2JNVA

Solution structure of c-terminal domain of nifu-like protein from oryza sativa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
b'MGLPLTAGNVESVLDQVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKIPDVAAVEPVTDKETG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NifU-like protein 1, chloroplast
publication title The cooperative role of OsCnfU-1A domain I and domain II in the iron sulphur cluster transfer process as revealed by NMR
pubmed doi rcsb
source organism Oryza sativa
molecule tags Metal transport
total genus 12
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2jnvA00
1UWDA 1XHJA 1VEHA 2M5OA 2Z51A 2M5HA 1WCJA 3LNOA 1TH5A 3UX2A 3CQ1A 2CU6A 3CQ2A 3UX3A 3CQ3A 2JNVA
chains in the Genus database with same CATH superfamily
4EATA 5LMNC 1ML8A 1V26A 4OX9C 2HHHC 3EERA 4D56A 3LNVA 1T5HX 4L7IA 4PROC 1HNZC 4RLQA 4X64C 2VQEC 5BSTA 5JRHA 4DV6C 1N32C 1P7LA 4FUTA 4DG8A 3E7WA 2JNVA 1MDBA 4GKKC 4AQYC 4L4QA 4LF4C 4LFBC 3J80D 1AMUA 3GPCA 2P2QA 3IEUA 3CQ1A 2VZEA 4NOZA 5BSUA 3K6RA 4PZPA 2Y4NA 2D27A 4IZ6A 3FCCA 2UUBC 4DV5C 4D57A 1MKYA 4KTTA 1MXCA 1XMOC 2V7BA 3UOWA 3N2QA 1IBKC 4LFAC 4I9FA 4DR1C 3IPLA 4IR7A 2Y4OA 5CZXA 2M5HA 4DUYC 3NI2A 5BSWA 3LNOA 3LUSA 4I9GA 3GR1A 4PHTA 3L8CA 4B3SC 4JI0C 2Z51A 2WD9A 1WF3A 1FJGC 1N2FA 3PBKA 2E8EA 2CY1A 1UWDA 1WH9A 4DCVA 3G7SA 1RG9A 3A9VA 5KEIA 5T8TA 4DR4C 4GKJC 1JOSA 2P2MA 4ISBA 2P02A 5IT9D 2KZ0A 3A4IA 5CZVA 1XRCA 4RVNA 2D7VA 4ODJA 2KZFA 5A2QD 2UXBC 2UU9C 4MH4A 1KKGA 1LCIA 5GTDA 2XR1A 3IEVA 4NXNC 3ETOA 1XMQC 3LGXA 3PESA 2ZM6C 4RM2A 4FTFA 2P2FA 4LF6C 1UKKA 2UUAC 1QM4A 4B3RC 2Y27A 3L95X 3I08A 4U5YD 3UZ0A 3UX3A 4DR2C 1RY2A 2AYAA 4DV0C 4OXIA 1FUGA 1N36C 2YWBA 2CXCA 1TH5A 1V25A 2HJGA 2EGTA 1ZB9A 2QVZX 2QW0X 1ZB8A 4JI8C 4L2ZA 3NYQA 4BSZA 5A19A 3CJEA 4DCTA 4R1LA 2NCLA 4X66C 2QL8A 5BURA 3UX2A 2E5LC 5AE1A 4ZLPA 5K8FA 2P2JA 4DV2C 4NDNA 1O9TA 2D1QA 5BUSA 4KTVA 2QVYX 4RMNA 2ZZNA 4DR3C 4JI3C 4DV3C 3T1HC 4D4IA 2UXCC 1NY8A 3UEBA 5K85A 4GXRA 3R9WA 4LF9C 2KDNA 1IB8A 4WS9A 3E7XA 5KYVA 1NYEA 3GKUA 5IWAC 2E8FA 4BC7A 4GXQA 5LMUC 1VEHA 4YY3C 2UUCC 1T5DX 4JI6C 2ATWA 2D1TA 4PUHA 1PG4A 4GS5A 2D28C 3DAYA 4R1MA 3RV2A 3O2EA 4DCSA 4JI7C 1GPMA 4DR7C 3PROC 5T8SA 4LFCC 3A25A 3R44A 2BH1X 1PA4A 1P4EC 1XNQC 1YJ7A 2D1SA 1FLOA 5H9UA 1J5EC 3C5EA 2OPLA 1MXAA 1P4EA 3CQ3A 2UXDC 1HNXC 1QWIA 4TPSB 4B3TC 4KHPC 2MMAB 4DR5C 4BC9A 4JYAC 3CQ2A 4DUZC 4RVOA 3GR0A 1HR0C 2OPLB 1PG3A 4DV7C 5LCIA 3VNRA 2E7GA 4ZJZA 3EQ6A 1WCJA 1L2FA 1O93A 5AE2A 2WP0C 3H2TA 2DYJA 5FLXD 4LF8C 4XX2A 4G37A 3LAXA 2PT7G 1ULTA 4WV3A 4DCUA 3B7WA 5BSRA 5BR8C 3S82A 3TR3A 4BBYA 4K0KC 1PU1A 3T1YC 5BSMA 3RG2A 1XS3A 3DLPX 3IMLA 3VNQA 4BCAA 3SO4A 2E0GA 2YWCA 5BSVA 1XRAA 4D4GA 4B3MC 2BJOA 1V60A 1XNRC 2MM9A 3OTOC 1XHJA 5IFIA 3A26A 4RLFA 3R9XA 2ONFA 4JI2C 4R0MA 2DHMA 3FCEA 5DV9A 2VSQA 3VNSA 5ADZA 3NYRA 4G1IA 3TQIA 1VLAA 1BA3A 2F4VC 4MTNA 4LE5A 3ETCA 5E7QA 4JI5C 3TDEA 4K0BA 1HH2P 1MXBA 1O92A 3AY0A 2JMPA 4JI4C 3AF5A 2P20A 1EGAA 3A9UA 5A1IA 2YX1A 2ZZMA 4LF7C 4RM3A 1MDFA 2ASBA 2P2BA 3KXWA 4OYCA 1M6XC 2PROA 3NPDA 5A1GA 4PUIA 3CW9A 2DPLA 4DV1C 2D1RA 4NXMC 4PUGA 1LQLA 2E8CA 4DG9A 1M6XA 1HNWC 4JV5C 3J81D 2M5OA 2OBVA 5AE3A 4HPVA 2OO4A 3I07A 2CU6A 1K0RA 1IBLC 4X65C 4JM1A 4X62C 5KYTA 2MCQA 3CW8X 1N34C 1IBMC 1XRBA 1USPA 3JAMD 1MD9A 3N54B 4LF5C 4G36A 2VQFC 4DR6C 4YHHC 3AF6A 1I94C 2QVXX 1N33C 2YCBA 2PN2A 3DHVA 5BUQA 4FUQA 1USPB 1O90A 3TUFA 4JI1C 4DV4C
chains in the Genus database with same CATH topology
1UWDA 1XHJA 1VEHA 2M5OA 2Z51A 2M5HA 1WCJA 3LNOA 1TH5A 3UX2A 3CQ1A 2CU6A 3CQ2A 3UX3A 3CQ3A 2JNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWD A;  1XHJ A;  1VEH A;  2M5O A;  2Z51 A;  2M5H A;  1WCJ A;  3LNO A;  1TH5 A;  3UX2 A;  3CQ1 A;  2CU6 A;  3CQ2 A;  3UX3 A;  3CQ3 A;  2JNV A; 
#chains in the Genus database with same CATH topology
 4EAT A;  5LMN C;  1ML8 A;  1V26 A;  4OX9 C;  2HHH C;  3EER A;  4D56 A;  3LNV A;  1T5H X;  4L7I A;  4PRO C;  1HNZ C;  4RLQ A;  4X64 C;  2VQE C;  5BST A;  5JRH A;  4DV6 C;  1N32 C;  1P7L A;  4FUT A;  4DG8 A;  3E7W A;  2JNV A;  1MDB A;  4GKK C;  4AQY C;  4L4Q A;  4LF4 C;  4LFB C;  3J80 D;  1AMU A;  3GPC A;  2P2Q A;  3IEU A;  3CQ1 A;  2VZE A;  4NOZ A;  5BSU A;  3K6R A;  4PZP A;  2Y4N A;  2D27 A;  4IZ6 A;  3FCC A;  2UUB C;  4DV5 C;  4D57 A;  1MKY A;  4KTT A;  1MXC A;  1XMO C;  2V7B A;  3UOW A;  3N2Q A;  1IBK C;  4LFA C;  4I9F A;  4DR1 C;  3IPL A;  4IR7 A;  2Y4O A;  5CZX A;  2M5H A;  4DUY C;  3NI2 A;  5BSW A;  3LNO A;  3LUS A;  4I9G A;  3GR1 A;  4PHT A;  3L8C A;  4B3S C;  4JI0 C;  2Z51 A;  2WD9 A;  1WF3 A;  1FJG C;  1N2F A;  3PBK A;  2E8E A;  2CY1 A;  1UWD A;  1WH9 A;  4DCV A;  3G7S A;  1RG9 A;  3A9V A;  5KEI A;  5T8T A;  4DR4 C;  4GKJ C;  1JOS A;  2P2M A;  4ISB A;  2P02 A;  5IT9 D;  2KZ0 A;  3A4I A;  5CZV A;  1XRC A;  4RVN A;  2D7V A;  4ODJ A;  2KZF A;  5A2Q D;  2UXB C;  2UU9 C;  4MH4 A;  1KKG A;  1LCI A;  5GTD A;  2XR1 A;  3IEV A;  4NXN C;  3ETO A;  1XMQ C;  3LGX A;  3PES A;  2ZM6 C;  4RM2 A;  4FTF A;  2P2F A;  4LF6 C;  1UKK A;  2UUA C;  1QM4 A;  4B3R C;  2Y27 A;  3L95 X;  3I08 A;  4U5Y D;  3UZ0 A;  3UX3 A;  4DR2 C;  1RY2 A;  2AYA A;  4DV0 C;  4OXI A;  1FUG A;  1N36 C;  2YWB A;  2CXC A;  1TH5 A;  1V25 A;  2HJG A;  2EGT A;  1ZB9 A;  2QVZ X;  2QW0 X;  1ZB8 A;  4JI8 C;  4L2Z A;  3NYQ A;  4BSZ A;  5A19 A;  3CJE A;  4DCT A;  4R1L A;  2NCL A;  4X66 C;  2QL8 A;  5BUR A;  3UX2 A;  2E5L C;  5AE1 A;  4ZLP A;  5K8F A;  2P2J A;  4DV2 C;  4NDN A;  1O9T A;  2D1Q A;  5BUS A;  4KTV A;  2QVY X;  4RMN A;  2ZZN A;  4DR3 C;  4JI3 C;  4DV3 C;  3T1H C;  4D4I A;  2UXC C;  1NY8 A;  3UEB A;  5K85 A;  4GXR A;  3R9W A;  4LF9 C;  2KDN A;  1IB8 A;  4WS9 A;  3E7X A;  5KYV A;  1NYE A;  3GKU A;  5IWA C;  2E8F A;  4BC7 A;  4GXQ A;  5LMU C;  1VEH A;  4YY3 C;  2UUC C;  1T5D X;  4JI6 C;  2ATW A;  2D1T A;  4PUH A;  1PG4 A;  4GS5 A;  2D28 C;  3DAY A;  4R1M A;  3RV2 A;  3O2E A;  4DCS A;  4JI7 C;  1GPM A;  4DR7 C;  3PRO C;  5T8S A;  4LFC C;  3A25 A;  3R44 A;  2BH1 X;  1PA4 A;  1P4E C;  1XNQ C;  1YJ7 A;  2D1S A;  1FLO A;  5H9U A;  1J5E C;  3C5E A;  2OPL A;  1MXA A;  1P4E A;  3CQ3 A;  2UXD C;  1HNX C;  1QWI A;  4TPS B;  4B3T C;  4KHP C;  2MMA B;  4DR5 C;  4BC9 A;  4JYA C;  3CQ2 A;  4DUZ C;  4RVO A;  3GR0 A;  1HR0 C;  2OPL B;  1PG3 A;  4DV7 C;  5LCI A;  3VNR A;  2E7G A;  4ZJZ A;  3EQ6 A;  1WCJ A;  1L2F A;  1O93 A;  5AE2 A;  2WP0 C;  3H2T A;  2DYJ A;  5FLX D;  4LF8 C;  4XX2 A;  4G37 A;  3LAX A;  2PT7 G;  1ULT A;  4WV3 A;  4DCU A;  3B7W A;  5BSR A;  5BR8 C;  3S82 A;  3TR3 A;  4BBY A;  4K0K C;  1PU1 A;  3T1Y C;  5BSM A;  3RG2 A;  1XS3 A;  3DLP X;  3IML A;  3VNQ A;  4BCA A;  3SO4 A;  2E0G A;  2YWC A;  5BSV A;  1XRA A;  4D4G A;  4B3M C;  2BJO A;  1V60 A;  1XNR C;  2MM9 A;  3OTO C;  1XHJ A;  5IFI A;  3A26 A;  4RLF A;  3R9X A;  2ONF A;  4JI2 C;  4R0M A;  2DHM A;  3FCE A;  5DV9 A;  2VSQ A;  3VNS A;  5ADZ A;  3NYR A;  4G1I A;  3TQI A;  1VLA A;  1BA3 A;  2F4V C;  4MTN A;  4LE5 A;  3ETC A;  5E7Q A;  4JI5 C;  3TDE A;  4K0B A;  1HH2 P;  1MXB A;  1O92 A;  3AY0 A;  2JMP A;  4JI4 C;  3AF5 A;  2P20 A;  1EGA A;  3A9U A;  5A1I A;  2YX1 A;  2ZZM A;  4LF7 C;  4RM3 A;  1MDF A;  2ASB A;  2P2B A;  3KXW A;  4OYC A;  1M6X C;  2PRO A;  3NPD A;  5A1G A;  4PUI A;  3CW9 A;  2DPL A;  4DV1 C;  2D1R A;  4NXM C;  4PUG A;  1LQL A;  2E8C A;  4DG9 A;  1M6X A;  1HNW C;  4JV5 C;  3J81 D;  2M5O A;  2OBV A;  5AE3 A;  4HPV A;  2OO4 A;  3I07 A;  2CU6 A;  1K0R A;  1IBL C;  4X65 C;  4JM1 A;  4X62 C;  5KYT A;  2MCQ A;  3CW8 X;  1N34 C;  1IBM C;  1XRB A;  1USP A;  3JAM D;  1MD9 A;  3N54 B;  4LF5 C;  4G36 A;  2VQF C;  4DR6 C;  4YHH C;  3AF6 A;  1I94 C;  2QVX X;  1N33 C;  2YCB A;  2PN2 A;  3DHV A;  5BUQ A;  4FUQ A;  1USP B;  1O90 A;  3TUF A;  4JI1 C;  4DV4 C; 
#chains in the Genus database with same CATH homology
 1UWD A;  1XHJ A;  1VEH A;  2M5O A;  2Z51 A;  2M5H A;  1WCJ A;  3LNO A;  1TH5 A;  3UX2 A;  3CQ1 A;  2CU6 A;  3CQ2 A;  3UX3 A;  3CQ3 A;  2JNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...