1NYEA

Crystal structure of osmc from e. coli
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
143
Chain Sequence
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of OsmC from Escherichia coli: a salt-shock-induced protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Osmotically inducible protein C
total genus 36
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1nyeA00
2CY1A 3IEUA 4DCSA 1FJGC 2E8CA 1XNRC 1USPA 4GKKC 2KZFA 4DV5C 1MKYA 2PN2A 2JMPA 4X65C 4LF9C 4DCUA 1IBLC 1HH2P 2YCBA 3T1YC 5FLXD 4XX2A 4DV1C 3EERA 4JYAC 1J5EC 1XMOC 4DR1C 2PT7G 3GKUA 4LF4C 4DUYC 2UUAC 5IT9D 1N34C 4K0KC 4KHPC 2EGTA 2UXDC 2ASBA 2ZM6C 4DR5C 1ML8A 2QL8A 3J81D 1LQLA 1UKKA 4X62C 4LF7C 2UUCC 4B3TC 3JAMD 1JOSA 3I07A 2E8EA 1NYEA 4LFAC 2F4VC 4JI3C 1IBMC 1EGAA 3R9XA 4X66C 3IEVA 4LFCC 1USPB 2CXCA 4DV2C 4DR6C 4LF6C 1XMQC 4DR2C 2BJOA 4GKJC 1KKGA 1HNWC 4B3MC 4JI2C 3J80D 5A2QD 1L2FA 3CJEA 4DV3C 5LMNC 2ATWA 2ONFA 2DYJA 2OPLB 4DR3C 4MH4A 3LUSA 3AF5A 1ZB9A 2E5LC 4DCTA 2VQFC 4DUZC 4DV6C 4DV7C 2UU9C 2UUBC 1PA4A 4NXNC 4MTNA 4BSZA 1N2FA 2E7GA 1VLAA 4AQYC 3T1HC 2OPLA 2HHHC 1N33C 4YHHC 4LF5C 4DR4C 4DV4C 4DCVA 1WH9A 4B3SC 2UXBC 4JI5C 5BR8C 2UXCC 1ZB8A 4JV5C 1HNXC 2XR1A 5LMUC 1K0RA 4B3RC 4JI6C 1XNQC 1N36C 4LFBC 3AF6A 4JI1C 2D7VA 4JI8C 4OX9C 4NOZA 1HR0C 2HJGA 3R9WA 4YY3C 4JI4C 4DV0C 5IWAC 1N32C 1WF3A 4JI0C 4NXMC 1QWIA 4X64C 1I94C 4LF8C 1IBKC 4DR7C 2E8FA 4JI7C 1HNZC 3OTOC 2VQEC
chains in the Genus database with same CATH superfamily
4DCSA 2DPLA 1MXAA 4RLFA 2E8CA 1USPA 2KDNA 2Y27A 2PN2A 2JMPA 3LNOA 2QVYX 2YCBA 2MCQA 4ODJA 3VNRA 4XX2A 4DV1C 5BSWA 1J5EC 4RM2A 4DR1C 4L4QA 4DUYC 4K0KC 2EGTA 2UXDC 1MXCA 1XRBA 4DR5C 3IPLA 5T8TA 1MD9A 4OXIA 3ETCA 5AE3A 2MMAB 2F4VC 2D1RA 3TDEA 3AY0A 4X66C 4WV3A 3DAYA 4EATA 1T5HX 2DHMA 5K8FA 3IMLA 5ADZA 1MDFA 2MM9A 4L2ZA 4DV3C 2OPLB 2DYJA 2P2BA 4MH4A 2UU9C 3AF5A 3CW8X 3TQIA 1ULTA 4BC9A 5JRHA 3N54B 1N2FA 1UWDA 3B7WA 4YHHC 5KEIA 1O90A 4L7IA 4JI5C 4RLQA 1ZB8A 3NYRA 1V26A 1MDBA 1XRCA 4B3RC 3I08A 3AF6A 4NOZA 1HR0C 4DV0C 5IWAC 4NXMC 1QWIA 2QW0X 1AMUA 3O2EA 1IBKC 4GXQA 2ZZNA 4ZLPA 4BCAA 1HNZC 2E0GA 3GR0A 2VQEC 3IEUA 5CZXA 1XNRC 1QM4A 4GKKC 2KZFA 1O9TA 4DV5C 1V60A 4X65C 1PU1A 5H9UA 2D28C 5E7QA 2Y4NA 5FLXD 4JYAC 3CQ3A 3E7WA 3UOWA 3A9UA 3GKUA 4LF4C 1FUGA 5IT9D 4BBYA 3L95X 4KHPC 4HPVA 2ASBA 4D56A 1M6XA 4IR7A 2YWCA 4LF7C 2UUCC 3JAMD 3I07A 2P02A 2E8EA 4G36A 3PBKA 1NYEA 4LFAC 4D4IA 4JM1A 1EGAA 5AE2A 3UX2A 1XMQC 2P2FA 5T8SA 5DV9A 2ZZMA 4KTVA 5KYTA 4I9GA 1KKGA 4LE5A 5AE1A 4JI2C 4R1MA 5A2QD 1XRAA 1L2FA 3CJEA 5LMNC 5GTDA 4DR3C 2E5LC 4ZJZA 2D1TA 3LUSA 2UXBC 4DCTA 4DV6C 5A1GA 2UUBC 1PA4A 4NXNC 4BSZA 2E7GA 3T1HC 1P7LA 2OPLA 4D57A 4TPSB 5A19A 1WCJA 1RG9A 4DV4C 2M5OA 5BR8C 3H2TA 3DHVA 2XR1A 5LMUC 1K0RA 1XNQC 2JNVA 3FCCA 3LAXA 2Z51A 3VNQA 3R9WA 4YY3C 4JI4C 2P20A 1PG3A 1VEHA 2WD9A 1TH5A 2E8FA 4FTFA 4JI7C 2M5HA 2V7BA 5BSVA 5LCIA 1NY8A 3OTOC 3NYQA 2Y4OA 5CZVA 1MKYA 3DLPX 1YJ7A 4GS5A 1O93A 4DCUA 4OYCA 2NCLA 2YX1A 3T1YC 4PROC 2KZ0A 1XS3A 1XHJA 2BH1X 1XMOC 5BURA 4FUTA 5BSRA 2UUAC 1N34C 3UZ0A 1M6XC 4ISBA 2P2QA 4RVOA 4DG9A 1ML8A 2QL8A 4PZPA 1LQLA 4X62C 4K0BA 1FLOA 1JOSA 2WP0C 3LGXA 3A4IA 1IBMC 3TR3A 3R9XA 3S82A 3L8CA 1USPB 3VNSA 4DV2C 4I9FA 4DR6C 4GXRA 1P4EA 4LF6C 4DR2C 4PUGA 4FUQA 2BJOA 2VSQA 3RG2A 1PG4A 3A26A 4B3MC 3J80D 5IFIA 2ATWA 1LCIA 1ZB9A 4DV7C 4DUZC 4AQYC 2HHHC 2YWBA 2D27A 1GPMA 5BUQA 3TUFA 3UX3A 4PUIA 1WH9A 4B3SC 3PROC 1HNXC 2VZEA 4BC7A 3C5EA 3GR1A 3A25A 4JI1C 2D7VA 4JI8C 4R1LA 4PHTA 2OBVA 2OO4A 4WS9A 4X64C 4JI0C 1I94C 4LF8C 2PROA 1RY2A 4KTTA 5A1IA 2CXCA 2CY1A 3N2QA 2P2MA 1FJGC 3NI2A 1O92A 3R44A 4LF9C 4G37A 5BUSA 1IBLC 4PUHA 2D1QA 1HH2P 3CQ2A 3EERA 3A9VA 2PT7G 2ZM6C 3FCEA 3J81D 2CU6A 1UKKA 4B3TC 3EQ6A 1T5DX 3G7SA 3K6RA 4JI3C 2QVXX 3IEVA 4LFCC 3CW9A 2P2JA 3UEBA 4DG8A 3KXWA 4RM3A 4GKJC 3CQ1A 1HNWC 5BSTA 4RVNA 1MXBA 2ONFA 5BSMA 3SO4A 2VQFC 3ETOA 3LNVA 3RV2A 4MTNA 5K85A 1VLAA 1N33C 4U5YD 4LF5C 4DR4C 5BSUA 4DCVA 3E7XA 4G1IA 2UXCC 1BA3A 2AYAA 2QVZX 4JV5C 3NPDA 2D1SA 1IB8A 4JI6C 3PESA 5KYVA 1N36C 4LFBC 4OX9C 2HJGA 4IZ6A 3GPCA 4NDNA 1N32C 1WF3A 4D4GA 1P4EC 1V25A 4DR7C 4RMNA 4R0MA
chains in the Genus database with same CATH topology
4DCSA 2DPLA 1MXAA 4RLFA 2E8CA 1USPA 2Y27A 2PN2A 2JMPA 2QVYX 2YCBA 4ODJA 3VNRA 4XX2A 4DV1C 5BSWA 1J5EC 4RM2A 4DR1C 4L4QA 4DUYC 4K0KC 2EGTA 2UXDC 1MXCA 1XRBA 4DR5C 3IPLA 5T8TA 1MD9A 4OXIA 3ETCA 5AE3A 2F4VC 2D1RA 3TDEA 4X66C 4WV3A 3DAYA 4EATA 1T5HX 5K8FA 3IMLA 5ADZA 1MDFA 4L2ZA 4DV3C 2OPLB 2DYJA 2P2BA 4MH4A 2UU9C 3AF5A 3CW8X 3TQIA 1ULTA 4BC9A 5JRHA 3N54B 1N2FA 3B7WA 4YHHC 5KEIA 1O90A 4L7IA 4JI5C 4RLQA 1ZB8A 3NYRA 1V26A 1MDBA 1XRCA 4B3RC 3I08A 3AF6A 4NOZA 1HR0C 4DV0C 5IWAC 4NXMC 1QWIA 2QW0X 1AMUA 1IBKC 4GXQA 4ZLPA 4BCAA 1HNZC 2E0GA 3GR0A 2VQEC 3IEUA 5CZXA 1XNRC 1QM4A 4GKKC 2KZFA 1O9TA 4DV5C 4X65C 5H9UA 2D28C 5E7QA 2Y4NA 5FLXD 4JYAC 3E7WA 3UOWA 3A9UA 3GKUA 4LF4C 1FUGA 5IT9D 4BBYA 3L95X 4KHPC 4HPVA 2ASBA 4D56A 4IR7A 2YWCA 4LF7C 2UUCC 3JAMD 3I07A 2P02A 2E8EA 4G36A 3PBKA 1NYEA 4LFAC 4D4IA 4JM1A 1EGAA 5AE2A 1XMQC 2P2FA 5T8SA 5DV9A 4KTVA 5KYTA 4I9GA 1KKGA 4LE5A 5AE1A 4JI2C 4R1MA 5A2QD 1XRAA 1L2FA 3CJEA 5LMNC 5GTDA 2E5LC 4DR3C 4ZJZA 2D1TA 3LUSA 2UXBC 4DCTA 4DV6C 5A1GA 2UUBC 1PA4A 4NXNC 4BSZA 2E7GA 3T1HC 1P7LA 2OPLA 4D57A 4TPSB 5A19A 4DV4C 1RG9A 5BR8C 3H2TA 3DHVA 2XR1A 5LMUC 1K0RA 1XNQC 3FCCA 3LAXA 3VNQA 3R9WA 4YY3C 4JI4C 2P20A 1PG3A 2WD9A 2E8FA 4FTFA 4JI7C 2V7BA 5BSVA 3OTOC 3NYQA 2Y4OA 5CZVA 1MKYA 3DLPX 1YJ7A 4GS5A 1O93A 4DCUA 4OYCA 3T1YC 4PROC 2BH1X 1XMOC 5BURA 4FUTA 5BSRA 2UUAC 1N34C 3UZ0A 4ISBA 2P2QA 4RVOA 4DG9A 1ML8A 2QL8A 4PZPA 1LQLA 4X62C 4K0BA 1JOSA 2WP0C 3LGXA 3A4IA 1IBMC 3R9XA 3S82A 3L8CA 1USPB 3VNSA 4DV2C 4I9FA 4DR6C 4GXRA 4LF6C 4DR2C 4FUQA 2BJOA 2VSQA 3RG2A 1PG4A 4B3MC 3J80D 5IFIA 2ATWA 1LCIA 1ZB9A 4DV7C 4DUZC 4AQYC 2HHHC 2YWBA 2D27A 1GPMA 5BUQA 3TUFA 1WH9A 4B3SC 3PROC 1HNXC 2VZEA 4BC7A 3C5EA 3GR1A 4JI1C 2D7VA 4JI8C 4R1LA 4PHTA 2OBVA 2OO4A 4WS9A 4X64C 4JI0C 1I94C 4LF8C 2PROA 1RY2A 4KTTA 5A1IA 2CXCA 2CY1A 3N2QA 2P2MA 1FJGC 3NI2A 1O92A 3R44A 4LF9C 4G37A 5BUSA 1IBLC 2D1QA 1HH2P 3EERA 3A9VA 2PT7G 2ZM6C 3FCEA 3J81D 1UKKA 4B3TC 3EQ6A 1T5DX 3G7SA 4JI3C 2QVXX 3IEVA 4LFCC 3CW9A 2P2JA 4DG8A 3KXWA 4RM3A 4GKJC 1HNWC 5BSTA 4RVNA 1MXBA 2ONFA 5BSMA 3SO4A 2VQFC 3ETOA 3LNVA 3RV2A 4MTNA 5K85A 1VLAA 1N33C 4U5YD 4LF5C 4DR4C 5BSUA 4DCVA 3E7XA 4G1IA 2UXCC 1BA3A 2AYAA 2QVZX 4JV5C 3NPDA 2D1SA 4JI6C 3PESA 5KYVA 1N36C 4LFBC 4OX9C 2HJGA 4IZ6A 3GPCA 4NDNA 1N32C 1WF3A 4D4GA 1V25A 4DR7C 4RMNA 4R0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY1 A;  3IEU A;  4DCS A;  1FJG C;  2E8C A;  1XNR C;  1USP A;  4GKK C;  2KZF A;  4DV5 C;  1MKY A;  2PN2 A;  2JMP A;  4X65 C;  4LF9 C;  4DCU A;  1IBL C;  1HH2 P;  2YCB A;  3T1Y C;  5FLX D;  4XX2 A;  4DV1 C;  3EER A;  4JYA C;  1J5E C;  1XMO C;  4DR1 C;  2PT7 G;  3GKU A;  4LF4 C;  4DUY C;  2UUA C;  5IT9 D;  1N34 C;  4K0K C;  4KHP C;  2EGT A;  2UXD C;  2ASB A;  2ZM6 C;  4DR5 C;  1ML8 A;  2QL8 A;  3J81 D;  1LQL A;  1UKK A;  4X62 C;  4LF7 C;  2UUC C;  4B3T C;  3JAM D;  1JOS A;  3I07 A;  2E8E A;  1NYE A;  4LFA C;  2F4V C;  4JI3 C;  1IBM C;  1EGA A;  3R9X A;  4X66 C;  3IEV A;  4LFC C;  1USP B;  2CXC A;  4DV2 C;  4DR6 C;  4LF6 C;  1XMQ C;  4DR2 C;  2BJO A;  4GKJ C;  1KKG A;  1HNW C;  4B3M C;  4JI2 C;  3J80 D;  5A2Q D;  1L2F A;  3CJE A;  4DV3 C;  5LMN C;  2ATW A;  2ONF A;  2DYJ A;  2OPL B;  4DR3 C;  4MH4 A;  3LUS A;  3AF5 A;  1ZB9 A;  2E5L C;  4DCT A;  2VQF C;  4DUZ C;  4DV6 C;  4DV7 C;  2UU9 C;  2UUB C;  1PA4 A;  4NXN C;  4MTN A;  4BSZ A;  1N2F A;  2E7G A;  1VLA A;  4AQY C;  3T1H C;  2OPL A;  2HHH C;  1N33 C;  4YHH C;  4LF5 C;  4DR4 C;  4DV4 C;  4DCV A;  1WH9 A;  4B3S C;  2UXB C;  4JI5 C;  5BR8 C;  2UXC C;  1ZB8 A;  4JV5 C;  1HNX C;  2XR1 A;  5LMU C;  1K0R A;  4B3R C;  4JI6 C;  1XNQ C;  1N36 C;  4LFB C;  3AF6 A;  4JI1 C;  2D7V A;  4JI8 C;  4OX9 C;  4NOZ A;  1HR0 C;  2HJG A;  3R9W A;  4YY3 C;  4JI4 C;  4DV0 C;  5IWA C;  1N32 C;  1WF3 A;  4JI0 C;  4NXM C;  1QWI A;  4X64 C;  1I94 C;  4LF8 C;  1IBK C;  4DR7 C;  2E8F A;  4JI7 C;  1HNZ C;  3OTO C;  2VQE C; 
#chains in the Genus database with same CATH topology
 4DCS A;  2DPL A;  1MXA A;  4RLF A;  2E8C A;  1USP A;  2KDN A;  2Y27 A;  2PN2 A;  2JMP A;  3LNO A;  2QVY X;  2YCB A;  2MCQ A;  4ODJ A;  3VNR A;  4XX2 A;  4DV1 C;  5BSW A;  1J5E C;  4RM2 A;  4DR1 C;  4L4Q A;  4DUY C;  4K0K C;  2EGT A;  2UXD C;  1MXC A;  1XRB A;  4DR5 C;  3IPL A;  5T8T A;  1MD9 A;  4OXI A;  3ETC A;  5AE3 A;  2MMA B;  2F4V C;  2D1R A;  3TDE A;  3AY0 A;  4X66 C;  4WV3 A;  3DAY A;  4EAT A;  1T5H X;  2DHM A;  5K8F A;  3IML A;  5ADZ A;  1MDF A;  2MM9 A;  4L2Z A;  4DV3 C;  2OPL B;  2DYJ A;  2P2B A;  4MH4 A;  2UU9 C;  3AF5 A;  3CW8 X;  3TQI A;  1ULT A;  4BC9 A;  5JRH A;  3N54 B;  1N2F A;  1UWD A;  3B7W A;  4YHH C;  5KEI A;  1O90 A;  4L7I A;  4JI5 C;  4RLQ A;  1ZB8 A;  3NYR A;  1V26 A;  1MDB A;  1XRC A;  4B3R C;  3I08 A;  3AF6 A;  4NOZ A;  1HR0 C;  4DV0 C;  5IWA C;  4NXM C;  1QWI A;  2QW0 X;  1AMU A;  3O2E A;  1IBK C;  4GXQ A;  2ZZN A;  4ZLP A;  4BCA A;  1HNZ C;  2E0G A;  3GR0 A;  2VQE C;  3IEU A;  5CZX A;  1XNR C;  1QM4 A;  4GKK C;  2KZF A;  1O9T A;  4DV5 C;  1V60 A;  4X65 C;  1PU1 A;  5H9U A;  2D28 C;  5E7Q A;  2Y4N A;  5FLX D;  4JYA C;  3CQ3 A;  3E7W A;  3UOW A;  3A9U A;  3GKU A;  4LF4 C;  1FUG A;  5IT9 D;  4BBY A;  3L95 X;  4KHP C;  4HPV A;  2ASB A;  4D56 A;  1M6X A;  4IR7 A;  2YWC A;  4LF7 C;  2UUC C;  3JAM D;  3I07 A;  2P02 A;  2E8E A;  4G36 A;  3PBK A;  1NYE A;  4LFA C;  4D4I A;  4JM1 A;  1EGA A;  5AE2 A;  3UX2 A;  1XMQ C;  2P2F A;  5T8S A;  5DV9 A;  2ZZM A;  4KTV A;  5KYT A;  4I9G A;  1KKG A;  4LE5 A;  5AE1 A;  4JI2 C;  4R1M A;  5A2Q D;  1XRA A;  1L2F A;  3CJE A;  5LMN C;  5GTD A;  4DR3 C;  2E5L C;  4ZJZ A;  2D1T A;  3LUS A;  2UXB C;  4DCT A;  4DV6 C;  5A1G A;  2UUB C;  1PA4 A;  4NXN C;  4BSZ A;  2E7G A;  3T1H C;  1P7L A;  2OPL A;  4D57 A;  4TPS B;  5A19 A;  1WCJ A;  1RG9 A;  4DV4 C;  2M5O A;  5BR8 C;  3H2T A;  3DHV A;  2XR1 A;  5LMU C;  1K0R A;  1XNQ C;  2JNV A;  3FCC A;  3LAX A;  2Z51 A;  3VNQ A;  3R9W A;  4YY3 C;  4JI4 C;  2P20 A;  1PG3 A;  1VEH A;  2WD9 A;  1TH5 A;  2E8F A;  4FTF A;  4JI7 C;  2M5H A;  2V7B A;  5BSV A;  5LCI A;  1NY8 A;  3OTO C;  3NYQ A;  2Y4O A;  5CZV A;  1MKY A;  3DLP X;  1YJ7 A;  4GS5 A;  1O93 A;  4DCU A;  4OYC A;  2NCL A;  2YX1 A;  3T1Y C;  4PRO C;  2KZ0 A;  1XS3 A;  1XHJ A;  2BH1 X;  1XMO C;  5BUR A;  4FUT A;  5BSR A;  2UUA C;  1N34 C;  3UZ0 A;  1M6X C;  4ISB A;  2P2Q A;  4RVO A;  4DG9 A;  1ML8 A;  2QL8 A;  4PZP A;  1LQL A;  4X62 C;  4K0B A;  1FLO A;  1JOS A;  2WP0 C;  3LGX A;  3A4I A;  1IBM C;  3TR3 A;  3R9X A;  3S82 A;  3L8C A;  1USP B;  3VNS A;  4DV2 C;  4I9F A;  4DR6 C;  4GXR A;  1P4E A;  4LF6 C;  4DR2 C;  4PUG A;  4FUQ A;  2BJO A;  2VSQ A;  3RG2 A;  1PG4 A;  3A26 A;  4B3M C;  3J80 D;  5IFI A;  2ATW A;  1LCI A;  1ZB9 A;  4DV7 C;  4DUZ C;  4AQY C;  2HHH C;  2YWB A;  2D27 A;  1GPM A;  5BUQ A;  3TUF A;  3UX3 A;  4PUI A;  1WH9 A;  4B3S C;  3PRO C;  1HNX C;  2VZE A;  4BC7 A;  3C5E A;  3GR1 A;  3A25 A;  4JI1 C;  2D7V A;  4JI8 C;  4R1L A;  4PHT A;  2OBV A;  2OO4 A;  4WS9 A;  4X64 C;  4JI0 C;  1I94 C;  4LF8 C;  2PRO A;  1RY2 A;  4KTT A;  5A1I A;  2CXC A;  2CY1 A;  3N2Q A;  2P2M A;  1FJG C;  3NI2 A;  1O92 A;  3R44 A;  4LF9 C;  4G37 A;  5BUS A;  1IBL C;  4PUH A;  2D1Q A;  1HH2 P;  3CQ2 A;  3EER A;  3A9V A;  2PT7 G;  2ZM6 C;  3FCE A;  3J81 D;  2CU6 A;  1UKK A;  4B3T C;  3EQ6 A;  1T5D X;  3G7S A;  3K6R A;  4JI3 C;  2QVX X;  3IEV A;  4LFC C;  3CW9 A;  2P2J A;  3UEB A;  4DG8 A;  3KXW A;  4RM3 A;  4GKJ C;  3CQ1 A;  1HNW C;  5BST A;  4RVN A;  1MXB A;  2ONF A;  5BSM A;  3SO4 A;  2VQF C;  3ETO A;  3LNV A;  3RV2 A;  4MTN A;  5K85 A;  1VLA A;  1N33 C;  4U5Y D;  4LF5 C;  4DR4 C;  5BSU A;  4DCV A;  3E7X A;  4G1I A;  2UXC C;  1BA3 A;  2AYA A;  2QVZ X;  4JV5 C;  3NPD A;  2D1S A;  1IB8 A;  4JI6 C;  3PES A;  5KYV A;  1N36 C;  4LFB C;  4OX9 C;  2HJG A;  4IZ6 A;  3GPC A;  4NDN A;  1N32 C;  1WF3 A;  4D4G A;  1P4E C;  1V25 A;  4DR7 C;  4RMN A;  4R0M A; 
#chains in the Genus database with same CATH homology
 4DCS A;  2DPL A;  1MXA A;  4RLF A;  2E8C A;  1USP A;  2Y27 A;  2PN2 A;  2JMP A;  2QVY X;  2YCB A;  4ODJ A;  3VNR A;  4XX2 A;  4DV1 C;  5BSW A;  1J5E C;  4RM2 A;  4DR1 C;  4L4Q A;  4DUY C;  4K0K C;  2EGT A;  2UXD C;  1MXC A;  1XRB A;  4DR5 C;  3IPL A;  5T8T A;  1MD9 A;  4OXI A;  3ETC A;  5AE3 A;  2F4V C;  2D1R A;  3TDE A;  4X66 C;  4WV3 A;  3DAY A;  4EAT A;  1T5H X;  5K8F A;  3IML A;  5ADZ A;  1MDF A;  4L2Z A;  4DV3 C;  2OPL B;  2DYJ A;  2P2B A;  4MH4 A;  2UU9 C;  3AF5 A;  3CW8 X;  3TQI A;  1ULT A;  4BC9 A;  5JRH A;  3N54 B;  1N2F A;  3B7W A;  4YHH C;  5KEI A;  1O90 A;  4L7I A;  4JI5 C;  4RLQ A;  1ZB8 A;  3NYR A;  1V26 A;  1MDB A;  1XRC A;  4B3R C;  3I08 A;  3AF6 A;  4NOZ A;  1HR0 C;  4DV0 C;  5IWA C;  4NXM C;  1QWI A;  2QW0 X;  1AMU A;  1IBK C;  4GXQ A;  4ZLP A;  4BCA A;  1HNZ C;  2E0G A;  3GR0 A;  2VQE C;  3IEU A;  5CZX A;  1XNR C;  1QM4 A;  4GKK C;  2KZF A;  1O9T A;  4DV5 C;  4X65 C;  5H9U A;  2D28 C;  5E7Q A;  2Y4N A;  5FLX D;  4JYA C;  3E7W A;  3UOW A;  3A9U A;  3GKU A;  4LF4 C;  1FUG A;  5IT9 D;  4BBY A;  3L95 X;  4KHP C;  4HPV A;  2ASB A;  4D56 A;  4IR7 A;  2YWC A;  4LF7 C;  2UUC C;  3JAM D;  3I07 A;  2P02 A;  2E8E A;  4G36 A;  3PBK A;  1NYE A;  4LFA C;  4D4I A;  4JM1 A;  1EGA A;  5AE2 A;  1XMQ C;  2P2F A;  5T8S A;  5DV9 A;  4KTV A;  5KYT A;  4I9G A;  1KKG A;  4LE5 A;  5AE1 A;  4JI2 C;  4R1M A;  5A2Q D;  1XRA A;  1L2F A;  3CJE A;  5LMN C;  5GTD A;  2E5L C;  4DR3 C;  4ZJZ A;  2D1T A;  3LUS A;  2UXB C;  4DCT A;  4DV6 C;  5A1G A;  2UUB C;  1PA4 A;  4NXN C;  4BSZ A;  2E7G A;  3T1H C;  1P7L A;  2OPL A;  4D57 A;  4TPS B;  5A19 A;  4DV4 C;  1RG9 A;  5BR8 C;  3H2T A;  3DHV A;  2XR1 A;  5LMU C;  1K0R A;  1XNQ C;  3FCC A;  3LAX A;  3VNQ A;  3R9W A;  4YY3 C;  4JI4 C;  2P20 A;  1PG3 A;  2WD9 A;  2E8F A;  4FTF A;  4JI7 C;  2V7B A;  5BSV A;  3OTO C;  3NYQ A;  2Y4O A;  5CZV A;  1MKY A;  3DLP X;  1YJ7 A;  4GS5 A;  1O93 A;  4DCU A;  4OYC A;  3T1Y C;  4PRO C;  2BH1 X;  1XMO C;  5BUR A;  4FUT A;  5BSR A;  2UUA C;  1N34 C;  3UZ0 A;  4ISB A;  2P2Q A;  4RVO A;  4DG9 A;  1ML8 A;  2QL8 A;  4PZP A;  1LQL A;  4X62 C;  4K0B A;  1JOS A;  2WP0 C;  3LGX A;  3A4I A;  1IBM C;  3R9X A;  3S82 A;  3L8C A;  1USP B;  3VNS A;  4DV2 C;  4I9F A;  4DR6 C;  4GXR A;  4LF6 C;  4DR2 C;  4FUQ A;  2BJO A;  2VSQ A;  3RG2 A;  1PG4 A;  4B3M C;  3J80 D;  5IFI A;  2ATW A;  1LCI A;  1ZB9 A;  4DV7 C;  4DUZ C;  4AQY C;  2HHH C;  2YWB A;  2D27 A;  1GPM A;  5BUQ A;  3TUF A;  1WH9 A;  4B3S C;  3PRO C;  1HNX C;  2VZE A;  4BC7 A;  3C5E A;  3GR1 A;  4JI1 C;  2D7V A;  4JI8 C;  4R1L A;  4PHT A;  2OBV A;  2OO4 A;  4WS9 A;  4X64 C;  4JI0 C;  1I94 C;  4LF8 C;  2PRO A;  1RY2 A;  4KTT A;  5A1I A;  2CXC A;  2CY1 A;  3N2Q A;  2P2M A;  1FJG C;  3NI2 A;  1O92 A;  3R44 A;  4LF9 C;  4G37 A;  5BUS A;  1IBL C;  2D1Q A;  1HH2 P;  3EER A;  3A9V A;  2PT7 G;  2ZM6 C;  3FCE A;  3J81 D;  1UKK A;  4B3T C;  3EQ6 A;  1T5D X;  3G7S A;  4JI3 C;  2QVX X;  3IEV A;  4LFC C;  3CW9 A;  2P2J A;  4DG8 A;  3KXW A;  4RM3 A;  4GKJ C;  1HNW C;  5BST A;  4RVN A;  1MXB A;  2ONF A;  5BSM A;  3SO4 A;  2VQF C;  3ETO A;  3LNV A;  3RV2 A;  4MTN A;  5K85 A;  1VLA A;  1N33 C;  4U5Y D;  4LF5 C;  4DR4 C;  5BSU A;  4DCV A;  3E7X A;  4G1I A;  2UXC C;  1BA3 A;  2AYA A;  2QVZ X;  4JV5 C;  3NPD A;  2D1S A;  4JI6 C;  3PES A;  5KYV A;  1N36 C;  4LFB C;  4OX9 C;  2HJG A;  4IZ6 A;  3GPC A;  4NDN A;  1N32 C;  1WF3 A;  4D4G A;  1V25 A;  4DR7 C;  4RMN A;  4R0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...