2JNVA

Solution structure of c-terminal domain of nifu-like protein from oryza sativa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
MGLPLTAGNVESVLDQVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKIPDVAAVEPVTDKETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NifU-like protein 1, chloroplast
publication title The cooperative role of OsCnfU-1A domain I and domain II in the iron sulphur cluster transfer process as revealed by NMR
pubmed doi rcsb
source organism Oryza sativa
molecule tags Metal transport
total genus 12
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2jnvA00
1WCJA 3CQ2A 2M5HA 3CQ3A 1UWDA 2Z51A 2CU6A 3LNOA 3CQ1A 3UX3A 1TH5A 1XHJA 2M5OA 1VEHA 3UX2A 2JNVA
chains in the Genus database with same CATH superfamily
4LF8C 3CQ3A 3RV2A 3EERA 4X65C 5KYTA 4JYAC 5KEIA 2D1RA 4DR3C 4D4GA 4DCSA 4JI1C 1O9TA 1NYEA 1TH5A 3R9WA 1P7LA 4ISBA 3G7SA 4DCTA 1XNRC 3T1HC 2NCLA 4DV3C 4PUHA 3A25A 2E8CA 3R44A 3E7XA 4DR7C 4MH4A 3LGXA 1HNWC 1M6XA 1MXAA 2QVZX 1VEHA 1XNQC 4LF5C 5BUSA 1WCJA 1ZB8A 3FCEA 1MKYA 5LCIA 3UOWA 4EATA 1P4EC 4JI8C 2YX1A 4NXNC 4IZ6A 5BUQA 1LQLA 1UWDA 2Y4OA 2MCQA 2E8EA 3LAXA 4RVOA 2DHMA 3R9XA 1MD9A 2P2QA 2Y4NA 4DG9A 1V60A 1QM4A 2ZZMA 4LF6C 3EQ6A 4LF9C 2PROA 2M5OA 1IBLC 1WH9A 1XMOC 3O2EA 3NPDA 2OBVA 5BSWA 2P02A 5IWAC 3IEUA 2VQEC 4PHTA 4JI2C 4DCVA 4JI7C 1J5EC 2UXDC 4B3TC 3PROC 4ZJZA 2UXBC 2ASBA 1UKKA 4BCAA 1XRCA 2BJOA 4GXQA 3CQ1A 5BR8C 4DR2C 1O90A 4AQYC 1XS3A 4KTTA 1XHJA 2KDNA 2ZZNA 2YCBA 4MTNA 4JI3C 1USPA 1GPMA 3SO4A 4FUQA 1N2FA 4NOZA 1NY8A 2DYJA 3LNVA 1WF3A 5CZVA 3CQ2A 4WV3A 4BC7A 4PROC 1AMUA 1MDFA 2VZEA 3UZ0A 4X64C 2D1SA 3CW9A 4LFBC 4DUZC 2P2MA 2WP0C 4PUIA 3K6RA 1RG9A 4R1MA 4DR1C 2D27A 1PG4A 1ULTA 2E5LC 4OX9C 1O92A 5IT9D 2HJGA 1MXCA 2UXCC 5KYVA 4KHPC 4R0MA 3VNSA 1I94C 3LUSA 4D56A 2CU6A 3I07A 4IR7A 4DV2C 5BSVA 1V26A 3I08A 4JI6C 3L8CA 4LE5A 1T5HX 1T5DX 2YWCA 1HR0C 3DAYA 2P2FA 5CZXA 2VQFC 3OTOC 2D7VA 2UUAC 1QWIA 4YY3C 1P4EA 4D57A 4B3MC 5A19A 3UEBA 4NDNA 3IEVA 1PU1A 3VNRA 5LMUC 2D1QA 2JNVA 4FUTA 5A2QD 4RLFA 2KZ0A 1JOSA 2CY1A 3TR3A 3PBKA 5BURA 2HHHC 3UX2A 4DUYC 4R1LA 2UUCC 3A26A 2UU9C 4OXIA 5BSTA 3NYRA 4LF7C 3GKUA 3E7WA 2WD9A 4HPVA 5T8TA 4G1IA 2OPLB 2UUBC 1L2FA 1MDBA 2BH1X 1HNZC 4U5YD 4G36A 1PA4A 2F4VC 3N54B 3TQIA 4PUGA 5H9UA 2E7GA 3DLPX 2D1TA 4DG8A 3KXWA 4B3RC 3LNOA 2PT7G 1IBKC 4DR6C 5AE1A 4DR4C 3DHVA 2Y27A 4L4QA 3CW8X 2VSQA 5BSRA 2V7BA 3ETOA 4RVNA 3AF5A 2M5HA 4BBYA 4JI5C 4XX2A 5E7QA 4WS9A 4RM3A 4K0KC 4KTVA 4GKJC 3A4IA 4RM2A 3TDEA 1IB8A 3NYQA 3GR1A 5AE3A 1HNXC 3NI2A 2DPLA 5FLXD 4D4IA 3J81D 5T8SA 4DCUA 4LFCC 2XR1A 1IBMC 4BC9A 3AY0A 4DV6C 2P2JA 3H2TA 3IPLA 5K85A 4DV5C 3TUFA 3A9VA 4GS5A 4ZLPA 1PG3A 2AYAA 1YJ7A 2MM9A 1FUGA 3CJEA 2CXCA 4JM1A 1XRAA 2E0GA 3UX3A 3T1YC 2MMAB 1N36C 3A9UA 1FLOA 1EGAA 1N32C 1HH2P 5K8FA 4PZPA 4FTFA 4X66C 3B7WA 3GPCA 4DV0C 2JMPA 5BSUA 1M6XC 1VLAA 4DV1C 1N34C 4TPSB 4OYCA 4LF4C 4JI4C 4ODJA 5DV9A 3J80D 2KZFA 4X62C 2QW0X 3GR0A 3FCCA 4I9GA 1XRBA 1ZB9A 2P2BA 1BA3A 4BSZA 3JAMD 3IMLA 4K0BA 4JI0C 1V25A 4B3SC 1LCIA 1RY2A 2E8FA 2ATWA 4NXMC 3RG2A 5ADZA 4GKKC 2P20A 5LMNC 5GTDA 1USPB 4GXRA 3L95X 3S82A 4L7IA 1KKGA 4L2ZA 4DV4C 2OPLA 1O93A 4I9FA 3VNQA 2D28C 5AE2A 1MXBA 2Z51A 3AF6A 4DV7C 2ONFA 1ML8A 1N33C 5IFIA 5BSMA 4G37A 4LFAC 2QVYX 2OO4A 1K0RA 5A1GA 1XMQC 4RLQA 3C5EA 2YWBA 2EGTA 5JRHA 2QVXX 2PN2A 4RMNA 4JV5C 5A1IA 2QL8A 2ZM6C 4DR5C 4YHHC 3N2QA 3PESA 3ETCA 1FJGC
chains in the Genus database with same CATH topology
1WCJA 3CQ2A 2M5HA 3CQ3A 1UWDA 2Z51A 2CU6A 3LNOA 3CQ1A 3UX3A 1TH5A 1XHJA 2M5OA 1VEHA 3UX2A 2JNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCJ A;  3CQ2 A;  2M5H A;  3CQ3 A;  1UWD A;  2Z51 A;  2CU6 A;  3LNO A;  3CQ1 A;  3UX3 A;  1TH5 A;  1XHJ A;  2M5O A;  1VEH A;  3UX2 A;  2JNV A; 
#chains in the Genus database with same CATH topology
 4LF8 C;  3CQ3 A;  3RV2 A;  3EER A;  4X65 C;  5KYT A;  4JYA C;  5KEI A;  2D1R A;  4DR3 C;  4D4G A;  4DCS A;  4JI1 C;  1O9T A;  1NYE A;  1TH5 A;  3R9W A;  1P7L A;  4ISB A;  3G7S A;  4DCT A;  1XNR C;  3T1H C;  2NCL A;  4DV3 C;  4PUH A;  3A25 A;  2E8C A;  3R44 A;  3E7X A;  4DR7 C;  4MH4 A;  3LGX A;  1HNW C;  1M6X A;  1MXA A;  2QVZ X;  1VEH A;  1XNQ C;  4LF5 C;  5BUS A;  1WCJ A;  1ZB8 A;  3FCE A;  1MKY A;  5LCI A;  3UOW A;  4EAT A;  1P4E C;  4JI8 C;  2YX1 A;  4NXN C;  4IZ6 A;  5BUQ A;  1LQL A;  1UWD A;  2Y4O A;  2MCQ A;  2E8E A;  3LAX A;  4RVO A;  2DHM A;  3R9X A;  1MD9 A;  2P2Q A;  2Y4N A;  4DG9 A;  1V60 A;  1QM4 A;  2ZZM A;  4LF6 C;  3EQ6 A;  4LF9 C;  2PRO A;  2M5O A;  1IBL C;  1WH9 A;  1XMO C;  3O2E A;  3NPD A;  2OBV A;  5BSW A;  2P02 A;  5IWA C;  3IEU A;  2VQE C;  4PHT A;  4JI2 C;  4DCV A;  4JI7 C;  1J5E C;  2UXD C;  4B3T C;  3PRO C;  4ZJZ A;  2UXB C;  2ASB A;  1UKK A;  4BCA A;  1XRC A;  2BJO A;  4GXQ A;  3CQ1 A;  5BR8 C;  4DR2 C;  1O90 A;  4AQY C;  1XS3 A;  4KTT A;  1XHJ A;  2KDN A;  2ZZN A;  2YCB A;  4MTN A;  4JI3 C;  1USP A;  1GPM A;  3SO4 A;  4FUQ A;  1N2F A;  4NOZ A;  1NY8 A;  2DYJ A;  3LNV A;  1WF3 A;  5CZV A;  3CQ2 A;  4WV3 A;  4BC7 A;  4PRO C;  1AMU A;  1MDF A;  2VZE A;  3UZ0 A;  4X64 C;  2D1S A;  3CW9 A;  4LFB C;  4DUZ C;  2P2M A;  2WP0 C;  4PUI A;  3K6R A;  1RG9 A;  4R1M A;  4DR1 C;  2D27 A;  1PG4 A;  1ULT A;  2E5L C;  4OX9 C;  1O92 A;  5IT9 D;  2HJG A;  1MXC A;  2UXC C;  5KYV A;  4KHP C;  4R0M A;  3VNS A;  1I94 C;  3LUS A;  4D56 A;  2CU6 A;  3I07 A;  4IR7 A;  4DV2 C;  5BSV A;  1V26 A;  3I08 A;  4JI6 C;  3L8C A;  4LE5 A;  1T5H X;  1T5D X;  2YWC A;  1HR0 C;  3DAY A;  2P2F A;  5CZX A;  2VQF C;  3OTO C;  2D7V A;  2UUA C;  1QWI A;  4YY3 C;  1P4E A;  4D57 A;  4B3M C;  5A19 A;  3UEB A;  4NDN A;  3IEV A;  1PU1 A;  3VNR A;  5LMU C;  2D1Q A;  2JNV A;  4FUT A;  5A2Q D;  4RLF A;  2KZ0 A;  1JOS A;  2CY1 A;  3TR3 A;  3PBK A;  5BUR A;  2HHH C;  3UX2 A;  4DUY C;  4R1L A;  2UUC C;  3A26 A;  2UU9 C;  4OXI A;  5BST A;  3NYR A;  4LF7 C;  3GKU A;  3E7W A;  2WD9 A;  4HPV A;  5T8T A;  4G1I A;  2OPL B;  2UUB C;  1L2F A;  1MDB A;  2BH1 X;  1HNZ C;  4U5Y D;  4G36 A;  1PA4 A;  2F4V C;  3N54 B;  3TQI A;  4PUG A;  5H9U A;  2E7G A;  3DLP X;  2D1T A;  4DG8 A;  3KXW A;  4B3R C;  3LNO A;  2PT7 G;  1IBK C;  4DR6 C;  5AE1 A;  4DR4 C;  3DHV A;  2Y27 A;  4L4Q A;  3CW8 X;  2VSQ A;  5BSR A;  2V7B A;  3ETO A;  4RVN A;  3AF5 A;  2M5H A;  4BBY A;  4JI5 C;  4XX2 A;  5E7Q A;  4WS9 A;  4RM3 A;  4K0K C;  4KTV A;  4GKJ C;  3A4I A;  4RM2 A;  3TDE A;  1IB8 A;  3NYQ A;  3GR1 A;  5AE3 A;  1HNX C;  3NI2 A;  2DPL A;  5FLX D;  4D4I A;  3J81 D;  5T8S A;  4DCU A;  4LFC C;  2XR1 A;  1IBM C;  4BC9 A;  3AY0 A;  4DV6 C;  2P2J A;  3H2T A;  3IPL A;  5K85 A;  4DV5 C;  3TUF A;  3A9V A;  4GS5 A;  4ZLP A;  1PG3 A;  2AYA A;  1YJ7 A;  2MM9 A;  1FUG A;  3CJE A;  2CXC A;  4JM1 A;  1XRA A;  2E0G A;  3UX3 A;  3T1Y C;  2MMA B;  1N36 C;  3A9U A;  1FLO A;  1EGA A;  1N32 C;  1HH2 P;  5K8F A;  4PZP A;  4FTF A;  4X66 C;  3B7W A;  3GPC A;  4DV0 C;  2JMP A;  5BSU A;  1M6X C;  1VLA A;  4DV1 C;  1N34 C;  4TPS B;  4OYC A;  4LF4 C;  4JI4 C;  4ODJ A;  5DV9 A;  3J80 D;  2KZF A;  4X62 C;  2QW0 X;  3GR0 A;  3FCC A;  4I9G A;  1XRB A;  1ZB9 A;  2P2B A;  1BA3 A;  4BSZ A;  3JAM D;  3IML A;  4K0B A;  4JI0 C;  1V25 A;  4B3S C;  1LCI A;  1RY2 A;  2E8F A;  2ATW A;  4NXM C;  3RG2 A;  5ADZ A;  4GKK C;  2P20 A;  5LMN C;  5GTD A;  1USP B;  4GXR A;  3L95 X;  3S82 A;  4L7I A;  1KKG A;  4L2Z A;  4DV4 C;  2OPL A;  1O93 A;  4I9F A;  3VNQ A;  2D28 C;  5AE2 A;  1MXB A;  2Z51 A;  3AF6 A;  4DV7 C;  2ONF A;  1ML8 A;  1N33 C;  5IFI A;  5BSM A;  4G37 A;  4LFA C;  2QVY X;  2OO4 A;  1K0R A;  5A1G A;  1XMQ C;  4RLQ A;  3C5E A;  2YWB A;  2EGT A;  5JRH A;  2QVX X;  2PN2 A;  4RMN A;  4JV5 C;  5A1I A;  2QL8 A;  2ZM6 C;  4DR5 C;  4YHH C;  3N2Q A;  3PES A;  3ETC A;  1FJG C; 
#chains in the Genus database with same CATH homology
 1WCJ A;  3CQ2 A;  2M5H A;  3CQ3 A;  1UWD A;  2Z51 A;  2CU6 A;  3LNO A;  3CQ1 A;  3UX3 A;  1TH5 A;  1XHJ A;  2M5O A;  1VEH A;  3UX2 A;  2JNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...