  5K85 A;  4DCU A;  2BH1 X;  1RG9 A;  5AE3 A;  2P2M A;  1NYE A;  1VEH A;  3UOW A;  3J81 D;  2CU6 A;  4R1M A;  1PG4 A;  3CW9 A;  3SO4 A;  2P2J A;  2V7B A;  5A1I A;  2MM9 A;  2F4V C;  3UX2 A;  4NOZ A;  3EER A;  3GR1 A;  1P4E A;  1MXB A;  4FUQ A;  4LFA C;  2QL8 A;  2D1R A;  1UKK A;  4GKK C;  4RMN A;  2WD9 A;  3S82 A;  1ML8 A;  3CQ1 A;  1ZB9 A;  4PUI A;  3UZ0 A;  2EGT A;  4KHP C;  4JV5 C;  1V60 A;  4JI0 C;  5A2Q D;  3PRO C;  1PA4 A;  3C5E A;  2ASB A;  3LAX A;  3L8C A;  1V25 A;  4DR7 C;  3RV2 A;  4NXN C;  4B3S C;  5A19 A;  4JI6 C;  5KEI A;  4DV0 C;  3DAY A;  2QVY X;  2Y4N A;  4B3T C;  2E8C A;  3NYQ A;  5AE2 A;  4D4G A;  4BBY A;  4DR4 C;  4LF8 C;  2E5L C;  1N33 C;  1WF3 A;  3IEV A;  3E7W A;  4X66 C;  5KYT A;  5BUS A;  1IB8 A;  4DV4 C;  5AE1 A;  1FUG A;  1HNW C;  2D7V A;  4EAT A;  2WP0 C;  3IEU A;  3ETC A;  2UUC C;  5LMN C;  1N36 C;  3PBK A;  4RM2 A;  3NPD A;  5CZX A;  3O2E A;  4RLQ A;  1XMO C;  3J80 D;  4DUZ C;  5FLX D;  3R9X A;  4X65 C;  4I9F A;  3GR0 A;  4JI1 C;  5GTD A;  4YY3 C;  4GKJ C;  3LNO A;  2OPL A;  1IBK C;  4DR3 C;  1P7L A;  4LE5 A;  1QM4 A;  3TR3 A;  3DHV A;  1K0R A;  2E7G A;  3CQ3 A;  3AF6 A;  4DUY C;  4LF9 C;  3T1Y C;  2JNV A;  4DV7 C;  4OX9 C;  2YX1 A;  3G7S A;  3FCC A;  4DCT A;  1RY2 A;  2XR1 A;  4ISB A;  4JI3 C;  2HHH C;  4RM3 A;  2KZ0 A;  3CQ2 A;  3T1H C;  3JAM D;  4JI2 C;  2UXB C;  2P20 A;  2Y4O A;  5IFI A;  2VSQ A;  4D57 A;  1LQL A;  5A1G A;  1JOS A;  4G36 A;  1O90 A;  3NI2 A;  2YWB A;  3R44 A;  4BCA A;  1IBL C;  2UXD C;  5BSR A;  1HR0 C;  1AMU A;  3A4I A;  3UEB A;  5T8S A;  2M5H A;  3OTO C;  4DV3 C;  4KTT A;  2Y27 A;  2D1T A;  3EQ6 A;  4AQY C;  1EGA A;  1M6X A;  1N34 C;  1XHJ A;  1XMQ C;  3AF5 A;  2UU9 C;  2DPL A;  2PT7 G;  4MTN A;  4GS5 A;  2MCQ A;  4ZJZ A;  1WH9 A;  4PRO C;  4B3M C;  2E8F A;  5BST A;  4PUG A;  2P02 A;  2DYJ A;  2YCB A;  1USP A;  1NY8 A;  4WV3 A;  4JI4 C;  4K0B A;  1HH2 P;  3FCE A;  4K0K C;  4L2Z A;  1HNX C;  2M5O A;  1O92 A;  3DLP X;  4TPS B;  4LF5 C;  1MDB A;  2QW0 X;  3GPC A;  4I9G A;  5BUR A;  4GXQ A;  5IWA C;  4GXR A;  5ADZ A;  1O93 A;  1T5D X;  4DV6 C;  4JM1 A;  5IT9 D;  2E0G A;  4RLF A;  5BR8 C;  5JRH A;  2QVZ X;  4DG9 A;  2D1Q A;  4DV2 C;  1VLA A;  4JI8 C;  3TUF A;  2VQE C;  5LCI A;  1PG3 A;  4JYA C;  3VNS A;  4NXM C;  4LF6 C;  4LF4 C;  3CJE A;  5BUQ A;  5H9U A;  4X62 C;  5LMU C;  2CXC A;  3UX3 A;  3LUS A;  1N32 C;  5CZV A;  1L2F A;  1XRC A;  4OXI A;  2BJO A;  2P2B A;  4JI7 C;  2HJG A;  4D56 A;  4BC7 A;  1P4E C;  1GPM A;  4RVN A;  3IML A;  4LF7 C;  4G37 A;  1XNQ C;  2P2F A;  2AYA A;  3LGX A;  1FJG C;  4R1L A;  1QWI A;  1M6X C;  2D28 C;  3A9U A;  2CY1 A;  3L95 X;  4D4I A;  4DG8 A;  4DR2 C;  1XNR C;  1O9T A;  3K6R A;  3A25 A;  4PHT A;  2YWC A;  4PUH A;  1XS3 A;  4FTF A;  2ZM6 C;  4R0M A;  3N54 B;  1ULT A;  2ONF A;  3RG2 A;  1LCI A;  1PU1 A;  1WCJ A;  1MXC A;  1ZB8 A;  2MMA B;  1XRA A;  1FLO A;  2KZF A;  1T5H X;  1TH5 A;  2Z51 A;  4DCV A;  2UUA C;  2UXC C;  4KTV A;  3PES A;  3VNR A;  4BSZ A;  4RVO A;  4WS9 A;  1BA3 A;  2OBV A;  2NCL A;  5E7Q A;  3NYR A;  1V26 A;  1UWD A;  1YJ7 A;  2VZE A;  4L7I A;  3LNV A;  4ODJ A;  3I07 A;  4YHH C;  3VNQ A;  4DR1 C;  2VQF C;  5T8T A;  3TDE A;  4DV5 C;  2UUB C;  2OO4 A;  1J5E C;  2ZZM A;  2JMP A;  4DV1 C;  3E7X A;  5BSV A;  4LFC C;  5DV9 A;  4FUT A;  3IPL A;  4DR5 C;  1USP B;  1MXA A;  3I08 A;  1MDF A;  5K8F A;  4U5Y D;  4LFB C;  5BSW A;  4G1I A;  3CW8 X;  2P2Q A;  2PN2 A;  2ZZN A;  1MKY A;  4B3R C;  5BSM A;  3H2T A;  2E8E A;  5BSU A;  4JI5 C;  3B7W A;  3GKU A;  2QVX X;  4IZ6 A;  4MH4 A;  3ETO A;  2KDN A; 
#chains in the Genus database with same CATH homology
 2MCQ A;  2KDN A;  5LCI A;  2MM9 A;  2DHM A;  2NCL A;  2MMA B;  1NY8 A;  2KZ0 A;  4PUG A;  4PUH A;  1XS3 A;  1V60 A;  3O2E A;  4PUI A;  3TR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...