2QL8A

Crystal structure of a putative redox protein (lsei_0423) from lactobacillus casei atcc 334 at 1.50 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
MQDERWNHPLYTTTAINDEELEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRVKVAFIGARAEYQFLVHAQVMVKGVDFDTAKAFTNEIENRCPVSKLLKNSGNYTIETVTDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative redox protein
publication title Crystal structure of putative redox protein (YP_805721.1) from Lactobacillus casei ATCC 334 at 1.50 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2ql8A00
1ML8A 1UKKA 4DR3C 4DUZC 5FLXD 2YCBA 2ATWA 4YHHC 3JAMD 1WF3A 1XNRC 4B3TC 4BSZA 1ZB8A 2VQFC 1PA4A 4B3MC 4MH4A 3LUSA 2E7GA 2OPLB 1USPB 4JI6C 5LMUC 1EGAA 4JI2C 1ZB9A 4DV0C 4AQYC 1MKYA 2CXCA 2ZM6C 4DCTA 4JV5C 5IT9D 1J5EC 2UU9C 1FJGC 1N33C 1N32C 2PT7G 3R9WA 2OPLA 4JI1C 1USPA 3IEUA 5LMNC 2E8CA 1QWIA 1LQLA 1WH9A 5A2QD 1XMOC 4K0KC 4JI7C 2UXDC 2E8FA 2UUAC 2PN2A 4DR1C 3AF6A 3T1HC 4LF6C 1HR0C 1HH2P 4DR2C 1IBKC 4LFAC 4DR7C 2HJGA 1N34C 1L2FA 4GKKC 4DV7C 1HNXC 3AF5A 4LF5C 3J80D 2ASBA 4DUYC 2XR1A 4LF8C 4DCVA 4NXNC 4LF9C 4OX9C 2KZFA 1KKGA 1XNQC 1K0RA 1IBLC 2ONFA 3IEVA 4B3SC 4DR5C 4LF4C 4JI0C 4DV6C 3OTOC 4JI4C 2QL8A 4MTNA 4DV1C 2VQEC 4X66C 1N36C 4YY3C 1VLAA 3CJEA 4B3RC 3R9XA 2UXCC 4X64C 4XX2A 4X65C 1I94C 2UXBC 4DV3C 4DCUA 4LFBC 3T1YC 2E5LC 1IBMC 1HNWC 4LF7C 4DV4C 4JI8C 4JI5C 4DV5C 1XMQC 5BR8C 1N2FA 4DCSA 1JOSA 2CY1A 2UUBC 4KHPC 4JI3C 2DYJA 4X62C 4NXMC 2HHHC 3EERA 2BJOA 2EGTA 3I07A 3J81D 2UUCC 4DR4C 2JMPA 1NYEA 3GKUA 4JYAC 2D7VA 4LFCC 2F4VC 2E8EA 4GKJC 4DR6C 4DV2C 5IWAC 1HNZC 4NOZA
chains in the Genus database with same CATH superfamily
2VZEA 2ATWA 1M6XA 4B3TC 5BSVA 4BSZA 1FLOA 1ZB8A 4L7IA 5K8FA 3GPCA 5LMUC 3VNRA 4D56A 3K6RA 3A25A 1ZB9A 4AQYC 2CXCA 3A26A 4ZLPA 5KEIA 1J5EC 1PG3A 3EQ6A 3IEUA 2E8CA 4JI7C 1T5HX 2UUAC 3T1HC 4LF6C 1HR0C 2P2JA 3TDEA 4LFAC 3PESA 2AYAA 2OO4A 2WP0C 3C5EA 1HNXC 4LF5C 4DUYC 4LF8C 4DCVA 4OX9C 2DHMA 1K0RA 3PROC 1IBLC 2ONFA 1XNQC 3CQ3A 4NDNA 2YX1A 4LF4C 3DLPX 1V60A 3B7WA 3OTOC 4DV6C 4JI4C 1RG9A 1N36C 2Y4NA 1VLAA 3CJEA 3CQ2A 3AY0A 2BH1X 1P7LA 4XX2A 2UXBC 4DV3C 4OXIA 4LFBC 1XMQC 3DAYA 4TPSB 2P02A 3NI2A 1JOSA 2CY1A 2UUBC 5BSMA 2DYJA 3ETOA 4X62C 4BC9A 4RLQA 2BJOA 2UUCC 3GKUA 4EATA 2D7VA 5DV9A 3E7WA 3ETCA 2PROA 5IWAC 4DV2C 1HNZC 4DR6C 4D57A 1ML8A 4DUZC 2Y4OA 4YHHC 3TQIA 3CQ1A 1PU1A 3TR3A 3TUFA 2VQFC 4PZPA 2E7GA 5BSUA 1USPB 1XHJA 5H9UA 1O92A 1BA3A 2UU9C 2E0GA 4D4IA 1N32C 3R9WA 2NCLA 4JI1C 1USPA 3RV2A 1WH9A 4DG9A 1XMOC 4RMNA 2MM9A 1WCJA 2E8FA 4BCAA 2OBVA 4FUQA 3LNOA 1HH2P 4DR2C 5IFIA 1L2FA 2Y27A 4DG8A 1N34C 5AE3A 4HPVA 1MXAA 5LCIA 4NXNC 3L8CA 1IB8A 4KTTA 3CW8X 4L4QA 3NYQA 4JI0C 1VEHA 4DV1C 1MD9A 1V25A 4B3RC 3R9XA 4BBYA 1P4EC 4GXRA 2ZZMA 3LGXA 1I94C 3NPDA 1IBMC 3KXWA 4DV4C 5JRHA 4FUTA 3GR1A 4PUGA 1MDBA 5BUQA 4R1LA 2V7BA 2P2BA 1XRAA 3SO4A 5A19A 1T5DX 2P2MA 1MXBA 1NYEA 4JYAC 1TH5A 2F4VC 2E8EA 4NOZA 5FLXD 2YCBA 3N2QA 3JAMD 1WF3A 1O93A 4PROC 2MCQA 1PA4A 4B3MC 4G1IA 4JI6C 4BC7A 1EGAA 4K0BA 4JI2C 4DV0C 2QVZX 3VNSA 1AMUA 1MKYA 2ZM6C 4ODJA 4DCTA 4JV5C 5BSRA 2D1QA 3VNQA 5IT9D 1N33C 5KYTA 1PG4A 5K85A 2KZ0A 5LMNC 1LQLA 4PUIA 5ADZA 5A2QD 4FTFA 4U5YD 4L2ZA 4OYCA 4K0KC 4WV3A 4RVNA 2PN2A 4DR1C 3GR0A 3L95X 5BSWA 4DR7C 2YWCA 3IMLA 2D27A 4DV7C 1P4EA 3J80D 4JM1A 2ZZNA 2XR1A 2DPLA 2KZFA 3S82A 2QVYX 5BURA 3IEVA 1O9TA 4DR5C 3G7SA 4I9FA 4MTNA 5CZVA 2VQEC 5KYVA 4YY3C 2UXCC 2D28C 4X64C 3H2TA 3T1YC 2E5LC 4LF7C 4JI8C 4DV5C 1RY2A 1V26A 1N2FA 4G36A 4KHPC 1LCIA 4JI3C 5GTDA 4RVOA 4NXMC 3EERA 3A9VA 3I07A 1O90A 2MMAB 2Z51A 3E7XA 3J81D 2JMPA 2WD9A 3A9UA 4LFCC 3LAXA 4IR7A 2D1SA 3R44A 4RM2A 4LE5A 1UKKA 2QVXX 5BSTA 4DR3C 1XRCA 1XNRC 2YWBA 3UEBA 3O2EA 4MH4A 3LUSA 2OPLB 3CW9A 2KDNA 3UOWA 3PBKA 1FJGC 2PT7G 2QW0X 2OPLA 1M6XC 1QWIA 1QM4A 3FCEA 2P20A 1XS3A 2UXDC 4G37A 5T8SA 4GS5A 3AF6A 4IZ6A 3UX3A 1MDFA 1MXCA 1IBKC 2HJGA 4GKKC 3RG2A 4R0MA 3AF5A 5A1GA 2ASBA 1FUGA 3IPLA 2CU6A 4LF9C 2M5HA 1KKGA 4RLFA 3A4IA 5T8TA 2D1RA 1GPMA 4RM3A 4B3SC 3UX2A 2JNVA 2VSQA 3N54B 3I08A 4D4GA 2QL8A 3DHVA 4X66C 4ISBA 5AE2A 1ULTA 5A1IA 1YJ7A 4X65C 4DCUA 1HNWC 2P2QA 4JI5C 5BR8C 2M5OA 4DCSA 3LNVA 4KTVA 4PUHA 2D1TA 1UWDA 5E7QA 1XRBA 5CZXA 4I9GA 4ZJZA 4WS9A 1NY8A 2HHHC 4PHTA 2EGTA 5AE1A 3NYRA 4DR4C 4R1MA 5BUSA 4GKJC 2P2FA 3UZ0A 3FCCA 4GXQA
chains in the Genus database with same CATH topology
2VZEA 2ATWA 4B3TC 5BSVA 4BSZA 1ZB8A 4L7IA 5K8FA 3GPCA 5LMUC 3VNRA 4D56A 1ZB9A 4AQYC 2CXCA 4ZLPA 5KEIA 1J5EC 1PG3A 3EQ6A 3IEUA 2E8CA 4JI7C 1T5HX 2UUAC 3T1HC 4LF6C 1HR0C 2P2JA 3TDEA 4LFAC 3PESA 2AYAA 2OO4A 2WP0C 3C5EA 1HNXC 4LF5C 4DUYC 4LF8C 4DCVA 4OX9C 1XNQC 1K0RA 3PROC 1IBLC 2ONFA 4NDNA 4LF4C 3DLPX 3B7WA 3OTOC 4DV6C 4JI4C 1RG9A 1N36C 2Y4NA 1VLAA 3CJEA 2BH1X 1P7LA 4XX2A 2UXBC 4DV3C 4OXIA 4LFBC 1XMQC 3DAYA 4TPSB 2P02A 3NI2A 1JOSA 2CY1A 2UUBC 5BSMA 2DYJA 3ETOA 4X62C 4BC9A 4RLQA 2BJOA 2UUCC 3GKUA 4EATA 2D7VA 5DV9A 3E7WA 3ETCA 2PROA 5IWAC 4DV2C 1HNZC 4DR6C 4D57A 1ML8A 4DUZC 2Y4OA 4YHHC 3TQIA 3TUFA 2VQFC 4PZPA 2E7GA 5BSUA 1USPB 5H9UA 1O92A 1BA3A 2UU9C 2E0GA 4D4IA 1N32C 3R9WA 4JI1C 1USPA 3RV2A 1WH9A 4DG9A 1XMOC 4RMNA 2E8FA 4BCAA 2OBVA 4FUQA 1HH2P 4DR2C 5IFIA 1L2FA 2Y27A 4DG8A 1N34C 5AE3A 4HPVA 1MXAA 4NXNC 3L8CA 4KTTA 3CW8X 4L4QA 3NYQA 4JI0C 4DV1C 1MD9A 1V25A 4B3RC 3R9XA 4BBYA 4GXRA 3LGXA 1I94C 3NPDA 1IBMC 3KXWA 4DV4C 5JRHA 4FUTA 3GR1A 1MDBA 5BUQA 4R1LA 2V7BA 2P2BA 1XRAA 3SO4A 5A19A 1T5DX 2P2MA 1MXBA 1NYEA 4JYAC 2F4VC 2E8EA 4NOZA 5FLXD 2YCBA 3N2QA 3JAMD 1WF3A 1O93A 4PROC 1PA4A 4B3MC 4G1IA 4JI6C 4BC7A 1EGAA 4K0BA 4JI2C 4DV0C 2QVZX 3VNSA 1AMUA 1MKYA 2ZM6C 4ODJA 4DCTA 4JV5C 5BSRA 2D1QA 3VNQA 5IT9D 1N33C 5KYTA 1PG4A 5K85A 5LMNC 1LQLA 5ADZA 5A2QD 4FTFA 4U5YD 4L2ZA 4OYCA 4K0KC 4WV3A 4RVNA 2PN2A 4DR1C 3GR0A 3L95X 5BSWA 4DR7C 2YWCA 3IMLA 2D27A 4DV7C 3J80D 4JM1A 2XR1A 2DPLA 2KZFA 3S82A 2QVYX 5BURA 3IEVA 1O9TA 4DR5C 3G7SA 4I9FA 4MTNA 5CZVA 2VQEC 5KYVA 4YY3C 2UXCC 2D28C 4X64C 3H2TA 3T1YC 2E5LC 4LF7C 4JI8C 4DV5C 1RY2A 1V26A 1N2FA 4G36A 4KHPC 1LCIA 4JI3C 5GTDA 4RVOA 4NXMC 3EERA 3A9VA 3J81D 1O90A 3E7XA 3I07A 2JMPA 2WD9A 3A9UA 4LFCC 3LAXA 4IR7A 2D1SA 3R44A 4RM2A 4LE5A 1UKKA 2QVXX 5BSTA 4DR3C 1XRCA 1XNRC 2YWBA 4MH4A 3LUSA 2OPLB 3CW9A 3UOWA 3PBKA 1FJGC 2PT7G 2QW0X 2OPLA 1QWIA 1QM4A 3FCEA 2P20A 2UXDC 4G37A 5T8SA 4GS5A 3AF6A 4IZ6A 1MDFA 1MXCA 1IBKC 2HJGA 4GKKC 3RG2A 4R0MA 3AF5A 5A1GA 2ASBA 1FUGA 3IPLA 4LF9C 1KKGA 4RLFA 3A4IA 5T8TA 2D1RA 1GPMA 4RM3A 4B3SC 2VSQA 3N54B 3I08A 4D4GA 2QL8A 3DHVA 4X66C 4ISBA 5AE2A 1ULTA 5A1IA 1YJ7A 4X65C 4DCUA 1HNWC 2P2QA 4JI5C 5BR8C 4DCSA 3LNVA 4KTVA 2D1TA 5E7QA 1XRBA 5CZXA 4I9GA 4ZJZA 4WS9A 2HHHC 4PHTA 2EGTA 5AE1A 3NYRA 4DR4C 4R1MA 5BUSA 4GKJC 2P2FA 3UZ0A 3FCCA 4GXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML8 A;  1UKK A;  4DR3 C;  4DUZ C;  5FLX D;  2YCB A;  2ATW A;  4YHH C;  3JAM D;  1WF3 A;  1XNR C;  4B3T C;  4BSZ A;  1ZB8 A;  2VQF C;  1PA4 A;  4B3M C;  4MH4 A;  3LUS A;  2E7G A;  2OPL B;  1USP B;  4JI6 C;  5LMU C;  1EGA A;  4JI2 C;  1ZB9 A;  4DV0 C;  4AQY C;  1MKY A;  2CXC A;  2ZM6 C;  4DCT A;  4JV5 C;  5IT9 D;  1J5E C;  2UU9 C;  1FJG C;  1N33 C;  1N32 C;  2PT7 G;  3R9W A;  2OPL A;  4JI1 C;  1USP A;  3IEU A;  5LMN C;  2E8C A;  1QWI A;  1LQL A;  1WH9 A;  5A2Q D;  1XMO C;  4K0K C;  4JI7 C;  2UXD C;  2E8F A;  2UUA C;  2PN2 A;  4DR1 C;  3AF6 A;  3T1H C;  4LF6 C;  1HR0 C;  1HH2 P;  4DR2 C;  1IBK C;  4LFA C;  4DR7 C;  2HJG A;  1N34 C;  1L2F A;  4GKK C;  4DV7 C;  1HNX C;  3AF5 A;  4LF5 C;  3J80 D;  2ASB A;  4DUY C;  2XR1 A;  4LF8 C;  4DCV A;  4NXN C;  4LF9 C;  4OX9 C;  2KZF A;  1KKG A;  1XNQ C;  1K0R A;  1IBL C;  2ONF A;  3IEV A;  4B3S C;  4DR5 C;  4LF4 C;  4JI0 C;  4DV6 C;  3OTO C;  4JI4 C;  2QL8 A;  4MTN A;  4DV1 C;  2VQE C;  4X66 C;  1N36 C;  4YY3 C;  1VLA A;  3CJE A;  4B3R C;  3R9X A;  2UXC C;  4X64 C;  4XX2 A;  4X65 C;  1I94 C;  2UXB C;  4DV3 C;  4DCU A;  4LFB C;  3T1Y C;  2E5L C;  1IBM C;  1HNW C;  4LF7 C;  4DV4 C;  4JI8 C;  4JI5 C;  4DV5 C;  1XMQ C;  5BR8 C;  1N2F A;  4DCS A;  1JOS A;  2CY1 A;  2UUB C;  4KHP C;  4JI3 C;  2DYJ A;  4X62 C;  4NXM C;  2HHH C;  3EER A;  2BJO A;  2EGT A;  3I07 A;  3J81 D;  2UUC C;  4DR4 C;  2JMP A;  1NYE A;  3GKU A;  4JYA C;  2D7V A;  4LFC C;  2F4V C;  2E8E A;  4GKJ C;  4DR6 C;  4DV2 C;  5IWA C;  1HNZ C;  4NOZ A; 
#chains in the Genus database with same CATH topology
 2VZE A;  2ATW A;  1M6X A;  4B3T C;  5BSV A;  4BSZ A;  1FLO A;  1ZB8 A;  4L7I A;  5K8F A;  3GPC A;  5LMU C;  3VNR A;  4D56 A;  3K6R A;  3A25 A;  1ZB9 A;  4AQY C;  2CXC A;  3A26 A;  4ZLP A;  5KEI A;  1J5E C;  1PG3 A;  3EQ6 A;  3IEU A;  2E8C A;  4JI7 C;  1T5H X;  2UUA C;  3T1H C;  4LF6 C;  1HR0 C;  2P2J A;  3TDE A;  4LFA C;  3PES A;  2AYA A;  2OO4 A;  2WP0 C;  3C5E A;  1HNX C;  4LF5 C;  4DUY C;  4LF8 C;  4DCV A;  4OX9 C;  2DHM A;  1K0R A;  3PRO C;  1IBL C;  2ONF A;  1XNQ C;  3CQ3 A;  4NDN A;  2YX1 A;  4LF4 C;  3DLP X;  1V60 A;  3B7W A;  3OTO C;  4DV6 C;  4JI4 C;  1RG9 A;  1N36 C;  2Y4N A;  1VLA A;  3CJE A;  3CQ2 A;  3AY0 A;  2BH1 X;  1P7L A;  4XX2 A;  2UXB C;  4DV3 C;  4OXI A;  4LFB C;  1XMQ C;  3DAY A;  4TPS B;  2P02 A;  3NI2 A;  1JOS A;  2CY1 A;  2UUB C;  5BSM A;  2DYJ A;  3ETO A;  4X62 C;  4BC9 A;  4RLQ A;  2BJO A;  2UUC C;  3GKU A;  4EAT A;  2D7V A;  5DV9 A;  3E7W A;  3ETC A;  2PRO A;  5IWA C;  4DV2 C;  1HNZ C;  4DR6 C;  4D57 A;  1ML8 A;  4DUZ C;  2Y4O A;  4YHH C;  3TQI A;  3CQ1 A;  1PU1 A;  3TR3 A;  3TUF A;  2VQF C;  4PZP A;  2E7G A;  5BSU A;  1USP B;  1XHJ A;  5H9U A;  1O92 A;  1BA3 A;  2UU9 C;  2E0G A;  4D4I A;  1N32 C;  3R9W A;  2NCL A;  4JI1 C;  1USP A;  3RV2 A;  1WH9 A;  4DG9 A;  1XMO C;  4RMN A;  2MM9 A;  1WCJ A;  2E8F A;  4BCA A;  2OBV A;  4FUQ A;  3LNO A;  1HH2 P;  4DR2 C;  5IFI A;  1L2F A;  2Y27 A;  4DG8 A;  1N34 C;  5AE3 A;  4HPV A;  1MXA A;  5LCI A;  4NXN C;  3L8C A;  1IB8 A;  4KTT A;  3CW8 X;  4L4Q A;  3NYQ A;  4JI0 C;  1VEH A;  4DV1 C;  1MD9 A;  1V25 A;  4B3R C;  3R9X A;  4BBY A;  1P4E C;  4GXR A;  2ZZM A;  3LGX A;  1I94 C;  3NPD A;  1IBM C;  3KXW A;  4DV4 C;  5JRH A;  4FUT A;  3GR1 A;  4PUG A;  1MDB A;  5BUQ A;  4R1L A;  2V7B A;  2P2B A;  1XRA A;  3SO4 A;  5A19 A;  1T5D X;  2P2M A;  1MXB A;  1NYE A;  4JYA C;  1TH5 A;  2F4V C;  2E8E A;  4NOZ A;  5FLX D;  2YCB A;  3N2Q A;  3JAM D;  1WF3 A;  1O93 A;  4PRO C;  2MCQ A;  1PA4 A;  4B3M C;  4G1I A;  4JI6 C;  4BC7 A;  1EGA A;  4K0B A;  4JI2 C;  4DV0 C;  2QVZ X;  3VNS A;  1AMU A;  1MKY A;  2ZM6 C;  4ODJ A;  4DCT A;  4JV5 C;  5BSR A;  2D1Q A;  3VNQ A;  5IT9 D;  1N33 C;  5KYT A;  1PG4 A;  5K85 A;  2KZ0 A;  5LMN C;  1LQL A;  4PUI A;  5ADZ A;  5A2Q D;  4FTF A;  4U5Y D;  4L2Z A;  4OYC A;  4K0K C;  4WV3 A;  4RVN A;  2PN2 A;  4DR1 C;  3GR0 A;  3L95 X;  5BSW A;  4DR7 C;  2YWC A;  3IML A;  2D27 A;  4DV7 C;  1P4E A;  3J80 D;  4JM1 A;  2ZZN A;  2XR1 A;  2DPL A;  2KZF A;  3S82 A;  2QVY X;  5BUR A;  3IEV A;  1O9T A;  4DR5 C;  3G7S A;  4I9F A;  4MTN A;  5CZV A;  2VQE C;  5KYV A;  4YY3 C;  2UXC C;  2D28 C;  4X64 C;  3H2T A;  3T1Y C;  2E5L C;  4LF7 C;  4JI8 C;  4DV5 C;  1RY2 A;  1V26 A;  1N2F A;  4G36 A;  4KHP C;  1LCI A;  4JI3 C;  5GTD A;  4RVO A;  4NXM C;  3EER A;  3A9V A;  3I07 A;  1O90 A;  2MMA B;  2Z51 A;  3E7X A;  3J81 D;  2JMP A;  2WD9 A;  3A9U A;  4LFC C;  3LAX A;  4IR7 A;  2D1S A;  3R44 A;  4RM2 A;  4LE5 A;  1UKK A;  2QVX X;  5BST A;  4DR3 C;  1XRC A;  1XNR C;  2YWB A;  3UEB A;  3O2E A;  4MH4 A;  3LUS A;  2OPL B;  3CW9 A;  2KDN A;  3UOW A;  3PBK A;  1FJG C;  2PT7 G;  2QW0 X;  2OPL A;  1M6X C;  1QWI A;  1QM4 A;  3FCE A;  2P20 A;  1XS3 A;  2UXD C;  4G37 A;  5T8S A;  4GS5 A;  3AF6 A;  4IZ6 A;  3UX3 A;  1MDF A;  1MXC A;  1IBK C;  2HJG A;  4GKK C;  3RG2 A;  4R0M A;  3AF5 A;  5A1G A;  2ASB A;  1FUG A;  3IPL A;  2CU6 A;  4LF9 C;  2M5H A;  1KKG A;  4RLF A;  3A4I A;  5T8T A;  2D1R A;  1GPM A;  4RM3 A;  4B3S C;  3UX2 A;  2JNV A;  2VSQ A;  3N54 B;  3I08 A;  4D4G A;  2QL8 A;  3DHV A;  4X66 C;  4ISB A;  5AE2 A;  1ULT A;  5A1I A;  1YJ7 A;  4X65 C;  4DCU A;  1HNW C;  2P2Q A;  4JI5 C;  5BR8 C;  2M5O A;  4DCS A;  3LNV A;  4KTV A;  4PUH A;  2D1T A;  1UWD A;  5E7Q A;  1XRB A;  5CZX A;  4I9G A;  4ZJZ A;  4WS9 A;  1NY8 A;  2HHH C;  4PHT A;  2EGT A;  5AE1 A;  3NYR A;  4DR4 C;  4R1M A;  5BUS A;  4GKJ C;  2P2F A;  3UZ0 A;  3FCC A;  4GXQ A; 
#chains in the Genus database with same CATH homology
 2VZE A;  2ATW A;  4B3T C;  5BSV A;  4BSZ A;  1ZB8 A;  4L7I A;  5K8F A;  3GPC A;  5LMU C;  3VNR A;  4D56 A;  1ZB9 A;  4AQY C;  2CXC A;  4ZLP A;  5KEI A;  1J5E C;  1PG3 A;  3EQ6 A;  3IEU A;  2E8C A;  4JI7 C;  1T5H X;  2UUA C;  3T1H C;  4LF6 C;  1HR0 C;  2P2J A;  3TDE A;  4LFA C;  3PES A;  2AYA A;  2OO4 A;  2WP0 C;  3C5E A;  1HNX C;  4LF5 C;  4DUY C;  4LF8 C;  4DCV A;  4OX9 C;  1XNQ C;  1K0R A;  3PRO C;  1IBL C;  2ONF A;  4NDN A;  4LF4 C;  3DLP X;  3B7W A;  3OTO C;  4DV6 C;  4JI4 C;  1RG9 A;  1N36 C;  2Y4N A;  1VLA A;  3CJE A;  2BH1 X;  1P7L A;  4XX2 A;  2UXB C;  4DV3 C;  4OXI A;  4LFB C;  1XMQ C;  3DAY A;  4TPS B;  2P02 A;  3NI2 A;  1JOS A;  2CY1 A;  2UUB C;  5BSM A;  2DYJ A;  3ETO A;  4X62 C;  4BC9 A;  4RLQ A;  2BJO A;  2UUC C;  3GKU A;  4EAT A;  2D7V A;  5DV9 A;  3E7W A;  3ETC A;  2PRO A;  5IWA C;  4DV2 C;  1HNZ C;  4DR6 C;  4D57 A;  1ML8 A;  4DUZ C;  2Y4O A;  4YHH C;  3TQI A;  3TUF A;  2VQF C;  4PZP A;  2E7G A;  5BSU A;  1USP B;  5H9U A;  1O92 A;  1BA3 A;  2UU9 C;  2E0G A;  4D4I A;  1N32 C;  3R9W A;  4JI1 C;  1USP A;  3RV2 A;  1WH9 A;  4DG9 A;  1XMO C;  4RMN A;  2E8F A;  4BCA A;  2OBV A;  4FUQ A;  1HH2 P;  4DR2 C;  5IFI A;  1L2F A;  2Y27 A;  4DG8 A;  1N34 C;  5AE3 A;  4HPV A;  1MXA A;  4NXN C;  3L8C A;  4KTT A;  3CW8 X;  4L4Q A;  3NYQ A;  4JI0 C;  4DV1 C;  1MD9 A;  1V25 A;  4B3R C;  3R9X A;  4BBY A;  4GXR A;  3LGX A;  1I94 C;  3NPD A;  1IBM C;  3KXW A;  4DV4 C;  5JRH A;  4FUT A;  3GR1 A;  1MDB A;  5BUQ A;  4R1L A;  2V7B A;  2P2B A;  1XRA A;  3SO4 A;  5A19 A;  1T5D X;  2P2M A;  1MXB A;  1NYE A;  4JYA C;  2F4V C;  2E8E A;  4NOZ A;  5FLX D;  2YCB A;  3N2Q A;  3JAM D;  1WF3 A;  1O93 A;  4PRO C;  1PA4 A;  4B3M C;  4G1I A;  4JI6 C;  4BC7 A;  1EGA A;  4K0B A;  4JI2 C;  4DV0 C;  2QVZ X;  3VNS A;  1AMU A;  1MKY A;  2ZM6 C;  4ODJ A;  4DCT A;  4JV5 C;  5BSR A;  2D1Q A;  3VNQ A;  5IT9 D;  1N33 C;  5KYT A;  1PG4 A;  5K85 A;  5LMN C;  1LQL A;  5ADZ A;  5A2Q D;  4FTF A;  4U5Y D;  4L2Z A;  4OYC A;  4K0K C;  4WV3 A;  4RVN A;  2PN2 A;  4DR1 C;  3GR0 A;  3L95 X;  5BSW A;  4DR7 C;  2YWC A;  3IML A;  2D27 A;  4DV7 C;  3J80 D;  4JM1 A;  2XR1 A;  2DPL A;  2KZF A;  3S82 A;  2QVY X;  5BUR A;  3IEV A;  1O9T A;  4DR5 C;  3G7S A;  4I9F A;  4MTN A;  5CZV A;  2VQE C;  5KYV A;  4YY3 C;  2UXC C;  2D28 C;  4X64 C;  3H2T A;  3T1Y C;  2E5L C;  4LF7 C;  4JI8 C;  4DV5 C;  1RY2 A;  1V26 A;  1N2F A;  4G36 A;  4KHP C;  1LCI A;  4JI3 C;  5GTD A;  4RVO A;  4NXM C;  3EER A;  3A9V A;  3J81 D;  1O90 A;  3E7X A;  3I07 A;  2JMP A;  2WD9 A;  3A9U A;  4LFC C;  3LAX A;  4IR7 A;  2D1S A;  3R44 A;  4RM2 A;  4LE5 A;  1UKK A;  2QVX X;  5BST A;  4DR3 C;  1XRC A;  1XNR C;  2YWB A;  4MH4 A;  3LUS A;  2OPL B;  3CW9 A;  3UOW A;  3PBK A;  1FJG C;  2PT7 G;  2QW0 X;  2OPL A;  1QWI A;  1QM4 A;  3FCE A;  2P20 A;  2UXD C;  4G37 A;  5T8S A;  4GS5 A;  3AF6 A;  4IZ6 A;  1MDF A;  1MXC A;  1IBK C;  2HJG A;  4GKK C;  3RG2 A;  4R0M A;  3AF5 A;  5A1G A;  2ASB A;  1FUG A;  3IPL A;  4LF9 C;  1KKG A;  4RLF A;  3A4I A;  5T8T A;  2D1R A;  1GPM A;  4RM3 A;  4B3S C;  2VSQ A;  3N54 B;  3I08 A;  4D4G A;  2QL8 A;  3DHV A;  4X66 C;  4ISB A;  5AE2 A;  1ULT A;  5A1I A;  1YJ7 A;  4X65 C;  4DCU A;  1HNW C;  2P2Q A;  4JI5 C;  5BR8 C;  4DCS A;  3LNV A;  4KTV A;  2D1T A;  5E7Q A;  1XRB A;  5CZX A;  4I9G A;  4ZJZ A;  4WS9 A;  2HHH C;  4PHT A;  2EGT A;  5AE1 A;  3NYR A;  4DR4 C;  4R1M A;  5BUS A;  4GKJ C;  2P2F A;  3UZ0 A;  3FCC A;  4GXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...