2QL8A

Crystal structure of a putative redox protein (lsei_0423) from lactobacillus casei atcc 334 at 1.50 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
MQDERWNHPLYTTTAINDEELEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRVKVAFIGARAEYQFLVHAQVMVKGVDFDTAKAFTNEIENRCPVSKLLKNSGNYTIETVTDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative redox protein
publication title Crystal structure of putative redox protein (YP_805721.1) from Lactobacillus casei ATCC 334 at 1.50 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2ql8A00
1USPB 3EERA 1HNXC 1ML8A 4JI7C 5BR8C 4JI3C 4GKKC 2UXCC 4AQYC 2ATWA 4LF6C 5IT9D 4JV5C 2QL8A 2BJOA 4X65C 1FJGC 3R9WA 4LF8C 1N34C 3AF6A 1ZB8A 1EGAA 3IEVA 1N33C 2OPLB 2UUAC 1KKGA 4KHPC 1USPA 4MH4A 2ONFA 4JI8C 1K0RA 1HNWC 2ASBA 4DCVA 1QWIA 4BSZA 3AF5A 4DR5C 4JI6C 1UKKA 3CJEA 2JMPA 4DV2C 2PT7G 4DV3C 4DR2C 4DCSA 4DV0C 2UU9C 5IWAC 1LQLA 2OPLA 2E8EA 1N32C 4DCTA 4X62C 4K0KC 2CXCA 3T1YC 4XX2A 2EGTA 2UXDC 4JI0C 5LMNC 4NOZA 4MTNA 1NYEA 1WF3A 4LF4C 3I07A 4DR1C 4DR6C 4DR7C 2VQFC 3IEUA 4LFAC 2XR1A 2DYJA 4X64C 1XNRC 2D7VA 1I94C 4LFCC 3LUSA 2F4VC 3JAMD 1WH9A 2PN2A 4DR3C 1IBMC 2UXBC 2YCBA 4DUYC 4DV6C 4DR4C 4LF7C 4JI1C 3T1HC 2E5LC 3R9XA 1L2FA 4X66C 1XMOC 2HHHC 3GKUA 4B3SC 5FLXD 4JI4C 1MKYA 4B3MC 1N2FA 5A2QD 4DV4C 2ZM6C 1HR0C 4YHHC 2E8FA 1IBLC 4B3RC 1JOSA 4GKJC 1PA4A 4DV1C 5LMUC 4DCUA 4LFBC 4JYAC 4JI2C 2UUCC 4NXNC 4LF5C 4OX9C 1XNQC 4NXMC 2E7GA 1IBKC 2CY1A 2HJGA 2KZFA 1HH2P 4B3TC 1HNZC 2E8CA 4LF9C 1VLAA 1ZB9A 4YY3C 3J80D 4DV5C 3OTOC 1J5EC 4DUZC 2UUBC 1N36C 1XMQC 2VQEC 4DV7C 4JI5C 3J81D
chains in the Genus database with same CATH superfamily
1HNXC 1ML8A 1V60A 4LE5A 3NPDA 4JI3C 2UXCC 4FTFA 2ATWA 4BC7A 1T5HX 4G1IA 2BJOA 5K8FA 3R9WA 3LNVA 2P20A 1USPA 3N54B 4MH4A 4GXQA 4L2ZA 1K0RA 1HNWC 4DCVA 1QWIA 4BSZA 2Y4NA 3H2TA 4FUQA 4DR2C 4DCSA 2ZZNA 1V26A 1LQLA 3IPLA 2Y4OA 3T1YC 3N2QA 4RM2A 4JI0C 4MTNA 3I07A 4WS9A 1MDFA 4K0BA 4D4IA 4DR6C 1PG3A 2VQFC 1RG9A 3IEUA 4D4GA 2XR1A 1XNRC 1I94C 4LFCC 3JAMD 2OBVA 2D1SA 3RG2A 4BBYA 2D27A 5DV9A 3VNRA 3R9XA 4G36A 2HHHC 2E0GA 1NY8A 1MKYA 1P4EC 1M6XC 1MDBA 1TH5A 2YWBA 2D1RA 2P2MA 2E8FA 1IBLC 1JOSA 5BUSA 4L4QA 1O9TA 1VEHA 4DCUA 1MXCA 4JYAC 4JI2C 2UUCC 4ZLPA 3SO4A 1IBKC 4I9GA 4YY3C 1J5EC 4TPSB 4DUZC 4R1LA 1N36C 1XMQC 2JNVA 3UOWA 2V7BA 4RVNA 4AQYC 4PUHA 1FJGC 1MXBA 4LF8C 1N34C 3AF6A 3I08A 4PHTA 1YJ7A 4NDNA 3IEVA 3CW8X 2OPLB 3TQIA 1BA3A 2ASBA 3A9VA 4JI6C 3UX3A 1UKKA 4R0MA 3NI2A 4DV2C 1ULTA 1FUGA 2UU9C 1IB8A 1LCIA 4DCTA 3ETOA 4KTTA 2Y27A 2CXCA 2EGTA 1NYEA 4LF4C 3DLPX 2QVZX 5GTDA 2AYAA 1WH9A 2D1QA 2PN2A 4D57A 2YCBA 1WCJA 4LF7C 4R1MA 3R44A 4JI1C 1MD9A 5BSTA 2E5LC 5H9UA 1P7LA 1XMOC 3DHVA 5BSMA 5FLXD 1XRAA 4B3MC 4BC9A 2YX1A 4DG8A 2ZM6C 5KEIA 5KYVA 4ISBA 2MCQA 4B3RC 2P2QA 5K85A 3A4IA 1O93A 5A1GA 4OX9C 3ETCA 2P2FA 5A19A 2CY1A 1GPMA 4IR7A 2QVYX 2YWCA 4LF9C 3B7WA 1VLAA 3LGXA 4DV5C 1XS3A 2Z51A 2D1TA 4GS5A 4ODJA 3A25A 1USPB 3UZ0A 4GKKC 3CW9A 3KXWA 5IT9D 4RMNA 2VSQA 4JV5C 5BSWA 3G7SA 4RLQA 3CQ1A 3O2EA 4RM3A 1V25A 1N33C 1KKGA 4KHPC 3L95X 4JI8C 4IZ6A 3E7XA 3CJEA 4DV0C 4PUIA 3PROC 1UWDA 1PG4A 1XHJA 4X62C 3TDEA 2MMAB 4K0KC 4XX2A 3L8CA 5LMNC 1WF3A 3S82A 3LAXA 3LNOA 3A26A 3NYQA 4LFAC 3FCCA 2PROA 2D7VA 3LUSA 3RV2A 4DR3C 4DR4C 2DPLA 1L2FA 4L7IA 4X66C 5BSVA 3GKUA 5CZXA 4U5YD 5IFIA 1N2FA 3PBKA 4KTVA 1XRCA 4I9FA 5E7QA 3TUFA 3VNSA 1MXAA 3UEBA 3VNQA 4DV1C 4PUGA 5LMUC 1FLOA 5LCIA 3NYRA 2WD9A 1XNQC 5KYTA 4NXMC 5JRHA 2KZFA 1HH2P 4B3TC 1HNZC 2E8CA 4OYCA 2QW0X 3J80D 1O92A 2KDNA 2QVXX 4JM1A 5AE3A 3EERA 3CQ3A 3IMLA 4JI7C 5BR8C 3K6RA 4LF6C 1P4EA 2QL8A 1M6XA 4X65C 2OO4A 2DHMA 3GR1A 4WV3A 1ZB8A 2NCLA 1EGAA 2UUAC 1XRBA 4PZPA 2ONFA 3TR3A 5AE1A 3AF5A 4DR5C 3C5EA 2JMPA 4G37A 1AMUA 2PT7G 5BURA 4DV3C 4OXIA 2P2JA 5IWAC 3UX2A 2OPLA 2E8EA 2MM9A 1N32C 4EATA 5T8SA 2UXDC 4RVOA 5AE2A 4NOZA 1PU1A 2P2BA 3EQ6A 4DR1C 2KZ0A 4DR7C 1T5DX 4BCAA 2DYJA 4HPVA 4X64C 2F4VC 4RLFA 1IBMC 2UXBC 4DUYC 4DV6C 3PESA 3T1HC 3CQ2A 2P02A 4B3SC 5BSRA 4JI4C 5A2QD 3GR0A 4DV4C 1HR0C 1O90A 4YHHC 3E7WA 2ZZMA 4ZJZA 4GKJC 1PA4A 4D56A 4DG9A 2M5OA 2BH1X 4LFBC 2WP0C 5ADZA 4NXNC 3FCEA 5BUQA 4LF5C 4GXRA 2D28C 4PROC 2E7GA 2M5HA 2HJGA 3DAYA 2CU6A 1RY2A 3A9UA 5T8TA 3AY0A 1QM4A 1ZB9A 3OTOC 5CZVA 2UUBC 5A1IA 5BSUA 2VZEA 2VQEC 4DV7C 4JI5C 3J81D 3GPCA 4FUTA
chains in the Genus database with same CATH topology
1HNXC 1ML8A 4LE5A 3NPDA 4JI3C 2UXCC 4FTFA 2ATWA 4BC7A 1T5HX 4G1IA 2BJOA 5K8FA 3R9WA 3LNVA 2P20A 1USPA 3N54B 4MH4A 4GXQA 4L2ZA 1K0RA 1HNWC 4DCVA 1QWIA 4BSZA 2Y4NA 3H2TA 4FUQA 4DR2C 4DCSA 1V26A 1LQLA 3IPLA 2Y4OA 3T1YC 3N2QA 4RM2A 4JI0C 4MTNA 3I07A 4WS9A 1MDFA 4K0BA 4D4IA 4DR6C 1PG3A 2VQFC 1RG9A 3IEUA 4D4GA 2XR1A 1XNRC 1I94C 4LFCC 3JAMD 2OBVA 2D1SA 3RG2A 4BBYA 2D27A 5DV9A 3VNRA 3R9XA 4G36A 2HHHC 2E0GA 1MKYA 1MDBA 2YWBA 2D1RA 2P2MA 2E8FA 1IBLC 1JOSA 5BUSA 4L4QA 1O9TA 4DCUA 1MXCA 4JYAC 4JI2C 2UUCC 4ZLPA 3SO4A 1IBKC 4I9GA 4YY3C 1J5EC 4TPSB 4DUZC 4R1LA 1N36C 1XMQC 3UOWA 2V7BA 4RVNA 4AQYC 1FJGC 1MXBA 4LF8C 1N34C 3AF6A 3I08A 4PHTA 1YJ7A 4NDNA 3IEVA 3CW8X 2OPLB 3TQIA 1BA3A 2ASBA 3A9VA 4JI6C 1UKKA 4R0MA 3NI2A 4DV2C 1ULTA 1FUGA 2UU9C 1LCIA 4DCTA 3ETOA 4KTTA 2Y27A 2CXCA 2EGTA 1NYEA 4LF4C 3DLPX 2QVZX 5GTDA 2AYAA 1WH9A 2D1QA 2PN2A 4D57A 2YCBA 4LF7C 4R1MA 3R44A 4JI1C 1MD9A 5BSTA 2E5LC 5H9UA 1P7LA 1XMOC 3DHVA 5BSMA 5FLXD 1XRAA 4B3MC 4BC9A 4DG8A 2ZM6C 5KEIA 5KYVA 4ISBA 4B3RC 2P2QA 5K85A 3A4IA 1O93A 5A1GA 4OX9C 3ETCA 2P2FA 5A19A 2CY1A 1GPMA 4IR7A 2QVYX 2YWCA 4LF9C 3B7WA 1VLAA 3LGXA 4DV5C 2D1TA 4GS5A 4ODJA 1USPB 3UZ0A 4GKKC 3CW9A 3KXWA 5IT9D 4RMNA 2VSQA 4JV5C 5BSWA 3G7SA 4RLQA 4RM3A 1V25A 1N33C 1KKGA 4KHPC 3L95X 4JI8C 4IZ6A 3E7XA 3CJEA 4DV0C 3PROC 1PG4A 4X62C 3TDEA 4K0KC 4XX2A 3L8CA 5LMNC 1WF3A 3S82A 3LAXA 4LFAC 3NYQA 3FCCA 2PROA 2D7VA 3LUSA 3RV2A 4DR3C 4DR4C 2DPLA 1L2FA 4L7IA 4X66C 5BSVA 3GKUA 5CZXA 4U5YD 5IFIA 1N2FA 3PBKA 4KTVA 1XRCA 4I9FA 5E7QA 3TUFA 3VNSA 1MXAA 3VNQA 4DV1C 5LMUC 3NYRA 2WD9A 1XNQC 5KYTA 4NXMC 5JRHA 2KZFA 1HH2P 4B3TC 1HNZC 2E8CA 4OYCA 2QW0X 3J80D 1O92A 2QVXX 4JM1A 5AE3A 3EERA 3IMLA 4JI7C 5BR8C 4LF6C 2QL8A 4X65C 2OO4A 3GR1A 4WV3A 1ZB8A 1EGAA 2UUAC 1XRBA 4PZPA 2ONFA 5AE1A 3AF5A 4DR5C 3C5EA 2JMPA 4G37A 1AMUA 2PT7G 5BURA 4DV3C 4OXIA 2P2JA 5IWAC 2OPLA 2E8EA 1N32C 4EATA 5T8SA 2UXDC 4RVOA 5AE2A 4NOZA 2P2BA 3EQ6A 4DR1C 4DR7C 1T5DX 4BCAA 2DYJA 4HPVA 4X64C 2F4VC 4RLFA 1IBMC 2UXBC 4DUYC 4DV6C 3PESA 3T1HC 2P02A 4B3SC 5BSRA 4JI4C 5A2QD 3GR0A 4DV4C 1HR0C 1O90A 4YHHC 3E7WA 4ZJZA 4GKJC 1PA4A 4D56A 4DG9A 2BH1X 4LFBC 2WP0C 5ADZA 4NXNC 3FCEA 5BUQA 4LF5C 4GXRA 2D28C 4PROC 2E7GA 2HJGA 3DAYA 1RY2A 3A9UA 5T8TA 1QM4A 1ZB9A 3OTOC 5CZVA 2UUBC 5A1IA 5BSUA 2VZEA 2VQEC 4DV7C 4JI5C 3J81D 3GPCA 4FUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP B;  3EER A;  1HNX C;  1ML8 A;  4JI7 C;  5BR8 C;  4JI3 C;  4GKK C;  2UXC C;  4AQY C;  2ATW A;  4LF6 C;  5IT9 D;  4JV5 C;  2QL8 A;  2BJO A;  4X65 C;  1FJG C;  3R9W A;  4LF8 C;  1N34 C;  3AF6 A;  1ZB8 A;  1EGA A;  3IEV A;  1N33 C;  2OPL B;  2UUA C;  1KKG A;  4KHP C;  1USP A;  4MH4 A;  2ONF A;  4JI8 C;  1K0R A;  1HNW C;  2ASB A;  4DCV A;  1QWI A;  4BSZ A;  3AF5 A;  4DR5 C;  4JI6 C;  1UKK A;  3CJE A;  2JMP A;  4DV2 C;  2PT7 G;  4DV3 C;  4DR2 C;  4DCS A;  4DV0 C;  2UU9 C;  5IWA C;  1LQL A;  2OPL A;  2E8E A;  1N32 C;  4DCT A;  4X62 C;  4K0K C;  2CXC A;  3T1Y C;  4XX2 A;  2EGT A;  2UXD C;  4JI0 C;  5LMN C;  4NOZ A;  4MTN A;  1NYE A;  1WF3 A;  4LF4 C;  3I07 A;  4DR1 C;  4DR6 C;  4DR7 C;  2VQF C;  3IEU A;  4LFA C;  2XR1 A;  2DYJ A;  4X64 C;  1XNR C;  2D7V A;  1I94 C;  4LFC C;  3LUS A;  2F4V C;  3JAM D;  1WH9 A;  2PN2 A;  4DR3 C;  1IBM C;  2UXB C;  2YCB A;  4DUY C;  4DV6 C;  4DR4 C;  4LF7 C;  4JI1 C;  3T1H C;  2E5L C;  3R9X A;  1L2F A;  4X66 C;  1XMO C;  2HHH C;  3GKU A;  4B3S C;  5FLX D;  4JI4 C;  1MKY A;  4B3M C;  1N2F A;  5A2Q D;  4DV4 C;  2ZM6 C;  1HR0 C;  4YHH C;  2E8F A;  1IBL C;  4B3R C;  1JOS A;  4GKJ C;  1PA4 A;  4DV1 C;  5LMU C;  4DCU A;  4LFB C;  4JYA C;  4JI2 C;  2UUC C;  4NXN C;  4LF5 C;  4OX9 C;  1XNQ C;  4NXM C;  2E7G A;  1IBK C;  2CY1 A;  2HJG A;  2KZF A;  1HH2 P;  4B3T C;  1HNZ C;  2E8C A;  4LF9 C;  1VLA A;  1ZB9 A;  4YY3 C;  3J80 D;  4DV5 C;  3OTO C;  1J5E C;  4DUZ C;  2UUB C;  1N36 C;  1XMQ C;  2VQE C;  4DV7 C;  4JI5 C;  3J81 D; 
#chains in the Genus database with same CATH topology
 1HNX C;  1ML8 A;  1V60 A;  4LE5 A;  3NPD A;  4JI3 C;  2UXC C;  4FTF A;  2ATW A;  4BC7 A;  1T5H X;  4G1I A;  2BJO A;  5K8F A;  3R9W A;  3LNV A;  2P20 A;  1USP A;  3N54 B;  4MH4 A;  4GXQ A;  4L2Z A;  1K0R A;  1HNW C;  4DCV A;  1QWI A;  4BSZ A;  2Y4N A;  3H2T A;  4FUQ A;  4DR2 C;  4DCS A;  2ZZN A;  1V26 A;  1LQL A;  3IPL A;  2Y4O A;  3T1Y C;  3N2Q A;  4RM2 A;  4JI0 C;  4MTN A;  3I07 A;  4WS9 A;  1MDF A;  4K0B A;  4D4I A;  4DR6 C;  1PG3 A;  2VQF C;  1RG9 A;  3IEU A;  4D4G A;  2XR1 A;  1XNR C;  1I94 C;  4LFC C;  3JAM D;  2OBV A;  2D1S A;  3RG2 A;  4BBY A;  2D27 A;  5DV9 A;  3VNR A;  3R9X A;  4G36 A;  2HHH C;  2E0G A;  1NY8 A;  1MKY A;  1P4E C;  1M6X C;  1MDB A;  1TH5 A;  2YWB A;  2D1R A;  2P2M A;  2E8F A;  1IBL C;  1JOS A;  5BUS A;  4L4Q A;  1O9T A;  1VEH A;  4DCU A;  1MXC A;  4JYA C;  4JI2 C;  2UUC C;  4ZLP A;  3SO4 A;  1IBK C;  4I9G A;  4YY3 C;  1J5E C;  4TPS B;  4DUZ C;  4R1L A;  1N36 C;  1XMQ C;  2JNV A;  3UOW A;  2V7B A;  4RVN A;  4AQY C;  4PUH A;  1FJG C;  1MXB A;  4LF8 C;  1N34 C;  3AF6 A;  3I08 A;  4PHT A;  1YJ7 A;  4NDN A;  3IEV A;  3CW8 X;  2OPL B;  3TQI A;  1BA3 A;  2ASB A;  3A9V A;  4JI6 C;  3UX3 A;  1UKK A;  4R0M A;  3NI2 A;  4DV2 C;  1ULT A;  1FUG A;  2UU9 C;  1IB8 A;  1LCI A;  4DCT A;  3ETO A;  4KTT A;  2Y27 A;  2CXC A;  2EGT A;  1NYE A;  4LF4 C;  3DLP X;  2QVZ X;  5GTD A;  2AYA A;  1WH9 A;  2D1Q A;  2PN2 A;  4D57 A;  2YCB A;  1WCJ A;  4LF7 C;  4R1M A;  3R44 A;  4JI1 C;  1MD9 A;  5BST A;  2E5L C;  5H9U A;  1P7L A;  1XMO C;  3DHV A;  5BSM A;  5FLX D;  1XRA A;  4B3M C;  4BC9 A;  2YX1 A;  4DG8 A;  2ZM6 C;  5KEI A;  5KYV A;  4ISB A;  2MCQ A;  4B3R C;  2P2Q A;  5K85 A;  3A4I A;  1O93 A;  5A1G A;  4OX9 C;  3ETC A;  2P2F A;  5A19 A;  2CY1 A;  1GPM A;  4IR7 A;  2QVY X;  2YWC A;  4LF9 C;  3B7W A;  1VLA A;  3LGX A;  4DV5 C;  1XS3 A;  2Z51 A;  2D1T A;  4GS5 A;  4ODJ A;  3A25 A;  1USP B;  3UZ0 A;  4GKK C;  3CW9 A;  3KXW A;  5IT9 D;  4RMN A;  2VSQ A;  4JV5 C;  5BSW A;  3G7S A;  4RLQ A;  3CQ1 A;  3O2E A;  4RM3 A;  1V25 A;  1N33 C;  1KKG A;  4KHP C;  3L95 X;  4JI8 C;  4IZ6 A;  3E7X A;  3CJE A;  4DV0 C;  4PUI A;  3PRO C;  1UWD A;  1PG4 A;  1XHJ A;  4X62 C;  3TDE A;  2MMA B;  4K0K C;  4XX2 A;  3L8C A;  5LMN C;  1WF3 A;  3S82 A;  3LAX A;  3LNO A;  3A26 A;  3NYQ A;  4LFA C;  3FCC A;  2PRO A;  2D7V A;  3LUS A;  3RV2 A;  4DR3 C;  4DR4 C;  2DPL A;  1L2F A;  4L7I A;  4X66 C;  5BSV A;  3GKU A;  5CZX A;  4U5Y D;  5IFI A;  1N2F A;  3PBK A;  4KTV A;  1XRC A;  4I9F A;  5E7Q A;  3TUF A;  3VNS A;  1MXA A;  3UEB A;  3VNQ A;  4DV1 C;  4PUG A;  5LMU C;  1FLO A;  5LCI A;  3NYR A;  2WD9 A;  1XNQ C;  5KYT A;  4NXM C;  5JRH A;  2KZF A;  1HH2 P;  4B3T C;  1HNZ C;  2E8C A;  4OYC A;  2QW0 X;  3J80 D;  1O92 A;  2KDN A;  2QVX X;  4JM1 A;  5AE3 A;  3EER A;  3CQ3 A;  3IML A;  4JI7 C;  5BR8 C;  3K6R A;  4LF6 C;  1P4E A;  2QL8 A;  1M6X A;  4X65 C;  2OO4 A;  2DHM A;  3GR1 A;  4WV3 A;  1ZB8 A;  2NCL A;  1EGA A;  2UUA C;  1XRB A;  4PZP A;  2ONF A;  3TR3 A;  5AE1 A;  3AF5 A;  4DR5 C;  3C5E A;  2JMP A;  4G37 A;  1AMU A;  2PT7 G;  5BUR A;  4DV3 C;  4OXI A;  2P2J A;  5IWA C;  3UX2 A;  2OPL A;  2E8E A;  2MM9 A;  1N32 C;  4EAT A;  5T8S A;  2UXD C;  4RVO A;  5AE2 A;  4NOZ A;  1PU1 A;  2P2B A;  3EQ6 A;  4DR1 C;  2KZ0 A;  4DR7 C;  1T5D X;  4BCA A;  2DYJ A;  4HPV A;  4X64 C;  2F4V C;  4RLF A;  1IBM C;  2UXB C;  4DUY C;  4DV6 C;  3PES A;  3T1H C;  3CQ2 A;  2P02 A;  4B3S C;  5BSR A;  4JI4 C;  5A2Q D;  3GR0 A;  4DV4 C;  1HR0 C;  1O90 A;  4YHH C;  3E7W A;  2ZZM A;  4ZJZ A;  4GKJ C;  1PA4 A;  4D56 A;  4DG9 A;  2M5O A;  2BH1 X;  4LFB C;  2WP0 C;  5ADZ A;  4NXN C;  3FCE A;  5BUQ A;  4LF5 C;  4GXR A;  2D28 C;  4PRO C;  2E7G A;  2M5H A;  2HJG A;  3DAY A;  2CU6 A;  1RY2 A;  3A9U A;  5T8T A;  3AY0 A;  1QM4 A;  1ZB9 A;  3OTO C;  5CZV A;  2UUB C;  5A1I A;  5BSU A;  2VZE A;  2VQE C;  4DV7 C;  4JI5 C;  3J81 D;  3GPC A;  4FUT A; 
#chains in the Genus database with same CATH homology
 1HNX C;  1ML8 A;  4LE5 A;  3NPD A;  4JI3 C;  2UXC C;  4FTF A;  2ATW A;  4BC7 A;  1T5H X;  4G1I A;  2BJO A;  5K8F A;  3R9W A;  3LNV A;  2P20 A;  1USP A;  3N54 B;  4MH4 A;  4GXQ A;  4L2Z A;  1K0R A;  1HNW C;  4DCV A;  1QWI A;  4BSZ A;  2Y4N A;  3H2T A;  4FUQ A;  4DR2 C;  4DCS A;  1V26 A;  1LQL A;  3IPL A;  2Y4O A;  3T1Y C;  3N2Q A;  4RM2 A;  4JI0 C;  4MTN A;  3I07 A;  4WS9 A;  1MDF A;  4K0B A;  4D4I A;  4DR6 C;  1PG3 A;  2VQF C;  1RG9 A;  3IEU A;  4D4G A;  2XR1 A;  1XNR C;  1I94 C;  4LFC C;  3JAM D;  2OBV A;  2D1S A;  3RG2 A;  4BBY A;  2D27 A;  5DV9 A;  3VNR A;  3R9X A;  4G36 A;  2HHH C;  2E0G A;  1MKY A;  1MDB A;  2YWB A;  2D1R A;  2P2M A;  2E8F A;  1IBL C;  1JOS A;  5BUS A;  4L4Q A;  1O9T A;  4DCU A;  1MXC A;  4JYA C;  4JI2 C;  2UUC C;  4ZLP A;  3SO4 A;  1IBK C;  4I9G A;  4YY3 C;  1J5E C;  4TPS B;  4DUZ C;  4R1L A;  1N36 C;  1XMQ C;  3UOW A;  2V7B A;  4RVN A;  4AQY C;  1FJG C;  1MXB A;  4LF8 C;  1N34 C;  3AF6 A;  3I08 A;  4PHT A;  1YJ7 A;  4NDN A;  3IEV A;  3CW8 X;  2OPL B;  3TQI A;  1BA3 A;  2ASB A;  3A9V A;  4JI6 C;  1UKK A;  4R0M A;  3NI2 A;  4DV2 C;  1ULT A;  1FUG A;  2UU9 C;  1LCI A;  4DCT A;  3ETO A;  4KTT A;  2Y27 A;  2CXC A;  2EGT A;  1NYE A;  4LF4 C;  3DLP X;  2QVZ X;  5GTD A;  2AYA A;  1WH9 A;  2D1Q A;  2PN2 A;  4D57 A;  2YCB A;  4LF7 C;  4R1M A;  3R44 A;  4JI1 C;  1MD9 A;  5BST A;  2E5L C;  5H9U A;  1P7L A;  1XMO C;  3DHV A;  5BSM A;  5FLX D;  1XRA A;  4B3M C;  4BC9 A;  4DG8 A;  2ZM6 C;  5KEI A;  5KYV A;  4ISB A;  4B3R C;  2P2Q A;  5K85 A;  3A4I A;  1O93 A;  5A1G A;  4OX9 C;  3ETC A;  2P2F A;  5A19 A;  2CY1 A;  1GPM A;  4IR7 A;  2QVY X;  2YWC A;  4LF9 C;  3B7W A;  1VLA A;  3LGX A;  4DV5 C;  2D1T A;  4GS5 A;  4ODJ A;  1USP B;  3UZ0 A;  4GKK C;  3CW9 A;  3KXW A;  5IT9 D;  4RMN A;  2VSQ A;  4JV5 C;  5BSW A;  3G7S A;  4RLQ A;  4RM3 A;  1V25 A;  1N33 C;  1KKG A;  4KHP C;  3L95 X;  4JI8 C;  4IZ6 A;  3E7X A;  3CJE A;  4DV0 C;  3PRO C;  1PG4 A;  4X62 C;  3TDE A;  4K0K C;  4XX2 A;  3L8C A;  5LMN C;  1WF3 A;  3S82 A;  3LAX A;  4LFA C;  3NYQ A;  3FCC A;  2PRO A;  2D7V A;  3LUS A;  3RV2 A;  4DR3 C;  4DR4 C;  2DPL A;  1L2F A;  4L7I A;  4X66 C;  5BSV A;  3GKU A;  5CZX A;  4U5Y D;  5IFI A;  1N2F A;  3PBK A;  4KTV A;  1XRC A;  4I9F A;  5E7Q A;  3TUF A;  3VNS A;  1MXA A;  3VNQ A;  4DV1 C;  5LMU C;  3NYR A;  2WD9 A;  1XNQ C;  5KYT A;  4NXM C;  5JRH A;  2KZF A;  1HH2 P;  4B3T C;  1HNZ C;  2E8C A;  4OYC A;  2QW0 X;  3J80 D;  1O92 A;  2QVX X;  4JM1 A;  5AE3 A;  3EER A;  3IML A;  4JI7 C;  5BR8 C;  4LF6 C;  2QL8 A;  4X65 C;  2OO4 A;  3GR1 A;  4WV3 A;  1ZB8 A;  1EGA A;  2UUA C;  1XRB A;  4PZP A;  2ONF A;  5AE1 A;  3AF5 A;  4DR5 C;  3C5E A;  2JMP A;  4G37 A;  1AMU A;  2PT7 G;  5BUR A;  4DV3 C;  4OXI A;  2P2J A;  5IWA C;  2OPL A;  2E8E A;  1N32 C;  4EAT A;  5T8S A;  2UXD C;  4RVO A;  5AE2 A;  4NOZ A;  2P2B A;  3EQ6 A;  4DR1 C;  4DR7 C;  1T5D X;  4BCA A;  2DYJ A;  4HPV A;  4X64 C;  2F4V C;  4RLF A;  1IBM C;  2UXB C;  4DUY C;  4DV6 C;  3PES A;  3T1H C;  2P02 A;  4B3S C;  5BSR A;  4JI4 C;  5A2Q D;  3GR0 A;  4DV4 C;  1HR0 C;  1O90 A;  4YHH C;  3E7W A;  4ZJZ A;  4GKJ C;  1PA4 A;  4D56 A;  4DG9 A;  2BH1 X;  4LFB C;  2WP0 C;  5ADZ A;  4NXN C;  3FCE A;  5BUQ A;  4LF5 C;  4GXR A;  2D28 C;  4PRO C;  2E7G A;  2HJG A;  3DAY A;  1RY2 A;  3A9U A;  5T8T A;  1QM4 A;  1ZB9 A;  3OTO C;  5CZV A;  2UUB C;  5A1I A;  5BSU A;  2VZE A;  2VQE C;  4DV7 C;  4JI5 C;  3J81 D;  3GPC A;  4FUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...