1XRBA

S-adenosylmethionine synthetase (mat, atp: l-methionine s-adenosyltransferase, e.c.2.5.1.6) in which met residues are replaced with selenomethionine residues (mse)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule tags Transferase
total genus 119
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xrbA02
5A19A 2YWBA 3SO4A 2DPLA 4KTTA 5T8SA 5H9UA 1O92A 3TDEA 1GPMA 1O90A 1XRCA 1RG9A 3RV2A 5A1GA 4HPVA 5A1IA 1XRBA 4KTVA 4NDNA 2YWCA 3UOWA 1MXBA 1FUGA 3TQIA 1O93A 2OBVA 1MXCA 1XRAA 1O9TA 1MXAA 4L4QA 4WS9A 5T8TA 4LE5A 1P7LA 4L2ZA 3A4IA 4L7IA 1QM4A 3IMLA 4ODJA 2P02A 3S82A 4K0BA
chains in the Genus database with same CATH superfamily
1HNWC 4IZ6A 3CQ3A 3CW9A 4U5YD 2Y4OA 4WV3A 3T1YC 4JYAC 4RVOA 3R44A 4RLFA 4NDNA 5AE3A 2CY1A 1AMUA 1ULTA 4LF8C 4DV3C 4L2ZA 3IMLA 4R0MA 1USPA 2VQEC 5BSUA 5A19A 2M5HA 5T8SA 3IEVA 4BSZA 3PBKA 1XRCA 3VNQA 2CXCA 3DAYA 2HHHC 4NXNC 1ZB9A 4PUGA 5CZXA 1O93A 4RLQA 1XRAA 1M6XA 1MD9A 3L8CA 1P7LA 3A4IA 4GXQA 1ZB8A 4DV5C 4JI3C 2YWBA 4LFAC 5KYTA 3AF5A 4PZPA 5H9UA 4BC7A 2VQFC 4DCUA 2MM9A 1HH2P 1L2FA 4BBYA 4HPVA 4DV2C 3UOWA 1MXAA 4DR4C 4LFBC 3C5EA 4JI2C 5LMUC 5K85A 3OTOC 3CJEA 3LAXA 4DR7C 4DR2C 2ONFA 1HNZC 5BSMA 4DV0C 1QWIA 4NXMC 1XS3A 2PN2A 2OPLA 2QW0X 3NPDA 4ZLPA 4JV5C 2D1SA 4JI6C 2WD9A 1BA3A 5DV9A 2UU9C 4FTFA 1FLOA 2E5LC 2Y4NA 4TPSB 1MKYA 3DHVA 4LF5C 5BSWA 5T8TA 2AYAA 5BSVA 3EQ6A 4DCTA 3LUSA 2D27A 4EATA 4OX9C 1N34C 1UWDA 3R9WA 3CQ1A 3AF6A 2KZ0A 2YCBA 3IEUA 3G7SA 4BCAA 2XR1A 5IWAC 4DR3C 5KYVA 3I07A 1T5HX 4FUTA 1HR0C 5CZVA 1TH5A 3E7XA 4JI8C 4LF4C 4PHTA 1YJ7A 4B3MC 4YY3C 1XHJA 2HJGA 1N32C 1XMOC 2QVXX 5BUQA 5FLXD 3TDEA 1IBLC 2DHMA 2NCLA 3ETOA 1PG4A 2E8FA 2P20A 4LF9C 2ATWA 1O9TA 4FUQA 4B3SC 5BSTA 3NYQA 2M5OA 2D1TA 1XMQC 4RM2A 2P2JA 4K0BA 3AY0A 2MMAB 5K8FA 3GKUA 4LF6C 4X62C 4IR7A 1V60A 3A9UA 3RV2A 5A1GA 1M6XC 5A1IA 4KTVA 3FCCA 4RVNA 2BJOA 2QVYX 2BH1X 2EGTA 2F4VC 2P2MA 3LNVA 2P02A 2CU6A 3UZ0A 1RY2A 3L95X 3SO4A 2D1QA 2UXCC 4D57A 1RG9A 1WF3A 4I9FA 4DUZC 2D7VA 4JI1C 3A25A 1K0RA 2ZZMA 5KEIA 4DV4C 3JAMD 3TQIA 4DR5C 1HNXC 2MCQA 2P2QA 2VZEA 3N54B 2WP0C 4PUHA 4L7IA 4MH4A 4R1MA 1IBMC 1MDFA 2DPLA 4ISBA 1N33C 2JMPA 2QVZX 1VEHA 4D4GA 4JI5C 3K6RA 2YWCA 2Z51A 1XNRC 4XX2A 1P4EA 1LQLA 4MTNA 2D28C 4DV6C 3EERA 1T5DX 5BURA 1VLAA 3GR1A 2E8CA 3A9VA 5BUSA 2UXBC 2E7GA 1PA4A 4GS5A 5BSRA 4X64C 4G36A 1MXCA 4D4IA 3J80D 1LCIA 1N36C 5GTDA 1I94C 1IB8A 4LE5A 2UUAC 3E7WA 4OXIA 5AE2A 3PESA 5AE1A 3J81D 2ZM6C 2PT7G 2KDNA 4G37A 1UKKA 4DR6C 3N2QA 3H2TA 2E0GA 1NYEA 3UX2A 4DUYC 3DLPX 2D1RA 3ETCA 2P2BA 4KHPC 4ODJA 2DYJA 4GKKC 1ML8A 2E8EA 2OO4A 4DV1C 4R1LA 3UEBA 4DCVA 4DG9A 5LMNC 2ZZNA 3NYRA 2OBVA 5LCIA 5JRHA 1USPB 3LGXA 4JM1A 4BC9A 5IT9D 3VNRA 4DR1C 2QL8A 3IPLA 5A2QD 2UXDC 2UUBC 1QM4A 4X65C 1J5EC 3KXWA 4LFCC 4G1IA 4PROC 4PUIA 4GXRA 2V7BA 1GPMA 3B7WA 4LF7C 3CQ2A 4OYCA 4RMNA 4X66C 1FJGC 1PU1A 3UX3A 1FUGA 3GR0A 4YHHC 4RM3A 4JI4C 3S82A 5BR8C 4JI7C 4B3TC 4ZJZA 1WH9A 2P2FA 3PROC 1O92A 1XNQC 1NY8A 1V25A 3VNSA 2JNVA 4I9GA 3GPCA 4B3RC 1V26A 2ASBA 1MXBA 4JI0C 2UUCC 4K0KC 4NOZA 3CW8X 2KZFA 1N2FA 1EGAA 1WCJA 2YX1A 3RG2A 3NI2A 4D56A 4KTTA 3TUFA 3FCEA 5IFIA 1O90A 1MDBA 1PG3A 4DCSA 3R9XA 3TR3A 3O2EA 1IBKC 3A26A 5ADZA 2Y27A 1JOSA 1XRBA 2OPLB 4DG8A 4AQYC 4GKJC 3T1HC 1P4EC 3LNOA 4L4QA 4WS9A 4DV7C 2PROA 5E7QA 1KKGA 3I08A 2VSQA
chains in the Genus database with same CATH topology
1HNWC 4IZ6A 3CW9A 4U5YD 2Y4OA 4WV3A 3T1YC 4JYAC 4RVOA 3R44A 4RLFA 4NDNA 5AE3A 2CY1A 1AMUA 1ULTA 4LF8C 4DV3C 4L2ZA 3IMLA 4R0MA 1USPA 2VQEC 5BSUA 5A19A 5T8SA 3IEVA 4BSZA 3PBKA 1XRCA 3VNQA 2CXCA 3DAYA 2HHHC 4NXNC 1ZB9A 5CZXA 1O93A 4RLQA 1XRAA 1MD9A 3L8CA 1P7LA 3A4IA 4GXQA 1ZB8A 4DV5C 4JI3C 2YWBA 4LFAC 5KYTA 3AF5A 4PZPA 5H9UA 4BC7A 2VQFC 4DCUA 1HH2P 1L2FA 4BBYA 4HPVA 4DV2C 3UOWA 1MXAA 4DR4C 4LFBC 3C5EA 4JI2C 5LMUC 5K85A 3OTOC 3CJEA 3LAXA 4DR7C 4DR2C 2ONFA 1HNZC 5BSMA 4DV0C 1QWIA 4NXMC 2PN2A 2OPLA 2QW0X 3NPDA 4ZLPA 4JV5C 2D1SA 4JI6C 2WD9A 1BA3A 5DV9A 2UU9C 4FTFA 2E5LC 2Y4NA 4TPSB 1MKYA 3DHVA 4LF5C 5BSWA 5T8TA 2AYAA 5BSVA 3EQ6A 4DCTA 3LUSA 2D27A 4EATA 4OX9C 1N34C 3R9WA 3AF6A 2YCBA 3IEUA 3G7SA 4BCAA 2XR1A 5IWAC 4DR3C 5KYVA 3I07A 1T5HX 4FUTA 1HR0C 5CZVA 3E7XA 4JI8C 4LF4C 4PHTA 1YJ7A 4B3MC 4YY3C 2HJGA 1N32C 1XMOC 2QVXX 5BUQA 5FLXD 3TDEA 1IBLC 3ETOA 1PG4A 2E8FA 2P20A 4LF9C 2ATWA 1O9TA 4FUQA 4B3SC 5BSTA 3NYQA 2D1TA 1XMQC 4RM2A 2P2JA 4K0BA 5K8FA 3GKUA 4LF6C 4X62C 4IR7A 3A9UA 3RV2A 5A1GA 5A1IA 4KTVA 3FCCA 4RVNA 2BJOA 2QVYX 2BH1X 2EGTA 2F4VC 2P2MA 3LNVA 2P02A 3UZ0A 1RY2A 3L95X 3SO4A 2D1QA 2UXCC 4D57A 1RG9A 1WF3A 4I9FA 4DUZC 2D7VA 4JI1C 1K0RA 5KEIA 4DV4C 3JAMD 3TQIA 4DR5C 1HNXC 2P2QA 2VZEA 3N54B 2WP0C 4L7IA 4MH4A 4R1MA 1IBMC 1MDFA 2DPLA 4ISBA 1N33C 2JMPA 2QVZX 4D4GA 4JI5C 2YWCA 1XNRC 4XX2A 1LQLA 4MTNA 2D28C 4DV6C 3EERA 1T5DX 5BURA 1VLAA 3GR1A 2E8CA 3A9VA 5BUSA 2UXBC 2E7GA 1PA4A 4GS5A 5BSRA 4X64C 4G36A 1MXCA 4D4IA 3J80D 1LCIA 1N36C 5GTDA 1I94C 4LE5A 2UUAC 3E7WA 4OXIA 5AE2A 3PESA 5AE1A 3J81D 2ZM6C 2PT7G 4G37A 1UKKA 4DR6C 3N2QA 3H2TA 2E0GA 1NYEA 4DUYC 3DLPX 2D1RA 3ETCA 2P2BA 4KHPC 4ODJA 2DYJA 4GKKC 1ML8A 2E8EA 2OO4A 4DV1C 4R1LA 4DCVA 4DG9A 5LMNC 3NYRA 2OBVA 5JRHA 1USPB 3LGXA 4JM1A 5IT9D 4BC9A 3VNRA 4DR1C 2QL8A 3IPLA 5A2QD 2UXDC 2UUBC 1QM4A 4X65C 1J5EC 3KXWA 4LFCC 4G1IA 4PROC 4GXRA 2V7BA 1GPMA 3B7WA 4LF7C 4OYCA 4RMNA 4X66C 1FJGC 1FUGA 3GR0A 4YHHC 4RM3A 4JI4C 3S82A 5BR8C 4JI7C 4B3TC 4ZJZA 1WH9A 2P2FA 3PROC 1O92A 1XNQC 1V25A 3VNSA 4I9GA 3GPCA 4B3RC 1V26A 2ASBA 1MXBA 4JI0C 2UUCC 4K0KC 4NOZA 3CW8X 2KZFA 1N2FA 1EGAA 3RG2A 3NI2A 4D56A 4KTTA 3TUFA 3FCEA 5IFIA 1O90A 1MDBA 1PG3A 4DCSA 3R9XA 1IBKC 5ADZA 2Y27A 1JOSA 1XRBA 2OPLB 4DG8A 4AQYC 4GKJC 3T1HC 4L4QA 4WS9A 4DV7C 2PROA 5E7QA 1KKGA 3I08A 2VSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A19 A;  2YWB A;  3SO4 A;  2DPL A;  4KTT A;  5T8S A;  5H9U A;  1O92 A;  3TDE A;  1GPM A;  1O90 A;  1XRC A;  1RG9 A;  3RV2 A;  5A1G A;  4HPV A;  5A1I A;  1XRB A;  4KTV A;  4NDN A;  2YWC A;  3UOW A;  1MXB A;  1FUG A;  3TQI A;  1O93 A;  2OBV A;  1MXC A;  1XRA A;  1O9T A;  1MXA A;  4L4Q A;  4WS9 A;  5T8T A;  4LE5 A;  1P7L A;  4L2Z A;  3A4I A;  4L7I A;  1QM4 A;  3IML A;  4ODJ A;  2P02 A;  3S82 A;  4K0B A; 
#chains in the Genus database with same CATH topology
 1HNW C;  4IZ6 A;  3CQ3 A;  3CW9 A;  4U5Y D;  2Y4O A;  4WV3 A;  3T1Y C;  4JYA C;  4RVO A;  3R44 A;  4RLF A;  4NDN A;  5AE3 A;  2CY1 A;  1AMU A;  1ULT A;  4LF8 C;  4DV3 C;  4L2Z A;  3IML A;  4R0M A;  1USP A;  2VQE C;  5BSU A;  5A19 A;  2M5H A;  5T8S A;  3IEV A;  4BSZ A;  3PBK A;  1XRC A;  3VNQ A;  2CXC A;  3DAY A;  2HHH C;  4NXN C;  1ZB9 A;  4PUG A;  5CZX A;  1O93 A;  4RLQ A;  1XRA A;  1M6X A;  1MD9 A;  3L8C A;  1P7L A;  3A4I A;  4GXQ A;  1ZB8 A;  4DV5 C;  4JI3 C;  2YWB A;  4LFA C;  5KYT A;  3AF5 A;  4PZP A;  5H9U A;  4BC7 A;  2VQF C;  4DCU A;  2MM9 A;  1HH2 P;  1L2F A;  4BBY A;  4HPV A;  4DV2 C;  3UOW A;  1MXA A;  4DR4 C;  4LFB C;  3C5E A;  4JI2 C;  5LMU C;  5K85 A;  3OTO C;  3CJE A;  3LAX A;  4DR7 C;  4DR2 C;  2ONF A;  1HNZ C;  5BSM A;  4DV0 C;  1QWI A;  4NXM C;  1XS3 A;  2PN2 A;  2OPL A;  2QW0 X;  3NPD A;  4ZLP A;  4JV5 C;  2D1S A;  4JI6 C;  2WD9 A;  1BA3 A;  5DV9 A;  2UU9 C;  4FTF A;  1FLO A;  2E5L C;  2Y4N A;  4TPS B;  1MKY A;  3DHV A;  4LF5 C;  5BSW A;  5T8T A;  2AYA A;  5BSV A;  3EQ6 A;  4DCT A;  3LUS A;  2D27 A;  4EAT A;  4OX9 C;  1N34 C;  1UWD A;  3R9W A;  3CQ1 A;  3AF6 A;  2KZ0 A;  2YCB A;  3IEU A;  3G7S A;  4BCA A;  2XR1 A;  5IWA C;  4DR3 C;  5KYV A;  3I07 A;  1T5H X;  4FUT A;  1HR0 C;  5CZV A;  1TH5 A;  3E7X A;  4JI8 C;  4LF4 C;  4PHT A;  1YJ7 A;  4B3M C;  4YY3 C;  1XHJ A;  2HJG A;  1N32 C;  1XMO C;  2QVX X;  5BUQ A;  5FLX D;  3TDE A;  1IBL C;  2DHM A;  2NCL A;  3ETO A;  1PG4 A;  2E8F A;  2P20 A;  4LF9 C;  2ATW A;  1O9T A;  4FUQ A;  4B3S C;  5BST A;  3NYQ A;  2M5O A;  2D1T A;  1XMQ C;  4RM2 A;  2P2J A;  4K0B A;  3AY0 A;  2MMA B;  5K8F A;  3GKU A;  4LF6 C;  4X62 C;  4IR7 A;  1V60 A;  3A9U A;  3RV2 A;  5A1G A;  1M6X C;  5A1I A;  4KTV A;  3FCC A;  4RVN A;  2BJO A;  2QVY X;  2BH1 X;  2EGT A;  2F4V C;  2P2M A;  3LNV A;  2P02 A;  2CU6 A;  3UZ0 A;  1RY2 A;  3L95 X;  3SO4 A;  2D1Q A;  2UXC C;  4D57 A;  1RG9 A;  1WF3 A;  4I9F A;  4DUZ C;  2D7V A;  4JI1 C;  3A25 A;  1K0R A;  2ZZM A;  5KEI A;  4DV4 C;  3JAM D;  3TQI A;  4DR5 C;  1HNX C;  2MCQ A;  2P2Q A;  2VZE A;  3N54 B;  2WP0 C;  4PUH A;  4L7I A;  4MH4 A;  4R1M A;  1IBM C;  1MDF A;  2DPL A;  4ISB A;  1N33 C;  2JMP A;  2QVZ X;  1VEH A;  4D4G A;  4JI5 C;  3K6R A;  2YWC A;  2Z51 A;  1XNR C;  4XX2 A;  1P4E A;  1LQL A;  4MTN A;  2D28 C;  4DV6 C;  3EER A;  1T5D X;  5BUR A;  1VLA A;  3GR1 A;  2E8C A;  3A9V A;  5BUS A;  2UXB C;  2E7G A;  1PA4 A;  4GS5 A;  5BSR A;  4X64 C;  4G36 A;  1MXC A;  4D4I A;  3J80 D;  1LCI A;  1N36 C;  5GTD A;  1I94 C;  1IB8 A;  4LE5 A;  2UUA C;  3E7W A;  4OXI A;  5AE2 A;  3PES A;  5AE1 A;  3J81 D;  2ZM6 C;  2PT7 G;  2KDN A;  4G37 A;  1UKK A;  4DR6 C;  3N2Q A;  3H2T A;  2E0G A;  1NYE A;  3UX2 A;  4DUY C;  3DLP X;  2D1R A;  3ETC A;  2P2B A;  4KHP C;  4ODJ A;  2DYJ A;  4GKK C;  1ML8 A;  2E8E A;  2OO4 A;  4DV1 C;  4R1L A;  3UEB A;  4DCV A;  4DG9 A;  5LMN C;  2ZZN A;  3NYR A;  2OBV A;  5LCI A;  5JRH A;  1USP B;  3LGX A;  4JM1 A;  4BC9 A;  5IT9 D;  3VNR A;  4DR1 C;  2QL8 A;  3IPL A;  5A2Q D;  2UXD C;  2UUB C;  1QM4 A;  4X65 C;  1J5E C;  3KXW A;  4LFC C;  4G1I A;  4PRO C;  4PUI A;  4GXR A;  2V7B A;  1GPM A;  3B7W A;  4LF7 C;  3CQ2 A;  4OYC A;  4RMN A;  4X66 C;  1FJG C;  1PU1 A;  3UX3 A;  1FUG A;  3GR0 A;  4YHH C;  4RM3 A;  4JI4 C;  3S82 A;  5BR8 C;  4JI7 C;  4B3T C;  4ZJZ A;  1WH9 A;  2P2F A;  3PRO C;  1O92 A;  1XNQ C;  1NY8 A;  1V25 A;  3VNS A;  2JNV A;  4I9G A;  3GPC A;  4B3R C;  1V26 A;  2ASB A;  1MXB A;  4JI0 C;  2UUC C;  4K0K C;  4NOZ A;  3CW8 X;  2KZF A;  1N2F A;  1EGA A;  1WCJ A;  2YX1 A;  3RG2 A;  3NI2 A;  4D56 A;  4KTT A;  3TUF A;  3FCE A;  5IFI A;  1O90 A;  1MDB A;  1PG3 A;  4DCS A;  3R9X A;  3TR3 A;  3O2E A;  1IBK C;  3A26 A;  5ADZ A;  2Y27 A;  1JOS A;  1XRB A;  2OPL B;  4DG8 A;  4AQY C;  4GKJ C;  3T1H C;  1P4E C;  3LNO A;  4L4Q A;  4WS9 A;  4DV7 C;  2PRO A;  5E7Q A;  1KKG A;  3I08 A;  2VSQ A; 
#chains in the Genus database with same CATH homology
 1HNW C;  4IZ6 A;  3CW9 A;  4U5Y D;  2Y4O A;  4WV3 A;  3T1Y C;  4JYA C;  4RVO A;  3R44 A;  4RLF A;  4NDN A;  5AE3 A;  2CY1 A;  1AMU A;  1ULT A;  4LF8 C;  4DV3 C;  4L2Z A;  3IML A;  4R0M A;  1USP A;  2VQE C;  5BSU A;  5A19 A;  5T8S A;  3IEV A;  4BSZ A;  3PBK A;  1XRC A;  3VNQ A;  2CXC A;  3DAY A;  2HHH C;  4NXN C;  1ZB9 A;  5CZX A;  1O93 A;  4RLQ A;  1XRA A;  1MD9 A;  3L8C A;  1P7L A;  3A4I A;  4GXQ A;  1ZB8 A;  4DV5 C;  4JI3 C;  2YWB A;  4LFA C;  5KYT A;  3AF5 A;  4PZP A;  5H9U A;  4BC7 A;  2VQF C;  4DCU A;  1HH2 P;  1L2F A;  4BBY A;  4HPV A;  4DV2 C;  3UOW A;  1MXA A;  4DR4 C;  4LFB C;  3C5E A;  4JI2 C;  5LMU C;  5K85 A;  3OTO C;  3CJE A;  3LAX A;  4DR7 C;  4DR2 C;  2ONF A;  1HNZ C;  5BSM A;  4DV0 C;  1QWI A;  4NXM C;  2PN2 A;  2OPL A;  2QW0 X;  3NPD A;  4ZLP A;  4JV5 C;  2D1S A;  4JI6 C;  2WD9 A;  1BA3 A;  5DV9 A;  2UU9 C;  4FTF A;  2E5L C;  2Y4N A;  4TPS B;  1MKY A;  3DHV A;  4LF5 C;  5BSW A;  5T8T A;  2AYA A;  5BSV A;  3EQ6 A;  4DCT A;  3LUS A;  2D27 A;  4EAT A;  4OX9 C;  1N34 C;  3R9W A;  3AF6 A;  2YCB A;  3IEU A;  3G7S A;  4BCA A;  2XR1 A;  5IWA C;  4DR3 C;  5KYV A;  3I07 A;  1T5H X;  4FUT A;  1HR0 C;  5CZV A;  3E7X A;  4JI8 C;  4LF4 C;  4PHT A;  1YJ7 A;  4B3M C;  4YY3 C;  2HJG A;  1N32 C;  1XMO C;  2QVX X;  5BUQ A;  5FLX D;  3TDE A;  1IBL C;  3ETO A;  1PG4 A;  2E8F A;  2P20 A;  4LF9 C;  2ATW A;  1O9T A;  4FUQ A;  4B3S C;  5BST A;  3NYQ A;  2D1T A;  1XMQ C;  4RM2 A;  2P2J A;  4K0B A;  5K8F A;  3GKU A;  4LF6 C;  4X62 C;  4IR7 A;  3A9U A;  3RV2 A;  5A1G A;  5A1I A;  4KTV A;  3FCC A;  4RVN A;  2BJO A;  2QVY X;  2BH1 X;  2EGT A;  2F4V C;  2P2M A;  3LNV A;  2P02 A;  3UZ0 A;  1RY2 A;  3L95 X;  3SO4 A;  2D1Q A;  2UXC C;  4D57 A;  1RG9 A;  1WF3 A;  4I9F A;  4DUZ C;  2D7V A;  4JI1 C;  1K0R A;  5KEI A;  4DV4 C;  3JAM D;  3TQI A;  4DR5 C;  1HNX C;  2P2Q A;  2VZE A;  3N54 B;  2WP0 C;  4L7I A;  4MH4 A;  4R1M A;  1IBM C;  1MDF A;  2DPL A;  4ISB A;  1N33 C;  2JMP A;  2QVZ X;  4D4G A;  4JI5 C;  2YWC A;  1XNR C;  4XX2 A;  1LQL A;  4MTN A;  2D28 C;  4DV6 C;  3EER A;  1T5D X;  5BUR A;  1VLA A;  3GR1 A;  2E8C A;  3A9V A;  5BUS A;  2UXB C;  2E7G A;  1PA4 A;  4GS5 A;  5BSR A;  4X64 C;  4G36 A;  1MXC A;  4D4I A;  3J80 D;  1LCI A;  1N36 C;  5GTD A;  1I94 C;  4LE5 A;  2UUA C;  3E7W A;  4OXI A;  5AE2 A;  3PES A;  5AE1 A;  3J81 D;  2ZM6 C;  2PT7 G;  4G37 A;  1UKK A;  4DR6 C;  3N2Q A;  3H2T A;  2E0G A;  1NYE A;  4DUY C;  3DLP X;  2D1R A;  3ETC A;  2P2B A;  4KHP C;  4ODJ A;  2DYJ A;  4GKK C;  1ML8 A;  2E8E A;  2OO4 A;  4DV1 C;  4R1L A;  4DCV A;  4DG9 A;  5LMN C;  3NYR A;  2OBV A;  5JRH A;  1USP B;  3LGX A;  4JM1 A;  5IT9 D;  4BC9 A;  3VNR A;  4DR1 C;  2QL8 A;  3IPL A;  5A2Q D;  2UXD C;  2UUB C;  1QM4 A;  4X65 C;  1J5E C;  3KXW A;  4LFC C;  4G1I A;  4PRO C;  4GXR A;  2V7B A;  1GPM A;  3B7W A;  4LF7 C;  4OYC A;  4RMN A;  4X66 C;  1FJG C;  1FUG A;  3GR0 A;  4YHH C;  4RM3 A;  4JI4 C;  3S82 A;  5BR8 C;  4JI7 C;  4B3T C;  4ZJZ A;  1WH9 A;  2P2F A;  3PRO C;  1O92 A;  1XNQ C;  1V25 A;  3VNS A;  4I9G A;  3GPC A;  4B3R C;  1V26 A;  2ASB A;  1MXB A;  4JI0 C;  2UUC C;  4K0K C;  4NOZ A;  3CW8 X;  2KZF A;  1N2F A;  1EGA A;  3RG2 A;  3NI2 A;  4D56 A;  4KTT A;  3TUF A;  3FCE A;  5IFI A;  1O90 A;  1MDB A;  1PG3 A;  4DCS A;  3R9X A;  1IBK C;  5ADZ A;  2Y27 A;  1JOS A;  1XRB A;  2OPL B;  4DG8 A;  4AQY C;  4GKJ C;  3T1H C;  4L4Q A;  4WS9 A;  4DV7 C;  2PRO A;  5E7Q A;  1KKG A;  3I08 A;  2VSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...