1XRBA

S-adenosylmethionine synthetase (mat, atp: l-methionine s-adenosyltransferase, e.c.2.5.1.6) in which met residues are replaced with selenomethionine residues (mse)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule tags Transferase
total genus 119
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA02
4KTTA 5A1GA 1QM4A 3S82A 1MXBA 1O92A 5A1IA 1O93A 1O90A 1MXCA 3TDEA 1XRAA 3UOWA 2YWCA 5A19A 3TQIA 1XRCA 4ODJA 3IMLA 4WS9A 5T8SA 1XRBA 4KTVA 3RV2A 2OBVA 2P02A 4L2ZA 4HPVA 4LE5A 5H9UA 4K0BA 5T8TA 1O9TA 4L4QA 1GPMA 3A4IA 4L7IA 1FUGA 1MXAA 1RG9A 4NDNA 1P7LA 2YWBA 3SO4A 2DPLA
chains in the Genus database with same CATH superfamily
5A1GA 4BC7A 3AF5A 2E8EA 2D1QA 1XS3A 1AMUA 4DV2C 4JI0C 5KYTA 5BURA 1WF3A 1L2FA 1PA4A 3JAMD 2V7BA 3CJEA 4IR7A 2E0GA 2AYAA 4JI6C 4WV3A 4RMNA 3DHVA 4PUHA 1IBMC 1VLAA 3T1YC 2PROA 4DV7C 1HNWC 4MTNA 4JI4C 4JI2C 4DCSA 2OBVA 2P02A 3K6RA 1NY8A 4FUQA 2E5LC 2YX1A 2YWBA 5BSWA 4PUIA 3EQ6A 4I9FA 2P2MA 3RG2A 3L95X 4DG9A 1O93A 2D7VA 5CZXA 1BA3A 2YWCA 4NXMC 4LF4C 2VZEA 2QVZX 3N54B 3I08A 2D1SA 4X66C 2D1RA 4JI1C 2QVXX 3O2EA 3EERA 4G1IA 4RM3A 3A9UA 2JMPA 3CW9A 3TDEA 1ZB8A 1I94C 2CU6A 1IBLC 3CW8X 3CQ3A 3GR0A 3R9WA 3VNRA 2DYJA 1EGAA 4DCVA 5CZVA 3OTOC 4LF7C 2MM9A 4DR5C 4JI3C 3FCCA 3ETOA 4D57A 1QM4A 3LAXA 4G36A 1XNQC 4DG8A 3NYRA 2D1TA 4DV0C 3PBKA 4PHTA 3AY0A 3GPCA 2D28C 3IEVA 4DR4C 4TPSB 4DV5C 4DV3C 4FUTA 2HHHC 2Y4OA 3LGXA 4D4GA 5ADZA 2OPLA 3I07A 1FUGA 2OPLB 4BCAA 4LF6C 4OXIA 3LNOA 4LF5C 1O92A 5BUSA 4DV4C 2UUCC 4JYAC 5BR8C 4ISBA 2JNVA 4B3MC 1MDBA 1MKYA 4B3RC 4DR7C 3RV2A 4X62C 4R1MA 1UKKA 4HPVA 4LE5A 4GKJC 3VNQA 4K0KC 1T5DX 2WP0C 3R44A 2ASBA 1V25A 4YHHC 3GKUA 2P2FA 4FTFA 4LFAC 1N33C 5AE1A 1ULTA 4JI7C 3J80D 3FCEA 1N36C 5T8SA 4LF9C 3GR1A 4D56A 5AE2A 5BSUA 2KZ0A 4JI8C 2P2QA 5BSRA 4ZLPA 1NYEA 2VQFC 5IFIA 3CQ1A 1UWDA 5A1IA 4YY3C 2QW0X 3DAYA 2D27A 1XMOC 5BSMA 3UOWA 1FLOA 2Z51A 3LNVA 2E8CA 1M6XA 5LMNC 5T8TA 4RVOA 4L7IA 2BH1X 3SO4A 4LFCC 4DUYC 4I9GA 1MDFA 4OYCA 3S82A 4X65C 4DV6C 4LFBC 1PG4A 3TQIA 2XR1A 4WS9A 4DV1C 1T5HX 2E7GA 2QL8A 4DR1C 3G7SA 4KHPC 1QWIA 3A4IA 1LQLA 4NDNA 5JRHA 4B3TC 2DPLA 3E7WA 4PUGA 4IZ6A 3TR3A 1O90A 1MXCA 2QVYX 1XRAA 3LUSA 2NCLA 1XNRC 1XMQC 4DR2C 2KZFA 3TUFA 2E8FA 5IT9D 1P7LA 4DUZC 3UEBA 2M5OA 1K0RA 2UUAC 1MXBA 2F4VC 4PZPA 1PG3A 5KYVA 2UXCC 5K8FA 2KDNA 3A26A 1HNZC 3UX2A 2CY1A 5BSTA 1HNXC 4L2ZA 1J5EC 1N2FA 4K0BA 1O9TA 3L8CA 1GPMA 5K85A 1JOSA 4ZJZA 4EATA 4BSZA 3DLPX 5KEIA 5LMUC 2Y4NA 4JV5C 1RY2A 2UXBC 4OX9C 1XRCA 2ATWA 3E7XA 3ETCA 1HH2P 3AF6A 3NYQA 4AQYC 4B3SC 3UX3A 2VQEC 3UZ0A 4R0MA 3B7WA 2ZZNA 4LF8C 1MD9A 2VSQA 5DV9A 5A19A 4G37A 4RVNA 1WCJA 1XRBA 2UXDC 1YJ7A 3IPLA 3VNSA 2UU9C 3C5EA 2MCQA 3T1HC 1USPA 2OO4A 1ZB9A 1USPB 1IBKC 5E7QA 1MXAA 4NOZA 1KKGA 4KTTA 1V60A 3A9VA 1N32C 4GKKC 2PN2A 4JM1A 1TH5A 4BC9A 1PU1A 4DR6C 4ODJA 1M6XC 4DR3C 3PROC 2YCBA 4KTVA 4RLQA 2WD9A 4DCTA 1P4EA 4NXNC 2MMAB 2EGTA 2ZZMA 4L4QA 3CQ2A 2P2BA 2P20A 2BJOA 4X64C 2M5HA 4DCUA 2DHMA 1P4EC 1N34C 4R1LA 3J81D 2ZM6C 4D4IA 4MH4A 1IB8A 3IMLA 4U5YD 2Y27A 5H9UA 1V26A 4GS5A 4PROC 5BSVA 1HR0C 1LCIA 3NPDA 5BUQA 2P2JA 5GTDA 4RLFA 4JI5C 1FJGC 1WH9A 3PESA 4GXQA 3N2QA 4GXRA 5AE3A 3KXWA 2HJGA 2UUBC 1ML8A 3IEUA 3A25A 3NI2A 2ONFA 4BBYA 5LCIA 2PT7G 4RM2A 5IWAC 1VEHA 5A2QD 2CXCA 3H2TA 1XHJA 1RG9A 3R9XA 4XX2A 5FLXD
chains in the Genus database with same CATH topology
5A1GA 4BC7A 3AF5A 2E8EA 2D1QA 1AMUA 4DV2C 4JI0C 5KYTA 5BURA 1WF3A 1L2FA 1PA4A 3JAMD 2V7BA 3CJEA 4IR7A 2E0GA 2AYAA 4JI6C 4WV3A 4RMNA 3DHVA 1IBMC 1VLAA 3T1YC 2PROA 4DV7C 1HNWC 4MTNA 4JI4C 4JI2C 4DCSA 2OBVA 2P02A 4FUQA 2E5LC 2YWBA 5BSWA 3EQ6A 4I9FA 2P2MA 3RG2A 3L95X 4DG9A 1O93A 2D7VA 5CZXA 1BA3A 2YWCA 4NXMC 4LF4C 2VZEA 2QVZX 3N54B 3I08A 2D1SA 4X66C 2D1RA 4JI1C 2QVXX 3EERA 4G1IA 4RM3A 3A9UA 2JMPA 3CW9A 3TDEA 1ZB8A 1I94C 1IBLC 3CW8X 3GR0A 3R9WA 3VNRA 2DYJA 1EGAA 4DCVA 5CZVA 3OTOC 4LF7C 4DR5C 4JI3C 3FCCA 3ETOA 4D57A 1QM4A 3LAXA 4G36A 1XNQC 4DG8A 3NYRA 2D1TA 4DV0C 3PBKA 4PHTA 3GPCA 3IEVA 2D28C 4DR4C 4TPSB 4DV5C 4DV3C 4FUTA 2HHHC 2Y4OA 3LGXA 4D4GA 5ADZA 2OPLA 3I07A 1FUGA 2OPLB 4BCAA 4LF6C 4OXIA 4LF5C 1O92A 5BUSA 4DV4C 2UUCC 4JYAC 5BR8C 4ISBA 4B3MC 1MDBA 1MKYA 4B3RC 4DR7C 3RV2A 4X62C 4R1MA 1UKKA 4HPVA 4LE5A 4GKJC 3VNQA 4K0KC 1T5DX 2WP0C 3R44A 2ASBA 1V25A 4YHHC 3GKUA 2P2FA 4FTFA 4LFAC 1N33C 5AE1A 1ULTA 4JI7C 3J80D 3FCEA 1N36C 5T8SA 4LF9C 3GR1A 4D56A 5AE2A 5BSUA 4JI8C 2P2QA 5BSRA 4ZLPA 1NYEA 2VQFC 5IFIA 5A1IA 4YY3C 2QW0X 3DAYA 2D27A 1XMOC 5BSMA 3UOWA 3LNVA 2E8CA 5LMNC 5T8TA 4RVOA 4L7IA 2BH1X 3SO4A 4LFCC 4DUYC 4I9GA 1MDFA 4OYCA 3S82A 4X65C 4DV6C 4LFBC 1PG4A 3TQIA 2XR1A 4WS9A 4DV1C 1T5HX 2E7GA 2QL8A 4DR1C 3G7SA 4KHPC 1QWIA 3A4IA 1LQLA 4NDNA 5JRHA 4B3TC 2DPLA 3E7WA 4IZ6A 1O90A 1MXCA 2QVYX 1XRAA 3LUSA 1XNRC 1XMQC 4DR2C 2KZFA 3TUFA 2E8FA 5IT9D 1P7LA 4DUZC 1K0RA 2UUAC 1MXBA 2F4VC 4PZPA 1PG3A 5KYVA 2UXCC 5K8FA 1HNZC 2CY1A 5BSTA 1HNXC 4L2ZA 1J5EC 1N2FA 4K0BA 1O9TA 3L8CA 1GPMA 5K85A 1JOSA 4ZJZA 4EATA 4BSZA 3DLPX 5KEIA 5LMUC 2Y4NA 4JV5C 1RY2A 2UXBC 4OX9C 1XRCA 2ATWA 3E7XA 3ETCA 1HH2P 3AF6A 3NYQA 4AQYC 4B3SC 2VQEC 3UZ0A 4R0MA 3B7WA 4LF8C 1MD9A 2VSQA 5DV9A 5A19A 4G37A 4RVNA 1XRBA 2UXDC 1YJ7A 3IPLA 3VNSA 2UU9C 3C5EA 3T1HC 1USPA 2OO4A 1ZB9A 1USPB 1IBKC 5E7QA 1MXAA 4NOZA 1KKGA 4KTTA 3A9VA 1N32C 4GKKC 2PN2A 4JM1A 4BC9A 4DR6C 4ODJA 4DR3C 3PROC 2YCBA 4KTVA 4RLQA 2WD9A 4DCTA 4NXNC 2EGTA 4L4QA 2P2BA 2P20A 2BJOA 4X64C 4DCUA 1N34C 4R1LA 3J81D 2ZM6C 4D4IA 4MH4A 3IMLA 4U5YD 2Y27A 5H9UA 1V26A 4GS5A 4PROC 5BSVA 1HR0C 1LCIA 3NPDA 5BUQA 2P2JA 5GTDA 4RLFA 4JI5C 1FJGC 1WH9A 3PESA 4GXQA 3N2QA 4GXRA 5AE3A 3KXWA 2HJGA 2UUBC 1ML8A 3IEUA 3NI2A 2ONFA 4BBYA 2PT7G 4RM2A 5IWAC 5A2QD 2CXCA 3H2TA 1RG9A 3R9XA 4XX2A 5FLXD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTT A;  5A1G A;  1QM4 A;  3S82 A;  1MXB A;  1O92 A;  5A1I A;  1O93 A;  1O90 A;  1MXC A;  3TDE A;  1XRA A;  3UOW A;  2YWC A;  5A19 A;  3TQI A;  1XRC A;  4ODJ A;  3IML A;  4WS9 A;  5T8S A;  1XRB A;  4KTV A;  3RV2 A;  2OBV A;  2P02 A;  4L2Z A;  4HPV A;  4LE5 A;  5H9U A;  4K0B A;  5T8T A;  1O9T A;  4L4Q A;  1GPM A;  3A4I A;  4L7I A;  1FUG A;  1MXA A;  1RG9 A;  4NDN A;  1P7L A;  2YWB A;  3SO4 A;  2DPL A; 
#chains in the Genus database with same CATH topology
 5A1G A;  4BC7 A;  3AF5 A;  2E8E A;  2D1Q A;  1XS3 A;  1AMU A;  4DV2 C;  4JI0 C;  5KYT A;  5BUR A;  1WF3 A;  1L2F A;  1PA4 A;  3JAM D;  2V7B A;  3CJE A;  4IR7 A;  2E0G A;  2AYA A;  4JI6 C;  4WV3 A;  4RMN A;  3DHV A;  4PUH A;  1IBM C;  1VLA A;  3T1Y C;  2PRO A;  4DV7 C;  1HNW C;  4MTN A;  4JI4 C;  4JI2 C;  4DCS A;  2OBV A;  2P02 A;  3K6R A;  1NY8 A;  4FUQ A;  2E5L C;  2YX1 A;  2YWB A;  5BSW A;  4PUI A;  3EQ6 A;  4I9F A;  2P2M A;  3RG2 A;  3L95 X;  4DG9 A;  1O93 A;  2D7V A;  5CZX A;  1BA3 A;  2YWC A;  4NXM C;  4LF4 C;  2VZE A;  2QVZ X;  3N54 B;  3I08 A;  2D1S A;  4X66 C;  2D1R A;  4JI1 C;  2QVX X;  3O2E A;  3EER A;  4G1I A;  4RM3 A;  3A9U A;  2JMP A;  3CW9 A;  3TDE A;  1ZB8 A;  1I94 C;  2CU6 A;  1IBL C;  3CW8 X;  3CQ3 A;  3GR0 A;  3R9W A;  3VNR A;  2DYJ A;  1EGA A;  4DCV A;  5CZV A;  3OTO C;  4LF7 C;  2MM9 A;  4DR5 C;  4JI3 C;  3FCC A;  3ETO A;  4D57 A;  1QM4 A;  3LAX A;  4G36 A;  1XNQ C;  4DG8 A;  3NYR A;  2D1T A;  4DV0 C;  3PBK A;  4PHT A;  3AY0 A;  3GPC A;  2D28 C;  3IEV A;  4DR4 C;  4TPS B;  4DV5 C;  4DV3 C;  4FUT A;  2HHH C;  2Y4O A;  3LGX A;  4D4G A;  5ADZ A;  2OPL A;  3I07 A;  1FUG A;  2OPL B;  4BCA A;  4LF6 C;  4OXI A;  3LNO A;  4LF5 C;  1O92 A;  5BUS A;  4DV4 C;  2UUC C;  4JYA C;  5BR8 C;  4ISB A;  2JNV A;  4B3M C;  1MDB A;  1MKY A;  4B3R C;  4DR7 C;  3RV2 A;  4X62 C;  4R1M A;  1UKK A;  4HPV A;  4LE5 A;  4GKJ C;  3VNQ A;  4K0K C;  1T5D X;  2WP0 C;  3R44 A;  2ASB A;  1V25 A;  4YHH C;  3GKU A;  2P2F A;  4FTF A;  4LFA C;  1N33 C;  5AE1 A;  1ULT A;  4JI7 C;  3J80 D;  3FCE A;  1N36 C;  5T8S A;  4LF9 C;  3GR1 A;  4D56 A;  5AE2 A;  5BSU A;  2KZ0 A;  4JI8 C;  2P2Q A;  5BSR A;  4ZLP A;  1NYE A;  2VQF C;  5IFI A;  3CQ1 A;  1UWD A;  5A1I A;  4YY3 C;  2QW0 X;  3DAY A;  2D27 A;  1XMO C;  5BSM A;  3UOW A;  1FLO A;  2Z51 A;  3LNV A;  2E8C A;  1M6X A;  5LMN C;  5T8T A;  4RVO A;  4L7I A;  2BH1 X;  3SO4 A;  4LFC C;  4DUY C;  4I9G A;  1MDF A;  4OYC A;  3S82 A;  4X65 C;  4DV6 C;  4LFB C;  1PG4 A;  3TQI A;  2XR1 A;  4WS9 A;  4DV1 C;  1T5H X;  2E7G A;  2QL8 A;  4DR1 C;  3G7S A;  4KHP C;  1QWI A;  3A4I A;  1LQL A;  4NDN A;  5JRH A;  4B3T C;  2DPL A;  3E7W A;  4PUG A;  4IZ6 A;  3TR3 A;  1O90 A;  1MXC A;  2QVY X;  1XRA A;  3LUS A;  2NCL A;  1XNR C;  1XMQ C;  4DR2 C;  2KZF A;  3TUF A;  2E8F A;  5IT9 D;  1P7L A;  4DUZ C;  3UEB A;  2M5O A;  1K0R A;  2UUA C;  1MXB A;  2F4V C;  4PZP A;  1PG3 A;  5KYV A;  2UXC C;  5K8F A;  2KDN A;  3A26 A;  1HNZ C;  3UX2 A;  2CY1 A;  5BST A;  1HNX C;  4L2Z A;  1J5E C;  1N2F A;  4K0B A;  1O9T A;  3L8C A;  1GPM A;  5K85 A;  1JOS A;  4ZJZ A;  4EAT A;  4BSZ A;  3DLP X;  5KEI A;  5LMU C;  2Y4N A;  4JV5 C;  1RY2 A;  2UXB C;  4OX9 C;  1XRC A;  2ATW A;  3E7X A;  3ETC A;  1HH2 P;  3AF6 A;  3NYQ A;  4AQY C;  4B3S C;  3UX3 A;  2VQE C;  3UZ0 A;  4R0M A;  3B7W A;  2ZZN A;  4LF8 C;  1MD9 A;  2VSQ A;  5DV9 A;  5A19 A;  4G37 A;  4RVN A;  1WCJ A;  1XRB A;  2UXD C;  1YJ7 A;  3IPL A;  3VNS A;  2UU9 C;  3C5E A;  2MCQ A;  3T1H C;  1USP A;  2OO4 A;  1ZB9 A;  1USP B;  1IBK C;  5E7Q A;  1MXA A;  4NOZ A;  1KKG A;  4KTT A;  1V60 A;  3A9V A;  1N32 C;  4GKK C;  2PN2 A;  4JM1 A;  1TH5 A;  4BC9 A;  1PU1 A;  4DR6 C;  4ODJ A;  1M6X C;  4DR3 C;  3PRO C;  2YCB A;  4KTV A;  4RLQ A;  2WD9 A;  4DCT A;  1P4E A;  4NXN C;  2MMA B;  2EGT A;  2ZZM A;  4L4Q A;  3CQ2 A;  2P2B A;  2P20 A;  2BJO A;  4X64 C;  2M5H A;  4DCU A;  2DHM A;  1P4E C;  1N34 C;  4R1L A;  3J81 D;  2ZM6 C;  4D4I A;  4MH4 A;  1IB8 A;  3IML A;  4U5Y D;  2Y27 A;  5H9U A;  1V26 A;  4GS5 A;  4PRO C;  5BSV A;  1HR0 C;  1LCI A;  3NPD A;  5BUQ A;  2P2J A;  5GTD A;  4RLF A;  4JI5 C;  1FJG C;  1WH9 A;  3PES A;  4GXQ A;  3N2Q A;  4GXR A;  5AE3 A;  3KXW A;  2HJG A;  2UUB C;  1ML8 A;  3IEU A;  3A25 A;  3NI2 A;  2ONF A;  4BBY A;  5LCI A;  2PT7 G;  4RM2 A;  5IWA C;  1VEH A;  5A2Q D;  2CXC A;  3H2T A;  1XHJ A;  1RG9 A;  3R9X A;  4XX2 A;  5FLX D; 
#chains in the Genus database with same CATH homology
 5A1G A;  4BC7 A;  3AF5 A;  2E8E A;  2D1Q A;  1AMU A;  4DV2 C;  4JI0 C;  5KYT A;  5BUR A;  1WF3 A;  1L2F A;  1PA4 A;  3JAM D;  2V7B A;  3CJE A;  4IR7 A;  2E0G A;  2AYA A;  4JI6 C;  4WV3 A;  4RMN A;  3DHV A;  1IBM C;  1VLA A;  3T1Y C;  2PRO A;  4DV7 C;  1HNW C;  4MTN A;  4JI4 C;  4JI2 C;  4DCS A;  2OBV A;  2P02 A;  4FUQ A;  2E5L C;  2YWB A;  5BSW A;  3EQ6 A;  4I9F A;  2P2M A;  3RG2 A;  3L95 X;  4DG9 A;  1O93 A;  2D7V A;  5CZX A;  1BA3 A;  2YWC A;  4NXM C;  4LF4 C;  2VZE A;  2QVZ X;  3N54 B;  3I08 A;  2D1S A;  4X66 C;  2D1R A;  4JI1 C;  2QVX X;  3EER A;  4G1I A;  4RM3 A;  3A9U A;  2JMP A;  3CW9 A;  3TDE A;  1ZB8 A;  1I94 C;  1IBL C;  3CW8 X;  3GR0 A;  3R9W A;  3VNR A;  2DYJ A;  1EGA A;  4DCV A;  5CZV A;  3OTO C;  4LF7 C;  4DR5 C;  4JI3 C;  3FCC A;  3ETO A;  4D57 A;  1QM4 A;  3LAX A;  4G36 A;  1XNQ C;  4DG8 A;  3NYR A;  2D1T A;  4DV0 C;  3PBK A;  4PHT A;  3GPC A;  3IEV A;  2D28 C;  4DR4 C;  4TPS B;  4DV5 C;  4DV3 C;  4FUT A;  2HHH C;  2Y4O A;  3LGX A;  4D4G A;  5ADZ A;  2OPL A;  3I07 A;  1FUG A;  2OPL B;  4BCA A;  4LF6 C;  4OXI A;  4LF5 C;  1O92 A;  5BUS A;  4DV4 C;  2UUC C;  4JYA C;  5BR8 C;  4ISB A;  4B3M C;  1MDB A;  1MKY A;  4B3R C;  4DR7 C;  3RV2 A;  4X62 C;  4R1M A;  1UKK A;  4HPV A;  4LE5 A;  4GKJ C;  3VNQ A;  4K0K C;  1T5D X;  2WP0 C;  3R44 A;  2ASB A;  1V25 A;  4YHH C;  3GKU A;  2P2F A;  4FTF A;  4LFA C;  1N33 C;  5AE1 A;  1ULT A;  4JI7 C;  3J80 D;  3FCE A;  1N36 C;  5T8S A;  4LF9 C;  3GR1 A;  4D56 A;  5AE2 A;  5BSU A;  4JI8 C;  2P2Q A;  5BSR A;  4ZLP A;  1NYE A;  2VQF C;  5IFI A;  5A1I A;  4YY3 C;  2QW0 X;  3DAY A;  2D27 A;  1XMO C;  5BSM A;  3UOW A;  3LNV A;  2E8C A;  5LMN C;  5T8T A;  4RVO A;  4L7I A;  2BH1 X;  3SO4 A;  4LFC C;  4DUY C;  4I9G A;  1MDF A;  4OYC A;  3S82 A;  4X65 C;  4DV6 C;  4LFB C;  1PG4 A;  3TQI A;  2XR1 A;  4WS9 A;  4DV1 C;  1T5H X;  2E7G A;  2QL8 A;  4DR1 C;  3G7S A;  4KHP C;  1QWI A;  3A4I A;  1LQL A;  4NDN A;  5JRH A;  4B3T C;  2DPL A;  3E7W A;  4IZ6 A;  1O90 A;  1MXC A;  2QVY X;  1XRA A;  3LUS A;  1XNR C;  1XMQ C;  4DR2 C;  2KZF A;  3TUF A;  2E8F A;  5IT9 D;  1P7L A;  4DUZ C;  1K0R A;  2UUA C;  1MXB A;  2F4V C;  4PZP A;  1PG3 A;  5KYV A;  2UXC C;  5K8F A;  1HNZ C;  2CY1 A;  5BST A;  1HNX C;  4L2Z A;  1J5E C;  1N2F A;  4K0B A;  1O9T A;  3L8C A;  1GPM A;  5K85 A;  1JOS A;  4ZJZ A;  4EAT A;  4BSZ A;  3DLP X;  5KEI A;  5LMU C;  2Y4N A;  4JV5 C;  1RY2 A;  2UXB C;  4OX9 C;  1XRC A;  2ATW A;  3E7X A;  3ETC A;  1HH2 P;  3AF6 A;  3NYQ A;  4AQY C;  4B3S C;  2VQE C;  3UZ0 A;  4R0M A;  3B7W A;  4LF8 C;  1MD9 A;  2VSQ A;  5DV9 A;  5A19 A;  4G37 A;  4RVN A;  1XRB A;  2UXD C;  1YJ7 A;  3IPL A;  3VNS A;  2UU9 C;  3C5E A;  3T1H C;  1USP A;  2OO4 A;  1ZB9 A;  1USP B;  1IBK C;  5E7Q A;  1MXA A;  4NOZ A;  1KKG A;  4KTT A;  3A9V A;  1N32 C;  4GKK C;  2PN2 A;  4JM1 A;  4BC9 A;  4DR6 C;  4ODJ A;  4DR3 C;  3PRO C;  2YCB A;  4KTV A;  4RLQ A;  2WD9 A;  4DCT A;  4NXN C;  2EGT A;  4L4Q A;  2P2B A;  2P20 A;  2BJO A;  4X64 C;  4DCU A;  1N34 C;  4R1L A;  3J81 D;  2ZM6 C;  4D4I A;  4MH4 A;  3IML A;  4U5Y D;  2Y27 A;  5H9U A;  1V26 A;  4GS5 A;  4PRO C;  5BSV A;  1HR0 C;  1LCI A;  3NPD A;  5BUQ A;  2P2J A;  5GTD A;  4RLF A;  4JI5 C;  1FJG C;  1WH9 A;  3PES A;  4GXQ A;  3N2Q A;  4GXR A;  5AE3 A;  3KXW A;  2HJG A;  2UUB C;  1ML8 A;  3IEU A;  3NI2 A;  2ONF A;  4BBY A;  2PT7 G;  4RM2 A;  5IWA C;  5A2Q D;  2CXC A;  3H2T A;  1RG9 A;  3R9X A;  4XX2 A;  5FLX D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...