2JNVA

Solution structure of c-terminal domain of nifu-like protein from oryza sativa
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
83
structure length
83
Chain Sequence
MGLPLTAGNVESVLDQVRPYLTADGGDVALHEIAGNVVRLKLQGACGSCPSSLITIKRGIERRLMEKIPDVAAVEPVTDKETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The cooperative role of OsCnfU-1A domain I and domain II in the iron sulphur cluster transfer process as revealed by NMR
pubmed doi rcsb
source organism Oryza sativa
molecule tags Metal transport
molecule keywords NifU-like protein 1, chloroplast
total genus 12
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01106 NifU NifU-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.130 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 Fe-S cluster assembly (FSCA) 2jnvA00
2M5HA 3CQ3A 1TH5A 1WCJA 3UX3A 3LNOA 2Z51A 3UX2A 3CQ2A 2JNVA 1XHJA 2CU6A 2M5OA 1VEHA 3CQ1A 1UWDA
chains in the Genus database with same CATH superfamily
2XR1A 2E5LC 3RV2A 3GR1A 2E7GA 4D57A 4DCVA 4R0MA 2E0GA 4AQYC 4DCSA 4PZPA 2CXCA 3GR0A 4DG9A 3G7SA 3PROC 4K0KC 2YX1A 4JI8C 3IPLA 1LQLA 4G36A 2ZZMA 3AF6A 4DV5C 1GPMA 2Y4NA 4DV6C 5BSWA 3NPDA 4RMNA 2KDNA 3A26A 4JI4C 3DAYA 1V26A 4JI7C 1UKKA 4LF7C 4JI1C 3EERA 1NY8A 5E7QA 1O9TA 4DR4C 1MXAA 1PA4A 4B3MC 1N32C 3UZ0A 3CJEA 1HNXC 2BH1X 3ETOA 1WH9A 2MMAB 4L4QA 4R1LA 4GKKC 3FCCA 3VNRA 5KEIA 2DHMA 3FCEA 2QL8A 2V7BA 4DV4C 4PHTA 4FUTA 5A1IA 3C5EA 3O2EA 4LF9C 1IBMC 2QVXX 2PROA 1UWDA 4LE5A 4GXQA 4DR2C 4NDNA 2HHHC 4OX9C 4OXIA 2ATWA 4U5YD 4WS9A 2P2JA 4X66C 4I9FA 4X65C 2VZEA 2D1SA 3IEUA 2D1QA 1PG3A 5T8SA 5GTDA 1ZB9A 4DV1C 4IR7A 4PROC 4RM3A 5IWAC 2QVZX 1KKGA 3UOWA 3TDEA 3NI2A 4NXNC 3CQ2A 2M5HA 1HH2P 4DR5C 3GPCA 1JOSA 5H9UA 1V60A 4G37A 4JI0C 1XRCA 1O93A 4XX2A 2UXCC 3I08A 1IBKC 1P4EC 2WP0C 4DV0C 2D28C 4MH4A 2QVYX 3VNSA 4B3TC 2BJOA 5BSRA 1XS3A 3EQ6A 1N34C 4DR1C 5LMNC 1ZB8A 3T1HC 2M5OA 2D1RA 4PUGA 1N2FA 1WCJA 2PN2A 2VQFC 1TH5A 2Z51A 3AY0A 4EATA 3IEVA 4L2ZA 4KTTA 5BSUA 4IZ6A 3NYQA 1PU1A 3NYRA 3UX2A 3JAMD 1WF3A 2AYAA 2P2BA 4GS5A 1MDBA 2KZFA 2NCLA 2WD9A 3A4IA 5IT9D 2E8FA 4I9GA 5BSVA 2P02A 5LMUC 3VNQA 2F4VC 2Y27A 5K8FA 1XHJA 4ODJA 1O90A 1M6XA 2VSQA 4NOZA 4JI2C 4TPSB 4LF6C 3LNVA 3TR3A 1RY2A 3TQIA 2ZM6C 4ISBA 4KHPC 3CQ3A 2VQEC 2ASBA 2QW0X 5LCIA 4ZLPA 4PUHA 4DR3C 2KZ0A 1NYEA 2E8EA 4BSZA 5IFIA 1ML8A 2P2MA 1FLOA 1PG4A 3LUSA 4NXMC 4LFBC 2ONFA 3LNOA 3LAXA 2YWBA 4D4GA 3UX3A 1HR0C 3R9XA 1IB8A 2CU6A 1AMUA 1XNQC 5BSTA 2DYJA 4FTFA 4PUIA 3AF5A 2YCBA 3N54B 1USPA 5BSMA 3ETCA 1V25A 2OPLB 1BA3A 4B3SC 4JI6C 4OYCA 4DUYC 3R9WA 4DR7C 4DV3C 2P2FA 4JI3C 3LGXA 4LFAC 1HNZC 4RLFA 3J80D 4R1MA 3A9VA 2UXDC 3E7WA 3E7XA 2UUBC 4X62C 3R44A 3DLPX 3PESA 4JI5C 4BC9A 4K0BA 4DV2C 5AE1A 4LFCC 1XRAA 2EGTA 1EGAA 4BCAA 2UU9C 2P20A 2UUAC 3A9UA 3PBKA 1QWIA 1YJ7A 3H2TA 1N36C 1RG9A 2MM9A 3S82A 2OPLA 4GKJC 1MD9A 1XMQC 2DPLA 5CZXA 5BURA 3DHVA 4L7IA 4BBYA 4RVNA 1XRBA 4LF4C 3CW8X 1HNWC 1XNRC 3N2QA 3I07A 3L95X 1MXBA 1J5EC 4DV7C 4RVOA 2OBVA 3OTOC 1T5HX 2MCQA 3T1YC 3GKUA 5BUQA 2ZZNA 1VLAA 5BUSA 2D27A 5JRHA 5DV9A 2D7VA 5AE2A 5ADZA 3KXWA 1MXCA 5FLXD 2UXBC 3IMLA 1FJGC 1I94C 2D1TA 3A25A 4DCTA 4G1IA 3CW9A 3TUFA 4D56A 1K0RA 4D4IA 1XMOC 2YWCA 4KTVA 4DR6C 1P4EA 2P2QA 3RG2A 4MTNA 4JYAC 1IBLC 3B7WA 2HJGA 4ZJZA 5BR8C 3J81D 2PT7G 4X64C 5A19A 4BC7A 4LF8C 1FUGA 4YHHC 1LCIA 1O92A 5T8TA 2JNVA 1QM4A 4YY3C 4RM2A 3L8CA 2Y4OA 1P7LA 4WV3A 1T5DX 2CY1A 5KYTA 1MKYA 2OO4A 4LF5C 1N33C 4DUZC 5A1GA 1USPB 4JV5C 5K85A 2UUCC 4DCUA 4DG8A 4HPVA 1VEHA 2E8CA 1ULTA 4RLQA 4B3RC 3K6RA 5CZVA 4FUQA 1L2FA 3CQ1A 5KYVA 2JMPA 3UEBA 1MDFA 1M6XC 4GXRA 4JM1A 5A2QD 3SO4A 5AE3A
chains in the Genus database with same CATH topology
2M5HA 3CQ3A 1TH5A 1WCJA 3UX3A 3LNOA 2Z51A 3UX2A 3CQ2A 2JNVA 1XHJA 2CU6A 2M5OA 1VEHA 3CQ1A 1UWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5H A;  3CQ3 A;  1TH5 A;  1WCJ A;  3UX3 A;  3LNO A;  2Z51 A;  3UX2 A;  3CQ2 A;  2JNV A;  1XHJ A;  2CU6 A;  2M5O A;  1VEH A;  3CQ1 A;  1UWD A; 
#chains in the Genus database with same CATH topology
 2XR1 A;  2E5L C;  3RV2 A;  3GR1 A;  2E7G A;  4D57 A;  4DCV A;  4R0M A;  2E0G A;  4AQY C;  4DCS A;  4PZP A;  2CXC A;  3GR0 A;  4DG9 A;  3G7S A;  3PRO C;  4K0K C;  2YX1 A;  4JI8 C;  3IPL A;  1LQL A;  4G36 A;  2ZZM A;  3AF6 A;  4DV5 C;  1GPM A;  2Y4N A;  4DV6 C;  5BSW A;  3NPD A;  4RMN A;  2KDN A;  3A26 A;  4JI4 C;  3DAY A;  1V26 A;  4JI7 C;  1UKK A;  4LF7 C;  4JI1 C;  3EER A;  1NY8 A;  5E7Q A;  1O9T A;  4DR4 C;  1MXA A;  1PA4 A;  4B3M C;  1N32 C;  3UZ0 A;  3CJE A;  1HNX C;  2BH1 X;  3ETO A;  1WH9 A;  2MMA B;  4L4Q A;  4R1L A;  4GKK C;  3FCC A;  3VNR A;  5KEI A;  2DHM A;  3FCE A;  2QL8 A;  2V7B A;  4DV4 C;  4PHT A;  4FUT A;  5A1I A;  3C5E A;  3O2E A;  4LF9 C;  1IBM C;  2QVX X;  2PRO A;  1UWD A;  4LE5 A;  4GXQ A;  4DR2 C;  4NDN A;  2HHH C;  4OX9 C;  4OXI A;  2ATW A;  4U5Y D;  4WS9 A;  2P2J A;  4X66 C;  4I9F A;  4X65 C;  2VZE A;  2D1S A;  3IEU A;  2D1Q A;  1PG3 A;  5T8S A;  5GTD A;  1ZB9 A;  4DV1 C;  4IR7 A;  4PRO C;  4RM3 A;  5IWA C;  2QVZ X;  1KKG A;  3UOW A;  3TDE A;  3NI2 A;  4NXN C;  3CQ2 A;  2M5H A;  1HH2 P;  4DR5 C;  3GPC A;  1JOS A;  5H9U A;  1V60 A;  4G37 A;  4JI0 C;  1XRC A;  1O93 A;  4XX2 A;  2UXC C;  3I08 A;  1IBK C;  1P4E C;  2WP0 C;  4DV0 C;  2D28 C;  4MH4 A;  2QVY X;  3VNS A;  4B3T C;  2BJO A;  5BSR A;  1XS3 A;  3EQ6 A;  1N34 C;  4DR1 C;  5LMN C;  1ZB8 A;  3T1H C;  2M5O A;  2D1R A;  4PUG A;  1N2F A;  1WCJ A;  2PN2 A;  2VQF C;  1TH5 A;  2Z51 A;  3AY0 A;  4EAT A;  3IEV A;  4L2Z A;  4KTT A;  5BSU A;  4IZ6 A;  3NYQ A;  1PU1 A;  3NYR A;  3UX2 A;  3JAM D;  1WF3 A;  2AYA A;  2P2B A;  4GS5 A;  1MDB A;  2KZF A;  2NCL A;  2WD9 A;  3A4I A;  5IT9 D;  2E8F A;  4I9G A;  5BSV A;  2P02 A;  5LMU C;  3VNQ A;  2F4V C;  2Y27 A;  5K8F A;  1XHJ A;  4ODJ A;  1O90 A;  1M6X A;  2VSQ A;  4NOZ A;  4JI2 C;  4TPS B;  4LF6 C;  3LNV A;  3TR3 A;  1RY2 A;  3TQI A;  2ZM6 C;  4ISB A;  4KHP C;  3CQ3 A;  2VQE C;  2ASB A;  2QW0 X;  5LCI A;  4ZLP A;  4PUH A;  4DR3 C;  2KZ0 A;  1NYE A;  2E8E A;  4BSZ A;  5IFI A;  1ML8 A;  2P2M A;  1FLO A;  1PG4 A;  3LUS A;  4NXM C;  4LFB C;  2ONF A;  3LNO A;  3LAX A;  2YWB A;  4D4G A;  3UX3 A;  1HR0 C;  3R9X A;  1IB8 A;  2CU6 A;  1AMU A;  1XNQ C;  5BST A;  2DYJ A;  4FTF A;  4PUI A;  3AF5 A;  2YCB A;  3N54 B;  1USP A;  5BSM A;  3ETC A;  1V25 A;  2OPL B;  1BA3 A;  4B3S C;  4JI6 C;  4OYC A;  4DUY C;  3R9W A;  4DR7 C;  4DV3 C;  2P2F A;  4JI3 C;  3LGX A;  4LFA C;  1HNZ C;  4RLF A;  3J80 D;  4R1M A;  3A9V A;  2UXD C;  3E7W A;  3E7X A;  2UUB C;  4X62 C;  3R44 A;  3DLP X;  3PES A;  4JI5 C;  4BC9 A;  4K0B A;  4DV2 C;  5AE1 A;  4LFC C;  1XRA A;  2EGT A;  1EGA A;  4BCA A;  2UU9 C;  2P20 A;  2UUA C;  3A9U A;  3PBK A;  1QWI A;  1YJ7 A;  3H2T A;  1N36 C;  1RG9 A;  2MM9 A;  3S82 A;  2OPL A;  4GKJ C;  1MD9 A;  1XMQ C;  2DPL A;  5CZX A;  5BUR A;  3DHV A;  4L7I A;  4BBY A;  4RVN A;  1XRB A;  4LF4 C;  3CW8 X;  1HNW C;  1XNR C;  3N2Q A;  3I07 A;  3L95 X;  1MXB A;  1J5E C;  4DV7 C;  4RVO A;  2OBV A;  3OTO C;  1T5H X;  2MCQ A;  3T1Y C;  3GKU A;  5BUQ A;  2ZZN A;  1VLA A;  5BUS A;  2D27 A;  5JRH A;  5DV9 A;  2D7V A;  5AE2 A;  5ADZ A;  3KXW A;  1MXC A;  5FLX D;  2UXB C;  3IML A;  1FJG C;  1I94 C;  2D1T A;  3A25 A;  4DCT A;  4G1I A;  3CW9 A;  3TUF A;  4D56 A;  1K0R A;  4D4I A;  1XMO C;  2YWC A;  4KTV A;  4DR6 C;  1P4E A;  2P2Q A;  3RG2 A;  4MTN A;  4JYA C;  1IBL C;  3B7W A;  2HJG A;  4ZJZ A;  5BR8 C;  3J81 D;  2PT7 G;  4X64 C;  5A19 A;  4BC7 A;  4LF8 C;  1FUG A;  4YHH C;  1LCI A;  1O92 A;  5T8T A;  2JNV A;  1QM4 A;  4YY3 C;  4RM2 A;  3L8C A;  2Y4O A;  1P7L A;  4WV3 A;  1T5D X;  2CY1 A;  5KYT A;  1MKY A;  2OO4 A;  4LF5 C;  1N33 C;  4DUZ C;  5A1G A;  1USP B;  4JV5 C;  5K85 A;  2UUC C;  4DCU A;  4DG8 A;  4HPV A;  1VEH A;  2E8C A;  1ULT A;  4RLQ A;  4B3R C;  3K6R A;  5CZV A;  4FUQ A;  1L2F A;  3CQ1 A;  5KYV A;  2JMP A;  3UEB A;  1MDF A;  1M6X C;  4GXR A;  4JM1 A;  5A2Q D;  3SO4 A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 2M5H A;  3CQ3 A;  1TH5 A;  1WCJ A;  3UX3 A;  3LNO A;  2Z51 A;  3UX2 A;  3CQ2 A;  2JNV A;  1XHJ A;  2CU6 A;  2M5O A;  1VEH A;  3CQ1 A;  1UWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...