1NYEA

Crystal structure of osmc from e. coli
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
143
Chain Sequence
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osmotically inducible protein C
publication title Structure of OsmC from Escherichia coli: a salt-shock-induced protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 36
structure length 143
sequence length 143
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1nyeA00
2UUBC 4JI8C 4DV4C 4OX9C 4NXNC 4DR4C 4GKKC 1N32C 1LQLA 2KZFA 5BR8C 4DV2C 3R9XA 1XNRC 2E8FA 4LF8C 4LF6C 1N2FA 4LF9C 5FLXD 3IEVA 4LF7C 4LFBC 4X66C 4DR2C 4B3TC 1ZB8A 1HNZC 1IBMC 1MKYA 4DUYC 1FJGC 4MTNA 1XMQC 2DYJA 4JI5C 5IT9D 4NXMC 1JOSA 4JYAC 1N34C 4LF4C 4DR1C 1NYEA 4MH4A 3OTOC 2ASBA 2E7GA 1J5EC 2VQEC 3GKUA 4DR7C 1PA4A 3T1YC 2OPLB 1USPB 2YCBA 4DV0C 2OPLA 4X65C 3LUSA 1USPA 3IEUA 2UUCC 2E8EA 2HJGA 2PT7G 2UUAC 4B3MC 2UXDC 1L2FA 4X64C 1UKKA 2ONFA 3EERA 3J81D 2CY1A 4JI4C 4B3SC 4LF5C 2VQFC 5LMNC 3CJEA 3AF5A 2F4VC 2ATWA 1ZB9A 2BJOA 3JAMD 4XX2A 4X62C 5IWAC 2EGTA 3R9WA 4K0KC 1EGAA 1K0RA 2D7VA 1HR0C 4JI0C 1WH9A 3J80D 4JI1C 3T1HC 1QWIA 2XR1A 4KHPC 2UXBC 4DCSA 2E5LC 4DCVA 4DV5C 2HHHC 4DV3C 3I07A 4DUZC 4YY3C 1XNQC 4NOZA 4DR6C 1HNWC 1XMOC 1I94C 4BSZA 4DV1C 1ML8A 4DCTA 1IBLC 1HNXC 1IBKC 1N33C 4JI3C 4DCUA 4LFAC 4GKJC 1N36C 4DR3C 4JI7C 3AF6A 4YHHC 4DV7C 1HH2P 4JI6C 5A2QD 4AQYC 2ZM6C 4B3RC 2PN2A 5LMUC 2CXCA 2E8CA 2JMPA 4JV5C 1KKGA 1WF3A 4JI2C 2QL8A 2UU9C 4LFCC 4DV6C 4DR5C 1VLAA 2UXCC
chains in the Genus database with same CATH superfamily
1ULTA 3PESA 4DR4C 1N32C 4DV2C 3RV2A 1N2FA 5JRHA 4RM2A 4GXQA 4X66C 4PUHA 3E7WA 2OBVA 2VSQA 3NI2A 1XMQC 2P02A 1N34C 4DR1C 2V7BA 3A4IA 3O2EA 4R1LA 3UEBA 5AE1A 1J5EC 1PA4A 2YCBA 2OPLA 1GPMA 4DG8A 2DPLA 2UXDC 2VZEA 4B3MC 1MDFA 2QVXX 4X64C 3VNSA 3J81D 2VQFC 3CJEA 4EATA 3TUFA 2ATWA 1M6XA 1XS3A 5IWAC 4X62C 3CQ1A 3ETCA 3B7WA 3R9WA 3CQ3A 3UX3A 1EGAA 1K0RA 4JI1C 1QWIA 5AE2A 2WP0C 5A1GA 2E5LC 4BBYA 4DCVA 3NYRA 1P7LA 2NCLA 1XNQC 4NOZA 5BUSA 2Y27A 4RLFA 3A26A 4DV1C 4RVNA 2MMAB 5ADZA 4RM3A 1N33C 3EQ6A 5IFIA 4DCUA 4D56A 3K6RA 4FUQA 2P20A 4ISBA 4DV7C 4JI6C 5A2QD 3GR1A 5LMUC 2CXCA 2JMPA 5K8FA 2QL8A 2UU9C 5LCIA 3VNQA 4RVOA 1M6XC 2UXCC 2UUBC 4G37A 4BCAA 5BR8C 3CW8X 5CZXA 1XNRC 2E8FA 4JM1A 5GTDA 4LF6C 4B3TC 4PHTA 2P2JA 1XRAA 1FJGC 4MTNA 3IMLA 3N2QA 2DYJA 5IT9D 4NXMC 4JYAC 2D1SA 3CW9A 4MH4A 4U5YD 3GKUA 3PBKA 4L2ZA 3NPDA 5A1IA 4DR7C 1USPB 3LUSA 2E8EA 3TQIA 4IZ6A 4JI4C 1O92A 4TPSB 5LMNC 1MDBA 1IB8A 3AF5A 1O90A 4GXRA 2YWCA 4R1MA 4I9FA 4DG9A 2E0GA 1BA3A 2Y4NA 4JI0C 2WD9A 3AY0A 4L7IA 2XR1A 4KHPC 2UXBC 4FTFA 4DCSA 4BC9A 3LGXA 4YY3C 1FLOA 3CQ2A 1XHJA 4BSZA 5DV9A 1TH5A 4KTVA 4ODJA 2MM9A 2YX1A 1LCIA 4DR3C 2AYAA 1WCJA 3L8CA 5KEIA 2KDNA 2E8CA 5T8SA 4GS5A 4LFCC 4PUIA 4OX9C 4NXNC 4GKKC 4LF8C 1P4EA 3FCCA 4LF7C 3RG2A 4DR2C 1T5HX 1HNZC 1IBMC 4DUYC 4L4QA 1O9TA 4JI5C 1MD9A 1MXBA 1JOSA 4D57A 4LF4C 4G36A 1NYEA 3A9VA 4WS9A 3OTOC 2ASBA 2E7GA 3S82A 2VQEC 1MXAA 3T1YC 1O93A 1YJ7A 4DV0C 4X65C 2CU6A 5K85A 1USPA 1V25A 3A25A 5BSVA 3IEUA 5BSTA 2UUCC 2PT7G 2QVYX 2PROA 2P2BA 1QM4A 5A19A 5BSWA 4LE5A 2KZ0A 4LF5C 1PG4A 2QW0X 5AE3A 2F4VC 3I08A 1ZB9A 5KYVA 4PUGA 3JAMD 4K0BA 2EGTA 2D7VA 3N54B 4D4GA 1HR0C 3A9UA 1WH9A 3GPCA 1VEHA 3ETOA 3T1HC 1P4EC 3UZ0A 4DV5C 4DV3C 3I07A 5BUQA 3TR3A 1HNWC 3FCEA 4FUTA 3TDEA 1MXCA 1ML8A 4DCTA 1IBLC 1HNXC 5T8TA 1FUGA 3NYQA 4BC7A 2D27A 4JI3C 3G7SA 2BH1X 4G1IA 4LFAC 1N36C 1XRCA 4JI7C 4YHHC 1PG3A 2ZM6C 2D1QA 1WF3A 3KXWA 4R0MA 4WV3A 4IR7A 1RG9A 4DV6C 4NDNA 2Y4OA 4DR5C 4JI8C 2ZZNA 4DV4C 1LQLA 1AMUA 2KZFA 3R9XA 5CZVA 3IPLA 4LF9C 5FLXD 3IEVA 4LFBC 4RLQA 1ZB8A 1MKYA 1T5DX 3C5EA 2QVZX 4ZLPA 5E7QA 2Z51A 3DLPX 2D1RA 2OPLB 3R44A 3LNOA 2OO4A 2P2QA 4D4IA 4PROC 4I9GA 2HJGA 2UUAC 5BSMA 1PU1A 1L2FA 1UKKA 2DHMA 2ONFA 4PZPA 3EERA 2CY1A 5BSUA 4B3SC 2YWBA 5H9UA 1XRBA 2P2FA 4RMNA 2BJOA 4KTTA 4XX2A 3L95X 2JNVA 3H2TA 4OYCA 2M5OA 4ZJZA 3LNVA 4K0KC 3GR0A 3J80D 1V26A 5KYTA 1V60A 5BURA 1RY2A 2HHHC 5BSRA 4DUZC 4DR6C 1XMOC 1I94C 3UOWA 3LAXA 3E7XA 1IBKC 3PROC 2M5HA 2ZZMA 4GKJC 2P2MA 2D1TA 3VNRA 2D28C 3DHVA 3AF6A 1HH2P 1UWDA 4AQYC 3UX2A 4B3RC 4HPVA 2PN2A 4JV5C 1KKGA 2MCQA 4JI2C 3DAYA 1NY8A 4OXIA 1VLAA 3SO4A
chains in the Genus database with same CATH topology
1ULTA 3PESA 4DR4C 1N32C 4DV2C 3RV2A 1N2FA 5JRHA 4RM2A 4GXQA 4X66C 3E7WA 2OBVA 2VSQA 3NI2A 1XMQC 2P02A 1N34C 4DR1C 2V7BA 3A4IA 4R1LA 5AE1A 1J5EC 1PA4A 2YCBA 2OPLA 1GPMA 4DG8A 2DPLA 2UXDC 2VZEA 4B3MC 1MDFA 2QVXX 4X64C 3VNSA 3J81D 2VQFC 3CJEA 4EATA 3TUFA 2ATWA 5IWAC 4X62C 3ETCA 3B7WA 3R9WA 1EGAA 1K0RA 4JI1C 1QWIA 5AE2A 2WP0C 5A1GA 2E5LC 4BBYA 4DCVA 3NYRA 1P7LA 1XNQC 4NOZA 5BUSA 2Y27A 4RLFA 4DV1C 4RVNA 5ADZA 4RM3A 1N33C 3EQ6A 5IFIA 4DCUA 4D56A 4FUQA 2P20A 4ISBA 4DV7C 4JI6C 5A2QD 3GR1A 5LMUC 2CXCA 2JMPA 5K8FA 2QL8A 2UU9C 3VNQA 4RVOA 2UXCC 2UUBC 4G37A 4BCAA 5BR8C 3CW8X 5CZXA 1XNRC 2E8FA 4JM1A 5GTDA 4LF6C 4B3TC 4PHTA 2P2JA 1XRAA 1FJGC 4MTNA 3IMLA 3N2QA 2DYJA 5IT9D 4NXMC 4JYAC 2D1SA 3CW9A 4MH4A 4U5YD 3GKUA 3PBKA 4L2ZA 3NPDA 5A1IA 4DR7C 1USPB 3LUSA 2E8EA 3TQIA 4IZ6A 4JI4C 1O92A 4TPSB 5LMNC 1MDBA 3AF5A 1O90A 4GXRA 2YWCA 4R1MA 4I9FA 4DG9A 2E0GA 1BA3A 2Y4NA 4JI0C 2WD9A 4L7IA 2XR1A 4KHPC 2UXBC 4FTFA 4DCSA 4BC9A 3LGXA 4YY3C 4BSZA 5DV9A 4KTVA 4ODJA 1LCIA 4DR3C 2AYAA 3L8CA 5KEIA 2E8CA 5T8SA 4GS5A 4LFCC 4OX9C 4NXNC 4GKKC 4LF8C 3FCCA 4LF7C 3RG2A 4DR2C 1T5HX 1HNZC 1IBMC 4DUYC 4L4QA 1O9TA 4JI5C 1MD9A 1MXBA 1JOSA 4D57A 4LF4C 4G36A 1NYEA 3A9VA 4WS9A 3OTOC 2ASBA 2E7GA 3S82A 2VQEC 1MXAA 3T1YC 1O93A 1YJ7A 4DV0C 4X65C 5K85A 1USPA 1V25A 5BSVA 3IEUA 5BSTA 2UUCC 2PT7G 2QVYX 2PROA 2P2BA 1QM4A 5A19A 5BSWA 4LE5A 4LF5C 1PG4A 2QW0X 5AE3A 2F4VC 3I08A 1ZB9A 5KYVA 3JAMD 4K0BA 2EGTA 2D7VA 3N54B 4D4GA 1HR0C 3A9UA 1WH9A 3GPCA 3ETOA 3T1HC 3UZ0A 4DV5C 4DV3C 3I07A 5BUQA 1HNWC 3FCEA 4FUTA 3TDEA 1MXCA 1ML8A 4DCTA 1IBLC 1HNXC 5T8TA 1FUGA 3NYQA 4BC7A 2D27A 4JI3C 3G7SA 2BH1X 4G1IA 4LFAC 1N36C 1XRCA 4JI7C 4YHHC 1PG3A 2ZM6C 2D1QA 1WF3A 3KXWA 4R0MA 4WV3A 4IR7A 1RG9A 4DV6C 4NDNA 2Y4OA 4DR5C 4JI8C 4DV4C 1LQLA 1AMUA 2KZFA 3R9XA 5CZVA 3IPLA 4LF9C 5FLXD 3IEVA 4LFBC 4RLQA 1ZB8A 1MKYA 1T5DX 3C5EA 2QVZX 4ZLPA 5E7QA 3DLPX 2D1RA 2OPLB 3R44A 2OO4A 2P2QA 4D4IA 4PROC 4I9GA 2HJGA 2UUAC 5BSMA 1L2FA 1UKKA 2ONFA 4PZPA 3EERA 2CY1A 5BSUA 4B3SC 2YWBA 5H9UA 1XRBA 2P2FA 4RMNA 2BJOA 4KTTA 3L95X 4XX2A 3H2TA 4OYCA 4ZJZA 3LNVA 4K0KC 3GR0A 3J80D 1V26A 5KYTA 5BURA 1RY2A 2HHHC 5BSRA 4DUZC 4DR6C 1XMOC 1I94C 3UOWA 3LAXA 3E7XA 1IBKC 3PROC 4GKJC 2P2MA 2D1TA 3VNRA 2D28C 3DHVA 3AF6A 1HH2P 4AQYC 4B3RC 4HPVA 2PN2A 4JV5C 1KKGA 4JI2C 3DAYA 4OXIA 1VLAA 3SO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB C;  4JI8 C;  4DV4 C;  4OX9 C;  4NXN C;  4DR4 C;  4GKK C;  1N32 C;  1LQL A;  2KZF A;  5BR8 C;  4DV2 C;  3R9X A;  1XNR C;  2E8F A;  4LF8 C;  4LF6 C;  1N2F A;  4LF9 C;  5FLX D;  3IEV A;  4LF7 C;  4LFB C;  4X66 C;  4DR2 C;  4B3T C;  1ZB8 A;  1HNZ C;  1IBM C;  1MKY A;  4DUY C;  1FJG C;  4MTN A;  1XMQ C;  2DYJ A;  4JI5 C;  5IT9 D;  4NXM C;  1JOS A;  4JYA C;  1N34 C;  4LF4 C;  4DR1 C;  1NYE A;  4MH4 A;  3OTO C;  2ASB A;  2E7G A;  1J5E C;  2VQE C;  3GKU A;  4DR7 C;  1PA4 A;  3T1Y C;  2OPL B;  1USP B;  2YCB A;  4DV0 C;  2OPL A;  4X65 C;  3LUS A;  1USP A;  3IEU A;  2UUC C;  2E8E A;  2HJG A;  2PT7 G;  2UUA C;  4B3M C;  2UXD C;  1L2F A;  4X64 C;  1UKK A;  2ONF A;  3EER A;  3J81 D;  2CY1 A;  4JI4 C;  4B3S C;  4LF5 C;  2VQF C;  5LMN C;  3CJE A;  3AF5 A;  2F4V C;  2ATW A;  1ZB9 A;  2BJO A;  3JAM D;  4XX2 A;  4X62 C;  5IWA C;  2EGT A;  3R9W A;  4K0K C;  1EGA A;  1K0R A;  2D7V A;  1HR0 C;  4JI0 C;  1WH9 A;  3J80 D;  4JI1 C;  3T1H C;  1QWI A;  2XR1 A;  4KHP C;  2UXB C;  4DCS A;  2E5L C;  4DCV A;  4DV5 C;  2HHH C;  4DV3 C;  3I07 A;  4DUZ C;  4YY3 C;  1XNQ C;  4NOZ A;  4DR6 C;  1HNW C;  1XMO C;  1I94 C;  4BSZ A;  4DV1 C;  1ML8 A;  4DCT A;  1IBL C;  1HNX C;  1IBK C;  1N33 C;  4JI3 C;  4DCU A;  4LFA C;  4GKJ C;  1N36 C;  4DR3 C;  4JI7 C;  3AF6 A;  4YHH C;  4DV7 C;  1HH2 P;  4JI6 C;  5A2Q D;  4AQY C;  2ZM6 C;  4B3R C;  2PN2 A;  5LMU C;  2CXC A;  2E8C A;  2JMP A;  4JV5 C;  1KKG A;  1WF3 A;  4JI2 C;  2QL8 A;  2UU9 C;  4LFC C;  4DV6 C;  4DR5 C;  1VLA A;  2UXC C; 
#chains in the Genus database with same CATH topology
 1ULT A;  3PES A;  4DR4 C;  1N32 C;  4DV2 C;  3RV2 A;  1N2F A;  5JRH A;  4RM2 A;  4GXQ A;  4X66 C;  4PUH A;  3E7W A;  2OBV A;  2VSQ A;  3NI2 A;  1XMQ C;  2P02 A;  1N34 C;  4DR1 C;  2V7B A;  3A4I A;  3O2E A;  4R1L A;  3UEB A;  5AE1 A;  1J5E C;  1PA4 A;  2YCB A;  2OPL A;  1GPM A;  4DG8 A;  2DPL A;  2UXD C;  2VZE A;  4B3M C;  1MDF A;  2QVX X;  4X64 C;  3VNS A;  3J81 D;  2VQF C;  3CJE A;  4EAT A;  3TUF A;  2ATW A;  1M6X A;  1XS3 A;  5IWA C;  4X62 C;  3CQ1 A;  3ETC A;  3B7W A;  3R9W A;  3CQ3 A;  3UX3 A;  1EGA A;  1K0R A;  4JI1 C;  1QWI A;  5AE2 A;  2WP0 C;  5A1G A;  2E5L C;  4BBY A;  4DCV A;  3NYR A;  1P7L A;  2NCL A;  1XNQ C;  4NOZ A;  5BUS A;  2Y27 A;  4RLF A;  3A26 A;  4DV1 C;  4RVN A;  2MMA B;  5ADZ A;  4RM3 A;  1N33 C;  3EQ6 A;  5IFI A;  4DCU A;  4D56 A;  3K6R A;  4FUQ A;  2P20 A;  4ISB A;  4DV7 C;  4JI6 C;  5A2Q D;  3GR1 A;  5LMU C;  2CXC A;  2JMP A;  5K8F A;  2QL8 A;  2UU9 C;  5LCI A;  3VNQ A;  4RVO A;  1M6X C;  2UXC C;  2UUB C;  4G37 A;  4BCA A;  5BR8 C;  3CW8 X;  5CZX A;  1XNR C;  2E8F A;  4JM1 A;  5GTD A;  4LF6 C;  4B3T C;  4PHT A;  2P2J A;  1XRA A;  1FJG C;  4MTN A;  3IML A;  3N2Q A;  2DYJ A;  5IT9 D;  4NXM C;  4JYA C;  2D1S A;  3CW9 A;  4MH4 A;  4U5Y D;  3GKU A;  3PBK A;  4L2Z A;  3NPD A;  5A1I A;  4DR7 C;  1USP B;  3LUS A;  2E8E A;  3TQI A;  4IZ6 A;  4JI4 C;  1O92 A;  4TPS B;  5LMN C;  1MDB A;  1IB8 A;  3AF5 A;  1O90 A;  4GXR A;  2YWC A;  4R1M A;  4I9F A;  4DG9 A;  2E0G A;  1BA3 A;  2Y4N A;  4JI0 C;  2WD9 A;  3AY0 A;  4L7I A;  2XR1 A;  4KHP C;  2UXB C;  4FTF A;  4DCS A;  4BC9 A;  3LGX A;  4YY3 C;  1FLO A;  3CQ2 A;  1XHJ A;  4BSZ A;  5DV9 A;  1TH5 A;  4KTV A;  4ODJ A;  2MM9 A;  2YX1 A;  1LCI A;  4DR3 C;  2AYA A;  1WCJ A;  3L8C A;  5KEI A;  2KDN A;  2E8C A;  5T8S A;  4GS5 A;  4LFC C;  4PUI A;  4OX9 C;  4NXN C;  4GKK C;  4LF8 C;  1P4E A;  3FCC A;  4LF7 C;  3RG2 A;  4DR2 C;  1T5H X;  1HNZ C;  1IBM C;  4DUY C;  4L4Q A;  1O9T A;  4JI5 C;  1MD9 A;  1MXB A;  1JOS A;  4D57 A;  4LF4 C;  4G36 A;  1NYE A;  3A9V A;  4WS9 A;  3OTO C;  2ASB A;  2E7G A;  3S82 A;  2VQE C;  1MXA A;  3T1Y C;  1O93 A;  1YJ7 A;  4DV0 C;  4X65 C;  2CU6 A;  5K85 A;  1USP A;  1V25 A;  3A25 A;  5BSV A;  3IEU A;  5BST A;  2UUC C;  2PT7 G;  2QVY X;  2PRO A;  2P2B A;  1QM4 A;  5A19 A;  5BSW A;  4LE5 A;  2KZ0 A;  4LF5 C;  1PG4 A;  2QW0 X;  5AE3 A;  2F4V C;  3I08 A;  1ZB9 A;  5KYV A;  4PUG A;  3JAM D;  4K0B A;  2EGT A;  2D7V A;  3N54 B;  4D4G A;  1HR0 C;  3A9U A;  1WH9 A;  3GPC A;  1VEH A;  3ETO A;  3T1H C;  1P4E C;  3UZ0 A;  4DV5 C;  4DV3 C;  3I07 A;  5BUQ A;  3TR3 A;  1HNW C;  3FCE A;  4FUT A;  3TDE A;  1MXC A;  1ML8 A;  4DCT A;  1IBL C;  1HNX C;  5T8T A;  1FUG A;  3NYQ A;  4BC7 A;  2D27 A;  4JI3 C;  3G7S A;  2BH1 X;  4G1I A;  4LFA C;  1N36 C;  1XRC A;  4JI7 C;  4YHH C;  1PG3 A;  2ZM6 C;  2D1Q A;  1WF3 A;  3KXW A;  4R0M A;  4WV3 A;  4IR7 A;  1RG9 A;  4DV6 C;  4NDN A;  2Y4O A;  4DR5 C;  4JI8 C;  2ZZN A;  4DV4 C;  1LQL A;  1AMU A;  2KZF A;  3R9X A;  5CZV A;  3IPL A;  4LF9 C;  5FLX D;  3IEV A;  4LFB C;  4RLQ A;  1ZB8 A;  1MKY A;  1T5D X;  3C5E A;  2QVZ X;  4ZLP A;  5E7Q A;  2Z51 A;  3DLP X;  2D1R A;  2OPL B;  3R44 A;  3LNO A;  2OO4 A;  2P2Q A;  4D4I A;  4PRO C;  4I9G A;  2HJG A;  2UUA C;  5BSM A;  1PU1 A;  1L2F A;  1UKK A;  2DHM A;  2ONF A;  4PZP A;  3EER A;  2CY1 A;  5BSU A;  4B3S C;  2YWB A;  5H9U A;  1XRB A;  2P2F A;  4RMN A;  2BJO A;  4KTT A;  4XX2 A;  3L95 X;  2JNV A;  3H2T A;  4OYC A;  2M5O A;  4ZJZ A;  3LNV A;  4K0K C;  3GR0 A;  3J80 D;  1V26 A;  5KYT A;  1V60 A;  5BUR A;  1RY2 A;  2HHH C;  5BSR A;  4DUZ C;  4DR6 C;  1XMO C;  1I94 C;  3UOW A;  3LAX A;  3E7X A;  1IBK C;  3PRO C;  2M5H A;  2ZZM A;  4GKJ C;  2P2M A;  2D1T A;  3VNR A;  2D28 C;  3DHV A;  3AF6 A;  1HH2 P;  1UWD A;  4AQY C;  3UX2 A;  4B3R C;  4HPV A;  2PN2 A;  4JV5 C;  1KKG A;  2MCQ A;  4JI2 C;  3DAY A;  1NY8 A;  4OXI A;  1VLA A;  3SO4 A; 
#chains in the Genus database with same CATH homology
 1ULT A;  3PES A;  4DR4 C;  1N32 C;  4DV2 C;  3RV2 A;  1N2F A;  5JRH A;  4RM2 A;  4GXQ A;  4X66 C;  3E7W A;  2OBV A;  2VSQ A;  3NI2 A;  1XMQ C;  2P02 A;  1N34 C;  4DR1 C;  2V7B A;  3A4I A;  4R1L A;  5AE1 A;  1J5E C;  1PA4 A;  2YCB A;  2OPL A;  1GPM A;  4DG8 A;  2DPL A;  2UXD C;  2VZE A;  4B3M C;  1MDF A;  2QVX X;  4X64 C;  3VNS A;  3J81 D;  2VQF C;  3CJE A;  4EAT A;  3TUF A;  2ATW A;  5IWA C;  4X62 C;  3ETC A;  3B7W A;  3R9W A;  1EGA A;  1K0R A;  4JI1 C;  1QWI A;  5AE2 A;  2WP0 C;  5A1G A;  2E5L C;  4BBY A;  4DCV A;  3NYR A;  1P7L A;  1XNQ C;  4NOZ A;  5BUS A;  2Y27 A;  4RLF A;  4DV1 C;  4RVN A;  5ADZ A;  4RM3 A;  1N33 C;  3EQ6 A;  5IFI A;  4DCU A;  4D56 A;  4FUQ A;  2P20 A;  4ISB A;  4DV7 C;  4JI6 C;  5A2Q D;  3GR1 A;  5LMU C;  2CXC A;  2JMP A;  5K8F A;  2QL8 A;  2UU9 C;  3VNQ A;  4RVO A;  2UXC C;  2UUB C;  4G37 A;  4BCA A;  5BR8 C;  3CW8 X;  5CZX A;  1XNR C;  2E8F A;  4JM1 A;  5GTD A;  4LF6 C;  4B3T C;  4PHT A;  2P2J A;  1XRA A;  1FJG C;  4MTN A;  3IML A;  3N2Q A;  2DYJ A;  5IT9 D;  4NXM C;  4JYA C;  2D1S A;  3CW9 A;  4MH4 A;  4U5Y D;  3GKU A;  3PBK A;  4L2Z A;  3NPD A;  5A1I A;  4DR7 C;  1USP B;  3LUS A;  2E8E A;  3TQI A;  4IZ6 A;  4JI4 C;  1O92 A;  4TPS B;  5LMN C;  1MDB A;  3AF5 A;  1O90 A;  4GXR A;  2YWC A;  4R1M A;  4I9F A;  4DG9 A;  2E0G A;  1BA3 A;  2Y4N A;  4JI0 C;  2WD9 A;  4L7I A;  2XR1 A;  4KHP C;  2UXB C;  4FTF A;  4DCS A;  4BC9 A;  3LGX A;  4YY3 C;  4BSZ A;  5DV9 A;  4KTV A;  4ODJ A;  1LCI A;  4DR3 C;  2AYA A;  3L8C A;  5KEI A;  2E8C A;  5T8S A;  4GS5 A;  4LFC C;  4OX9 C;  4NXN C;  4GKK C;  4LF8 C;  3FCC A;  4LF7 C;  3RG2 A;  4DR2 C;  1T5H X;  1HNZ C;  1IBM C;  4DUY C;  4L4Q A;  1O9T A;  4JI5 C;  1MD9 A;  1MXB A;  1JOS A;  4D57 A;  4LF4 C;  4G36 A;  1NYE A;  3A9V A;  4WS9 A;  3OTO C;  2ASB A;  2E7G A;  3S82 A;  2VQE C;  1MXA A;  3T1Y C;  1O93 A;  1YJ7 A;  4DV0 C;  4X65 C;  5K85 A;  1USP A;  1V25 A;  5BSV A;  3IEU A;  5BST A;  2UUC C;  2PT7 G;  2QVY X;  2PRO A;  2P2B A;  1QM4 A;  5A19 A;  5BSW A;  4LE5 A;  4LF5 C;  1PG4 A;  2QW0 X;  5AE3 A;  2F4V C;  3I08 A;  1ZB9 A;  5KYV A;  3JAM D;  4K0B A;  2EGT A;  2D7V A;  3N54 B;  4D4G A;  1HR0 C;  3A9U A;  1WH9 A;  3GPC A;  3ETO A;  3T1H C;  3UZ0 A;  4DV5 C;  4DV3 C;  3I07 A;  5BUQ A;  1HNW C;  3FCE A;  4FUT A;  3TDE A;  1MXC A;  1ML8 A;  4DCT A;  1IBL C;  1HNX C;  5T8T A;  1FUG A;  3NYQ A;  4BC7 A;  2D27 A;  4JI3 C;  3G7S A;  2BH1 X;  4G1I A;  4LFA C;  1N36 C;  1XRC A;  4JI7 C;  4YHH C;  1PG3 A;  2ZM6 C;  2D1Q A;  1WF3 A;  3KXW A;  4R0M A;  4WV3 A;  4IR7 A;  1RG9 A;  4DV6 C;  4NDN A;  2Y4O A;  4DR5 C;  4JI8 C;  4DV4 C;  1LQL A;  1AMU A;  2KZF A;  3R9X A;  5CZV A;  3IPL A;  4LF9 C;  5FLX D;  3IEV A;  4LFB C;  4RLQ A;  1ZB8 A;  1MKY A;  1T5D X;  3C5E A;  2QVZ X;  4ZLP A;  5E7Q A;  3DLP X;  2D1R A;  2OPL B;  3R44 A;  2OO4 A;  2P2Q A;  4D4I A;  4PRO C;  4I9G A;  2HJG A;  2UUA C;  5BSM A;  1L2F A;  1UKK A;  2ONF A;  4PZP A;  3EER A;  2CY1 A;  5BSU A;  4B3S C;  2YWB A;  5H9U A;  1XRB A;  2P2F A;  4RMN A;  2BJO A;  4KTT A;  3L95 X;  4XX2 A;  3H2T A;  4OYC A;  4ZJZ A;  3LNV A;  4K0K C;  3GR0 A;  3J80 D;  1V26 A;  5KYT A;  5BUR A;  1RY2 A;  2HHH C;  5BSR A;  4DUZ C;  4DR6 C;  1XMO C;  1I94 C;  3UOW A;  3LAX A;  3E7X A;  1IBK C;  3PRO C;  4GKJ C;  2P2M A;  2D1T A;  3VNR A;  2D28 C;  3DHV A;  3AF6 A;  1HH2 P;  4AQY C;  4B3R C;  4HPV A;  2PN2 A;  4JV5 C;  1KKG A;  4JI2 C;  3DAY A;  4OXI A;  1VLA A;  3SO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...