2QL8A

Crystal structure of a putative redox protein (lsei_0423) from lactobacillus casei atcc 334 at 1.50 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
MQDERWNHPLYTTTAINDEELEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRVKVAFIGARAEYQFLVHAQVMVKGVDFDTAKAFTNEIENRCPVSKLLKNSGNYTIETVTDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative redox protein (YP_805721.1) from Lactobacillus casei ATCC 334 at 1.50 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords Putative redox protein
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2ql8A00
3AF5A 1FJGC 2CY1A 4NOZA 2CXCA 2ZM6C 4DUYC 3R9WA 1KKGA 2ASBA 4DV0C 1HNZC 4KHPC 1IBKC 2UUCC 2PN2A 4OX9C 4LFCC 4B3TC 1ZB8A 1VLAA 4LFAC 1N34C 2UXBC 2OPLB 4B3RC 2E8CA 2HJGA 1N33C 4JI0C 4AQYC 2YCBA 4DCTA 4MTNA 4DR2C 3T1YC 1N32C 4DV1C 1N36C 2UU9C 1XNRC 5LMUC 2OPLA 4JI7C 2QL8A 1JOSA 4JYAC 1HH2P 2VQEC 2KZFA 4LF4C 3IEUA 4LFBC 1XMOC 1IBMC 4DR5C 4DR1C 4LF9C 4DCSA 2UXCC 1HNWC 2BJOA 1L2FA 4B3SC 2UXDC 2XR1A 5IWAC 1J5EC 4YY3C 2PT7G 4MH4A 5FLXD 4X64C 2F4VC 4DR3C 3J81D 4K0KC 5A2QD 3R9XA 2HHHC 3EERA 4X65C 3IEVA 4LF6C 4DV4C 1WF3A 4NXMC 1I94C 4DCUA 4DR6C 3J80D 4DV7C 2E7GA 4LF8C 1K0RA 1USPA 2E8EA 4LF5C 2ATWA 4X62C 4DR7C 1NYEA 5LMNC 4B3MC 1PA4A 3T1HC 2DYJA 1EGAA 3LUSA 4X66C 2UUBC 1WH9A 4JV5C 1ZB9A 4XX2A 3I07A 1XNQC 5IT9D 4JI1C 4JI2C 1UKKA 4BSZA 2VQFC 2EGTA 1LQLA 4LF7C 1QWIA 4DV2C 2E5LC 4JI8C 4NXNC 3GKUA 2D7VA 4JI6C 4DV6C 4YHHC 1N2FA 2E8FA 4JI5C 2UUAC 1HNXC 4JI3C 2JMPA 2ONFA 4DR4C 1XMQC 4GKJC 1HR0C 3OTOC 4DUZC 4DCVA 3AF6A 3CJEA 4JI4C 4DV3C 5BR8C 4GKKC 1ML8A 3JAMD 1IBLC 1USPB 4DV5C 1MKYA
chains in the Genus database with same CATH superfamily
2YX1A 5A19A 5BSWA 1PU1A 2DHMA 2CXCA 4NOZA 1PG4A 4PZPA 4KHPC 3LNOA 4FUQA 5IFIA 2PN2A 1XRBA 4EATA 4B3TC 2HJGA 2YCBA 4DCTA 3CW8X 2MMAB 4MTNA 1XRCA 5GTDA 4DR2C 3T1YC 3NYQA 5BURA 2QL8A 5BSTA 2KZFA 4DR1C 1O93A 1GPMA 4JM1A 3N2QA 2QW0X 5BSRA 3AY0A 4IR7A 3UX3A 1J5EC 2QVZX 4OYCA 4BC7A 2PT7G 1FUGA 4X64C 5JRHA 3J81D 5A2QD 2AYAA 4L7IA 4X65C 4NXMC 2P20A 3RG2A 5K85A 2E8EA 4DG8A 4PUHA 4I9GA 3DAYA 4ODJA 2D28C 1PA4A 3T1HC 3LNVA 3L95X 4K0BA 2MM9A 1WH9A 4JV5C 2Y4NA 4JI2C 4RM3A 3B7WA 4LF7C 3GR1A 2JNVA 4ZJZA 3N54B 1MXCA 4NXNC 3GKUA 2MCQA 5AE2A 4R1LA 4JI3C 3K6RA 1M6XA 2D1TA 3NI2A 3TQIA 4GKJC 1MXBA 1V26A 5BR8C 2M5HA 4L2ZA 1IBLC 3IMLA 3DLPX 2CY1A 3R9WA 1UWDA 3A25A 2P2QA 5BUSA 1VEHA 4OX9C 1ZB8A 1VLAA 1N34C 1RY2A 4B3RC 4RLQA 1N33C 2VZEA 2P02A 2OBVA 4DV1C 4D4IA 1N36C 3IPLA 4KTVA 1HH2P 2VQEC 3A4IA 1P4EA 1TH5A 3C5EA 4DR5C 1IBMC 3PROC 2CU6A 3S82A 5BUQA 4B3SC 5IWAC 5BSVA 1YJ7A 1LCIA 4G36A 4YY3C 3ETOA 3GPCA 4MH4A 1O92A 4LE5A 5K8FA 2F4VC 4DR3C 2Y27A 2WD9A 3R9XA 3EERA 1XRAA 4LF6C 1WF3A 3PESA 2P2JA 4WS9A 3TR3A 1XHJA 4RVNA 2NCLA 5A1GA 4LF5C 2ATWA 5T8SA 1NYEA 4RMNA 4TPSB 4HPVA 3SO4A 5LMNC 4ZLPA 3PBKA 4B3MC 3A9UA 4FUTA 2DYJA 4U5YD 5DV9A 2QVYX 3ETCA 1XNQC 2EGTA 2E5LC 2YWCA 1N2FA 1MD9A 3E7WA 1HNXC 4L4QA 1XMQC 1HR0C 3OTOC 5LCIA 4DCVA 3UX2A 4DG9A 3JAMD 2D1QA 4D57A 4DV5C 1FJGC 3A26A 2ZM6C 1XS3A 1KKGA 4RM2A 3GR0A 2ASBA 4BBYA 2KZ0A 5BSMA 3VNQA 1HNZC 1IBKC 2YWBA 1MDFA 1QM4A 1P7LA 3LGXA 2ZZNA 5CZVA 2OPLB 1V25A 5ADZA 2E8CA 4PROC 4AQYC 4IZ6A 4D56A 4RVOA 1PG3A 2UU9C 1XNRC 5LMUC 2OPLA 4JI7C 5H9UA 1JOSA 2ZZMA 4JYAC 4LF4C 4LFBC 4LF9C 4DCSA 2UXCC 2E0GA 3NYRA 5A1IA 2BJOA 1L2FA 3UOWA 2D1SA 2UXDC 5KEIA 5CZXA 2V7BA 2WP0C 5FLXD 2D1RA 3VNRA 5E7QA 4K0KC 2Y4OA 4DV4C 2QVXX 1T5DX 2E7GA 4LF8C 3KXWA 1K0RA 2PROA 4NDNA 1USPA 4PUIA 4DR7C 3CQ2A 5BSUA 1NY8A 4X66C 3EQ6A 1ZB9A 4XX2A 4G37A 3UEBA 5IT9D 3FCCA 2VQFC 3CQ3A 5AE1A 4JI8C 4RLFA 3TUFA 1IB8A 1T5HX 4FTFA 4WV3A 2OO4A 2JMPA 1P4EC 3CQ1A 1O90A 4DUZC 4KTTA 1O9TA 3CJEA 4DV3C 4GS5A 1USPB 3VNSA 3AF5A 4DUYC 4G1IA 1MDBA 4DV0C 4GXQA 4OXIA 2UUCC 4LFCC 4LFAC 4GXRA 2KDNA 2UXBC 2Z51A 4JI0C 1N32C 1WCJA 3I08A 3FCEA 2P2BA 1M6XC 3IEUA 1XMOC 3H2TA 1HNWC 2P2FA 5KYVA 2M5OA 1RG9A 2XR1A 5AE3A 3E7XA 3O2EA 2HHHC 3RV2A 3IEVA 3A9VA 3DHVA 1I94C 4DCUA 1V60A 4DR6C 3J80D 4DV7C 5T8TA 4ISBA 3NPDA 3TDEA 3CW9A 2P2MA 4X62C 3G7SA 2VSQA 1FLOA 3UZ0A 1EGAA 3LUSA 2UUBC 3L8CA 4I9FA 3I07A 4PHTA 4JI1C 1UKKA 2D27A 4BSZA 1AMUA 2BH1X 1LQLA 1QWIA 4DV2C 1BA3A 2DPLA 1ULTA 2D7VA 4JI6C 4DV6C 4PUGA 4D4GA 4YHHC 4JI5C 2E8FA 4BCAA 4R0MA 2UUAC 1MXAA 5KYTA 2ONFA 4DR4C 4R1MA 3AF6A 3LAXA 4JI4C 4GKKC 1ML8A 4BC9A 3R44A 1MKYA
chains in the Genus database with same CATH topology
5A19A 5BSWA 4NOZA 2CXCA 1PG4A 4PZPA 4KHPC 4FUQA 5IFIA 2PN2A 1XRBA 4EATA 4B3TC 2HJGA 2YCBA 4DCTA 3CW8X 4MTNA 5GTDA 1XRCA 4DR2C 3T1YC 3NYQA 5BURA 2QL8A 5BSTA 2KZFA 4DR1C 1O93A 1GPMA 4JM1A 3N2QA 2QW0X 5BSRA 4IR7A 1J5EC 2QVZX 4OYCA 4BC7A 2PT7G 1FUGA 4X64C 5JRHA 3J81D 5A2QD 2AYAA 4L7IA 4X65C 4NXMC 2P20A 3RG2A 5K85A 2E8EA 4DG8A 4I9GA 3DAYA 4ODJA 2D28C 1PA4A 3T1HC 3LNVA 3L95X 4K0BA 1WH9A 4JV5C 2Y4NA 4JI2C 4RM3A 3B7WA 4LF7C 3GR1A 4ZJZA 3N54B 1MXCA 4NXNC 3GKUA 5AE2A 4R1LA 4JI3C 4GKJC 2D1TA 3NI2A 3TQIA 1MXBA 1V26A 5BR8C 4L2ZA 1IBLC 3IMLA 3DLPX 2CY1A 3R9WA 2P2QA 5BUSA 4OX9C 1ZB8A 1VLAA 1N34C 1RY2A 4B3RC 4RLQA 1N33C 2VZEA 2P02A 2OBVA 4DV1C 4D4IA 1N36C 3IPLA 4KTVA 1HH2P 2VQEC 3A4IA 3C5EA 1IBMC 4DR5C 3PROC 3S82A 5BUQA 4B3SC 5IWAC 5BSVA 1YJ7A 1LCIA 4G36A 4YY3C 3ETOA 3GPCA 4MH4A 1O92A 4LE5A 5K8FA 2F4VC 4DR3C 2Y27A 2WD9A 3R9XA 3EERA 1XRAA 4LF6C 1WF3A 3PESA 2P2JA 4WS9A 4RVNA 5A1GA 4LF5C 2ATWA 5T8SA 1NYEA 4RMNA 4TPSB 4HPVA 3SO4A 5LMNC 4ZLPA 3PBKA 4B3MC 3A9UA 4FUTA 2DYJA 4U5YD 5DV9A 2QVYX 3ETCA 1XNQC 2EGTA 2E5LC 2YWCA 1N2FA 1MD9A 3E7WA 1HNXC 4L4QA 1XMQC 1HR0C 3OTOC 4DCVA 4DG9A 3JAMD 2D1QA 4D57A 4DV5C 1FJGC 2ZM6C 1KKGA 4RM2A 3GR0A 2ASBA 4BBYA 5BSMA 3VNQA 1HNZC 1IBKC 2YWBA 1MDFA 1QM4A 1P7LA 3LGXA 5CZVA 2OPLB 1V25A 5ADZA 2E8CA 4PROC 4AQYC 4IZ6A 4D56A 4RVOA 1PG3A 2UU9C 1XNRC 5LMUC 2OPLA 4JI7C 5H9UA 1JOSA 4JYAC 4LF4C 4LFBC 4LF9C 4DCSA 2UXCC 2E0GA 3NYRA 5A1IA 2BJOA 1L2FA 3UOWA 2D1SA 2UXDC 5KEIA 5CZXA 2V7BA 2WP0C 5FLXD 2D1RA 3VNRA 5E7QA 4K0KC 2Y4OA 4DV4C 2QVXX 1T5DX 2E7GA 4LF8C 3KXWA 1K0RA 2PROA 4NDNA 1USPA 4DR7C 5BSUA 4X66C 3EQ6A 1ZB9A 4XX2A 4G37A 5IT9D 3FCCA 2VQFC 5AE1A 4JI8C 4RLFA 3TUFA 1T5HX 4FTFA 4WV3A 2OO4A 2JMPA 1O90A 4DUZC 4KTTA 1O9TA 3CJEA 4DV3C 4GS5A 1USPB 3VNSA 3AF5A 4DUYC 4G1IA 1MDBA 4DV0C 4GXQA 4OXIA 2UUCC 4LFCC 4LFAC 4GXRA 2UXBC 4JI0C 1N32C 3I08A 3FCEA 2P2BA 3IEUA 1XMOC 3H2TA 1HNWC 2P2FA 5KYVA 1RG9A 2XR1A 5AE3A 3E7XA 2HHHC 3RV2A 3IEVA 3A9VA 3DHVA 1I94C 4DCUA 4DR6C 3J80D 4DV7C 5T8TA 4ISBA 3NPDA 3TDEA 3CW9A 2P2MA 4X62C 3G7SA 2VSQA 3UZ0A 1EGAA 3LUSA 2UUBC 3L8CA 4I9FA 3I07A 4PHTA 4JI1C 1UKKA 2D27A 4BSZA 1AMUA 2BH1X 1LQLA 1QWIA 4DV2C 1BA3A 2DPLA 1ULTA 2D7VA 4JI6C 4DV6C 4D4GA 4YHHC 4JI5C 2E8FA 4BCAA 4R0MA 2UUAC 1MXAA 5KYTA 2ONFA 4DR4C 4R1MA 3AF6A 3LAXA 4JI4C 4GKKC 1ML8A 4BC9A 3R44A 1MKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AF5 A;  1FJG C;  2CY1 A;  4NOZ A;  2CXC A;  2ZM6 C;  4DUY C;  3R9W A;  1KKG A;  2ASB A;  4DV0 C;  1HNZ C;  4KHP C;  1IBK C;  2UUC C;  2PN2 A;  4OX9 C;  4LFC C;  4B3T C;  1ZB8 A;  1VLA A;  4LFA C;  1N34 C;  2UXB C;  2OPL B;  4B3R C;  2E8C A;  2HJG A;  1N33 C;  4JI0 C;  4AQY C;  2YCB A;  4DCT A;  4MTN A;  4DR2 C;  3T1Y C;  1N32 C;  4DV1 C;  1N36 C;  2UU9 C;  1XNR C;  5LMU C;  2OPL A;  4JI7 C;  2QL8 A;  1JOS A;  4JYA C;  1HH2 P;  2VQE C;  2KZF A;  4LF4 C;  3IEU A;  4LFB C;  1XMO C;  1IBM C;  4DR5 C;  4DR1 C;  4LF9 C;  4DCS A;  2UXC C;  1HNW C;  2BJO A;  1L2F A;  4B3S C;  2UXD C;  2XR1 A;  5IWA C;  1J5E C;  4YY3 C;  2PT7 G;  4MH4 A;  5FLX D;  4X64 C;  2F4V C;  4DR3 C;  3J81 D;  4K0K C;  5A2Q D;  3R9X A;  2HHH C;  3EER A;  4X65 C;  3IEV A;  4LF6 C;  4DV4 C;  1WF3 A;  4NXM C;  1I94 C;  4DCU A;  4DR6 C;  3J80 D;  4DV7 C;  2E7G A;  4LF8 C;  1K0R A;  1USP A;  2E8E A;  4LF5 C;  2ATW A;  4X62 C;  4DR7 C;  1NYE A;  5LMN C;  4B3M C;  1PA4 A;  3T1H C;  2DYJ A;  1EGA A;  3LUS A;  4X66 C;  2UUB C;  1WH9 A;  4JV5 C;  1ZB9 A;  4XX2 A;  3I07 A;  1XNQ C;  5IT9 D;  4JI1 C;  4JI2 C;  1UKK A;  4BSZ A;  2VQF C;  2EGT A;  1LQL A;  4LF7 C;  1QWI A;  4DV2 C;  2E5L C;  4JI8 C;  4NXN C;  3GKU A;  2D7V A;  4JI6 C;  4DV6 C;  4YHH C;  1N2F A;  2E8F A;  4JI5 C;  2UUA C;  1HNX C;  4JI3 C;  2JMP A;  2ONF A;  4DR4 C;  1XMQ C;  4GKJ C;  1HR0 C;  3OTO C;  4DUZ C;  4DCV A;  3AF6 A;  3CJE A;  4JI4 C;  4DV3 C;  5BR8 C;  4GKK C;  1ML8 A;  3JAM D;  1IBL C;  1USP B;  4DV5 C;  1MKY A; 
#chains in the Genus database with same CATH topology
 2YX1 A;  5A19 A;  5BSW A;  1PU1 A;  2DHM A;  2CXC A;  4NOZ A;  1PG4 A;  4PZP A;  4KHP C;  3LNO A;  4FUQ A;  5IFI A;  2PN2 A;  1XRB A;  4EAT A;  4B3T C;  2HJG A;  2YCB A;  4DCT A;  3CW8 X;  2MMA B;  4MTN A;  1XRC A;  5GTD A;  4DR2 C;  3T1Y C;  3NYQ A;  5BUR A;  2QL8 A;  5BST A;  2KZF A;  4DR1 C;  1O93 A;  1GPM A;  4JM1 A;  3N2Q A;  2QW0 X;  5BSR A;  3AY0 A;  4IR7 A;  3UX3 A;  1J5E C;  2QVZ X;  4OYC A;  4BC7 A;  2PT7 G;  1FUG A;  4X64 C;  5JRH A;  3J81 D;  5A2Q D;  2AYA A;  4L7I A;  4X65 C;  4NXM C;  2P20 A;  3RG2 A;  5K85 A;  2E8E A;  4DG8 A;  4PUH A;  4I9G A;  3DAY A;  4ODJ A;  2D28 C;  1PA4 A;  3T1H C;  3LNV A;  3L95 X;  4K0B A;  2MM9 A;  1WH9 A;  4JV5 C;  2Y4N A;  4JI2 C;  4RM3 A;  3B7W A;  4LF7 C;  3GR1 A;  2JNV A;  4ZJZ A;  3N54 B;  1MXC A;  4NXN C;  3GKU A;  2MCQ A;  5AE2 A;  4R1L A;  4JI3 C;  3K6R A;  1M6X A;  2D1T A;  3NI2 A;  3TQI A;  4GKJ C;  1MXB A;  1V26 A;  5BR8 C;  2M5H A;  4L2Z A;  1IBL C;  3IML A;  3DLP X;  2CY1 A;  3R9W A;  1UWD A;  3A25 A;  2P2Q A;  5BUS A;  1VEH A;  4OX9 C;  1ZB8 A;  1VLA A;  1N34 C;  1RY2 A;  4B3R C;  4RLQ A;  1N33 C;  2VZE A;  2P02 A;  2OBV A;  4DV1 C;  4D4I A;  1N36 C;  3IPL A;  4KTV A;  1HH2 P;  2VQE C;  3A4I A;  1P4E A;  1TH5 A;  3C5E A;  4DR5 C;  1IBM C;  3PRO C;  2CU6 A;  3S82 A;  5BUQ A;  4B3S C;  5IWA C;  5BSV A;  1YJ7 A;  1LCI A;  4G36 A;  4YY3 C;  3ETO A;  3GPC A;  4MH4 A;  1O92 A;  4LE5 A;  5K8F A;  2F4V C;  4DR3 C;  2Y27 A;  2WD9 A;  3R9X A;  3EER A;  1XRA A;  4LF6 C;  1WF3 A;  3PES A;  2P2J A;  4WS9 A;  3TR3 A;  1XHJ A;  4RVN A;  2NCL A;  5A1G A;  4LF5 C;  2ATW A;  5T8S A;  1NYE A;  4RMN A;  4TPS B;  4HPV A;  3SO4 A;  5LMN C;  4ZLP A;  3PBK A;  4B3M C;  3A9U A;  4FUT A;  2DYJ A;  4U5Y D;  5DV9 A;  2QVY X;  3ETC A;  1XNQ C;  2EGT A;  2E5L C;  2YWC A;  1N2F A;  1MD9 A;  3E7W A;  1HNX C;  4L4Q A;  1XMQ C;  1HR0 C;  3OTO C;  5LCI A;  4DCV A;  3UX2 A;  4DG9 A;  3JAM D;  2D1Q A;  4D57 A;  4DV5 C;  1FJG C;  3A26 A;  2ZM6 C;  1XS3 A;  1KKG A;  4RM2 A;  3GR0 A;  2ASB A;  4BBY A;  2KZ0 A;  5BSM A;  3VNQ A;  1HNZ C;  1IBK C;  2YWB A;  1MDF A;  1QM4 A;  1P7L A;  3LGX A;  2ZZN A;  5CZV A;  2OPL B;  1V25 A;  5ADZ A;  2E8C A;  4PRO C;  4AQY C;  4IZ6 A;  4D56 A;  4RVO A;  1PG3 A;  2UU9 C;  1XNR C;  5LMU C;  2OPL A;  4JI7 C;  5H9U A;  1JOS A;  2ZZM A;  4JYA C;  4LF4 C;  4LFB C;  4LF9 C;  4DCS A;  2UXC C;  2E0G A;  3NYR A;  5A1I A;  2BJO A;  1L2F A;  3UOW A;  2D1S A;  2UXD C;  5KEI A;  5CZX A;  2V7B A;  2WP0 C;  5FLX D;  2D1R A;  3VNR A;  5E7Q A;  4K0K C;  2Y4O A;  4DV4 C;  2QVX X;  1T5D X;  2E7G A;  4LF8 C;  3KXW A;  1K0R A;  2PRO A;  4NDN A;  1USP A;  4PUI A;  4DR7 C;  3CQ2 A;  5BSU A;  1NY8 A;  4X66 C;  3EQ6 A;  1ZB9 A;  4XX2 A;  4G37 A;  3UEB A;  5IT9 D;  3FCC A;  2VQF C;  3CQ3 A;  5AE1 A;  4JI8 C;  4RLF A;  3TUF A;  1IB8 A;  1T5H X;  4FTF A;  4WV3 A;  2OO4 A;  2JMP A;  1P4E C;  3CQ1 A;  1O90 A;  4DUZ C;  4KTT A;  1O9T A;  3CJE A;  4DV3 C;  4GS5 A;  1USP B;  3VNS A;  3AF5 A;  4DUY C;  4G1I A;  1MDB A;  4DV0 C;  4GXQ A;  4OXI A;  2UUC C;  4LFC C;  4LFA C;  4GXR A;  2KDN A;  2UXB C;  2Z51 A;  4JI0 C;  1N32 C;  1WCJ A;  3I08 A;  3FCE A;  2P2B A;  1M6X C;  3IEU A;  1XMO C;  3H2T A;  1HNW C;  2P2F A;  5KYV A;  2M5O A;  1RG9 A;  2XR1 A;  5AE3 A;  3E7X A;  3O2E A;  2HHH C;  3RV2 A;  3IEV A;  3A9V A;  3DHV A;  1I94 C;  4DCU A;  1V60 A;  4DR6 C;  3J80 D;  4DV7 C;  5T8T A;  4ISB A;  3NPD A;  3TDE A;  3CW9 A;  2P2M A;  4X62 C;  3G7S A;  2VSQ A;  1FLO A;  3UZ0 A;  1EGA A;  3LUS A;  2UUB C;  3L8C A;  4I9F A;  3I07 A;  4PHT A;  4JI1 C;  1UKK A;  2D27 A;  4BSZ A;  1AMU A;  2BH1 X;  1LQL A;  1QWI A;  4DV2 C;  1BA3 A;  2DPL A;  1ULT A;  2D7V A;  4JI6 C;  4DV6 C;  4PUG A;  4D4G A;  4YHH C;  4JI5 C;  2E8F A;  4BCA A;  4R0M A;  2UUA C;  1MXA A;  5KYT A;  2ONF A;  4DR4 C;  4R1M A;  3AF6 A;  3LAX A;  4JI4 C;  4GKK C;  1ML8 A;  4BC9 A;  3R44 A;  1MKY A; 
#chains in the Genus database with same CATH homology
 5A19 A;  5BSW A;  4NOZ A;  2CXC A;  1PG4 A;  4PZP A;  4KHP C;  4FUQ A;  5IFI A;  2PN2 A;  1XRB A;  4EAT A;  4B3T C;  2HJG A;  2YCB A;  4DCT A;  3CW8 X;  4MTN A;  5GTD A;  1XRC A;  4DR2 C;  3T1Y C;  3NYQ A;  5BUR A;  2QL8 A;  5BST A;  2KZF A;  4DR1 C;  1O93 A;  1GPM A;  4JM1 A;  3N2Q A;  2QW0 X;  5BSR A;  4IR7 A;  1J5E C;  2QVZ X;  4OYC A;  4BC7 A;  2PT7 G;  1FUG A;  4X64 C;  5JRH A;  3J81 D;  5A2Q D;  2AYA A;  4L7I A;  4X65 C;  4NXM C;  2P20 A;  3RG2 A;  5K85 A;  2E8E A;  4DG8 A;  4I9G A;  3DAY A;  4ODJ A;  2D28 C;  1PA4 A;  3T1H C;  3LNV A;  3L95 X;  4K0B A;  1WH9 A;  4JV5 C;  2Y4N A;  4JI2 C;  4RM3 A;  3B7W A;  4LF7 C;  3GR1 A;  4ZJZ A;  3N54 B;  1MXC A;  4NXN C;  3GKU A;  5AE2 A;  4R1L A;  4JI3 C;  4GKJ C;  2D1T A;  3NI2 A;  3TQI A;  1MXB A;  1V26 A;  5BR8 C;  4L2Z A;  1IBL C;  3IML A;  3DLP X;  2CY1 A;  3R9W A;  2P2Q A;  5BUS A;  4OX9 C;  1ZB8 A;  1VLA A;  1N34 C;  1RY2 A;  4B3R C;  4RLQ A;  1N33 C;  2VZE A;  2P02 A;  2OBV A;  4DV1 C;  4D4I A;  1N36 C;  3IPL A;  4KTV A;  1HH2 P;  2VQE C;  3A4I A;  3C5E A;  1IBM C;  4DR5 C;  3PRO C;  3S82 A;  5BUQ A;  4B3S C;  5IWA C;  5BSV A;  1YJ7 A;  1LCI A;  4G36 A;  4YY3 C;  3ETO A;  3GPC A;  4MH4 A;  1O92 A;  4LE5 A;  5K8F A;  2F4V C;  4DR3 C;  2Y27 A;  2WD9 A;  3R9X A;  3EER A;  1XRA A;  4LF6 C;  1WF3 A;  3PES A;  2P2J A;  4WS9 A;  4RVN A;  5A1G A;  4LF5 C;  2ATW A;  5T8S A;  1NYE A;  4RMN A;  4TPS B;  4HPV A;  3SO4 A;  5LMN C;  4ZLP A;  3PBK A;  4B3M C;  3A9U A;  4FUT A;  2DYJ A;  4U5Y D;  5DV9 A;  2QVY X;  3ETC A;  1XNQ C;  2EGT A;  2E5L C;  2YWC A;  1N2F A;  1MD9 A;  3E7W A;  1HNX C;  4L4Q A;  1XMQ C;  1HR0 C;  3OTO C;  4DCV A;  4DG9 A;  3JAM D;  2D1Q A;  4D57 A;  4DV5 C;  1FJG C;  2ZM6 C;  1KKG A;  4RM2 A;  3GR0 A;  2ASB A;  4BBY A;  5BSM A;  3VNQ A;  1HNZ C;  1IBK C;  2YWB A;  1MDF A;  1QM4 A;  1P7L A;  3LGX A;  5CZV A;  2OPL B;  1V25 A;  5ADZ A;  2E8C A;  4PRO C;  4AQY C;  4IZ6 A;  4D56 A;  4RVO A;  1PG3 A;  2UU9 C;  1XNR C;  5LMU C;  2OPL A;  4JI7 C;  5H9U A;  1JOS A;  4JYA C;  4LF4 C;  4LFB C;  4LF9 C;  4DCS A;  2UXC C;  2E0G A;  3NYR A;  5A1I A;  2BJO A;  1L2F A;  3UOW A;  2D1S A;  2UXD C;  5KEI A;  5CZX A;  2V7B A;  2WP0 C;  5FLX D;  2D1R A;  3VNR A;  5E7Q A;  4K0K C;  2Y4O A;  4DV4 C;  2QVX X;  1T5D X;  2E7G A;  4LF8 C;  3KXW A;  1K0R A;  2PRO A;  4NDN A;  1USP A;  4DR7 C;  5BSU A;  4X66 C;  3EQ6 A;  1ZB9 A;  4XX2 A;  4G37 A;  5IT9 D;  3FCC A;  2VQF C;  5AE1 A;  4JI8 C;  4RLF A;  3TUF A;  1T5H X;  4FTF A;  4WV3 A;  2OO4 A;  2JMP A;  1O90 A;  4DUZ C;  4KTT A;  1O9T A;  3CJE A;  4DV3 C;  4GS5 A;  1USP B;  3VNS A;  3AF5 A;  4DUY C;  4G1I A;  1MDB A;  4DV0 C;  4GXQ A;  4OXI A;  2UUC C;  4LFC C;  4LFA C;  4GXR A;  2UXB C;  4JI0 C;  1N32 C;  3I08 A;  3FCE A;  2P2B A;  3IEU A;  1XMO C;  3H2T A;  1HNW C;  2P2F A;  5KYV A;  1RG9 A;  2XR1 A;  5AE3 A;  3E7X A;  2HHH C;  3RV2 A;  3IEV A;  3A9V A;  3DHV A;  1I94 C;  4DCU A;  4DR6 C;  3J80 D;  4DV7 C;  5T8T A;  4ISB A;  3NPD A;  3TDE A;  3CW9 A;  2P2M A;  4X62 C;  3G7S A;  2VSQ A;  3UZ0 A;  1EGA A;  3LUS A;  2UUB C;  3L8C A;  4I9F A;  3I07 A;  4PHT A;  4JI1 C;  1UKK A;  2D27 A;  4BSZ A;  1AMU A;  2BH1 X;  1LQL A;  1QWI A;  4DV2 C;  1BA3 A;  2DPL A;  1ULT A;  2D7V A;  4JI6 C;  4DV6 C;  4D4G A;  4YHH C;  4JI5 C;  2E8F A;  4BCA A;  4R0M A;  2UUA C;  1MXA A;  5KYT A;  2ONF A;  4DR4 C;  4R1M A;  3AF6 A;  3LAX A;  4JI4 C;  4GKK C;  1ML8 A;  4BC9 A;  3R44 A;  1MKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...