2QL8A

Crystal structure of a putative redox protein (lsei_0423) from lactobacillus casei atcc 334 at 1.50 a resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
MQDERWNHPLYTTTAINDEELEGHAYIPGGLKVQTSSPMNDHPGTNPEQLLGLSLSTCLEATLEAVEKEHGLPHTGAVRVKVAFIGARAEYQFLVHAQVMVKGVDFDTAKAFTNEIENRCPVSKLLKNSGNYTIETVTDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative redox protein (YP_805721.1) from Lactobacillus casei ATCC 334 at 1.50 A resolution
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords Putative redox protein
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2ql8A00
2UXCC 1IBKC 2D7VA 4JYAC 3J81D 2UUAC 1PA4A 2E8FA 2UU9C 2OPLB 4MTNA 4JI4C 3J80D 1N32C 1HNZC 4MH4A 4DCUA 4DR6C 4LFBC 4B3TC 3EERA 2VQEC 1IBLC 4K0KC 4X65C 3T1YC 1ML8A 2E7GA 4DR1C 1XNRC 4DV1C 4DCVA 1K0RA 3GKUA 2JMPA 5BR8C 1N36C 4DV7C 1HNXC 4JI7C 2YCBA 4BSZA 1NYEA 2VQFC 2CXCA 4NXMC 5IT9D 5A2QD 3I07A 4JI5C 1ZB8A 1L2FA 5FLXD 4OX9C 5IWAC 4LF6C 2E8CA 1HNWC 2HHHC 1HH2P 4DR5C 1HR0C 5LMUC 1VLAA 2UXBC 1J5EC 4DV6C 1ZB9A 2ONFA 1KKGA 3OTOC 4AQYC 4DCTA 1N33C 4DV3C 4YHHC 2ZM6C 1XNQC 2UUBC 2KZFA 2PN2A 1JOSA 1IBMC 2BJOA 1WH9A 4X66C 4JI8C 1N2FA 4DCSA 2ASBA 1MKYA 2HJGA 2CY1A 2QL8A 3AF5A 1USPA 4X64C 4JI2C 3CJEA 2PT7G 3JAMD 2XR1A 4B3SC 4KHPC 4LFCC 5LMNC 3R9WA 4DR4C 1FJGC 4DV5C 2OPLA 1EGAA 1UKKA 2E8EA 2E5LC 1N34C 4LF5C 4JV5C 4DR7C 4NOZA 3T1HC 4LF8C 4JI6C 4DUYC 4XX2A 4DUZC 4LFAC 2DYJA 4JI3C 3LUSA 4DV2C 1QWIA 3IEVA 4NXNC 4DR2C 4DR3C 1XMQC 1USPB 1I94C 1XMOC 2UXDC 1LQLA 4LF4C 4JI0C 3R9XA 4GKJC 4JI1C 4YY3C 4LF7C 2F4VC 4LF9C 4DV0C 1WF3A 2UUCC 3IEUA 4GKKC 4B3MC 4DV4C 2EGTA 2ATWA 4B3RC 4X62C 3AF6A
chains in the Genus database with same CATH superfamily
2QVZX 5AE2A 3A25A 2QVXX 4KTVA 2E8FA 4JI4C 4MTNA 5IFIA 3J80D 4MH4A 3E7WA 4DR6C 3EERA 4I9GA 1GPMA 5CZXA 3PBKA 3A26A 3GPCA 2E7GA 4DR1C 2D28C 4DG9A 3CQ3A 4DCVA 4ZLPA 4BBYA 1MXBA 1HNXC 3UX3A 2VQFC 5A2QD 3CQ1A 5JRHA 4JI5C 4RM3A 4TPSB 3TUFA 5H9UA 4OX9C 2DHMA 1HNWC 3A9VA 2HHHC 3N54B 1O9TA 2UXBC 2E0GA 2DPLA 4DCTA 2KZ0A 2V7BA 5A19A 2UUBC 3FCCA 1JOSA 2Y4NA 3PESA 3UOWA 5A1GA 3R44A 4X66C 4IZ6A 3SO4A 4JI2C 1USPA 4X64C 3CJEA 3N2QA 2XR1A 1FJGC 2D1RA 4BCAA 5KEIA 2OPLA 4RM2A 3PROC 1M6XA 2OO4A 2E5LC 2BH1X 3UZ0A 4GXQA 1XRAA 2DYJA 4IR7A 3LUSA 1VEHA 3LNOA 3NPDA 5T8SA 2MMAB 4ODJA 1XMQC 1TH5A 2D1QA 5BUSA 4PUGA 1XMOC 3K6RA 4JI1C 2WP0C 5DV9A 5GTDA 4DG8A 2P02A 4B3MC 2ATWA 3RG2A 4X62C 2QW0X 2NCLA 1MDFA 1O92A 2P2BA 2UUAC 1PA4A 2UU9C 1FLOA 2OPLB 4B3TC 1IBLC 4K0KC 4X65C 3T1YC 4EATA 1RY2A 3L8CA 5BSTA 3IMLA 3GKUA 4BC9A 4FUTA 4DV7C 4RLQA 4PUHA 1NYEA 2CXCA 2P2QA 2KDNA 3UX2A 4I9FA 2MCQA 1HH2P 1O90A 5E7QA 5T8TA 1FUGA 4RVOA 4DV6C 1ZB9A 2Y27A 2KZFA 2PN2A 3GR1A 1MXCA 2ZZNA 1WH9A 1O93A 1PU1A 2P2FA 1N2FA 1MKYA 2QL8A 4G37A 3JAMD 4B3SC 4R1LA 3TR3A 5LMNC 2YWBA 1QM4A 1XHJA 1P4EA 1N34C 4D4GA 4JV5C 4DR7C 4NOZA 3TDEA 4RLFA 2ZZMA 4D4IA 4DUZC 4XX2A 2JNVA 4L4QA 3IEVA 4NXNC 4DR2C 5KYTA 4RVNA 4DR3C 3GR0A 2UXDC 5AE1A 3R9XA 5BSVA 4LF7C 4DV0C 3UEBA 4FUQA 2EGTA 2YWCA 4G36A 1IBKC 2D7VA 4JYAC 3A4IA 3J81D 1N32C 1HNZC 4DCUA 1UWDA 3LGXA 5BSWA 4D56A 1ML8A 2P2MA 4DV1C 1K0RA 3L95X 1N36C 2QVYX 2YCBA 1RG9A 4BSZA 2D27A 5IT9D 1PG3A 1PG4A 1IB8A 3I07A 3TQIA 1L2FA 5FLXD 1T5HX 4PZPA 5IWAC 3LNVA 4LF6C 4DR5C 3H2TA 1VLAA 1J5EC 5BUQA 1N33C 4WV3A 4YHHC 2BJOA 1V26A 5BSUA 4FTFA 4JI8C 4DCSA 2HJGA 2CY1A 3AF5A 1P4EC 4DR4C 4OYCA 3ETOA 4DV5C 1EGAA 4HPVA 5LCIA 2E8EA 1MXAA 3S82A 3KXWA 4R1MA 2CU6A 3NI2A 1XRBA 4JI3C 3EQ6A 2P20A 2WD9A 3I08A 1T5DX 5BSMA 4L7IA 1WCJA 1USPB 2M5HA 3NYQA 3AY0A 2F4VC 2PROA 4LF9C 3ETCA 2UUCC 3IEUA 1P7LA 4GKKC 3CW8X 4DV4C 2UXCC 2D1TA 3DHVA 5CZVA 3IPLA 3DLPX 2MM9A 4BC7A 4WS9A 1MDBA 4R0MA 1M6XC 4LFBC 4LE5A 1XRCA 4K0BA 2VQEC 3FCEA 1YJ7A 4JM1A 3G7SA 1XNRC 3RV2A 3DAYA 4JI7C 5BR8C 2JMPA 3CQ2A 4NXMC 5K85A 5BURA 1ZB8A 4U5YD 4ISBA 1BA3A 1LCIA 3B7WA 2D1SA 2M5OA 3VNQA 5K8FA 3VNSA 4ZJZA 2E8CA 3CW9A 3NYRA 2VZEA 2YX1A 5AE3A 1HR0C 5LMUC 4PUIA 2ONFA 1KKGA 3OTOC 4AQYC 4DV3C 4GS5A 2ZM6C 4D57A 1XNQC 4GXRA 1IBMC 2ASBA 3LAXA 2P2JA 2PT7G 4PHTA 4KTTA 4LFCC 4KHPC 3R9WA 1ULTA 4L2ZA 2Z51A 1UKKA 1MD9A 3VNRA 4LF5C 1V60A 4OXIA 5ADZA 3T1HC 4LF8C 4JI6C 4PROC 4DUYC 4LFAC 3C5EA 3A9UA 1V25A 5KYVA 2VSQA 4DV2C 1QWIA 4G1IA 4RMNA 3E7XA 2AYAA 1AMUA 3O2EA 1I94C 1XS3A 1NY8A 1LQLA 4LF4C 4JI0C 4GKJC 4NDNA 4YY3C 2OBVA 1WF3A 2Y4OA 5BSRA 4B3RC 3AF6A 5A1IA
chains in the Genus database with same CATH topology
2QVZX 5AE2A 2QVXX 4KTVA 2E8FA 4JI4C 4MTNA 5IFIA 3J80D 4MH4A 3E7WA 4DR6C 3EERA 4I9GA 1GPMA 5CZXA 3PBKA 3GPCA 2E7GA 4DR1C 2D28C 4DG9A 4DCVA 4ZLPA 4BBYA 1MXBA 1HNXC 2VQFC 5A2QD 5JRHA 4JI5C 4RM3A 4TPSB 3TUFA 5H9UA 4OX9C 1HNWC 3A9VA 2HHHC 3N54B 1O9TA 2UXBC 2E0GA 2DPLA 4DCTA 2V7BA 5A19A 2UUBC 3FCCA 1JOSA 2Y4NA 3PESA 3UOWA 5A1GA 3R44A 4X66C 4IZ6A 3SO4A 4JI2C 1USPA 4X64C 3CJEA 3N2QA 2XR1A 1FJGC 2D1RA 4BCAA 2OPLA 5KEIA 4RM2A 3PROC 2OO4A 2E5LC 2BH1X 3UZ0A 4GXQA 1XRAA 2DYJA 4IR7A 3LUSA 3NPDA 5T8SA 4ODJA 1XMQC 2D1QA 5BUSA 1XMOC 4JI1C 2WP0C 5DV9A 5GTDA 4DG8A 2P02A 4B3MC 2ATWA 3RG2A 4X62C 2QW0X 1MDFA 1O92A 2P2BA 2UUAC 1PA4A 2UU9C 2OPLB 4B3TC 1IBLC 4K0KC 4X65C 3T1YC 4EATA 1RY2A 3L8CA 5BSTA 3IMLA 3GKUA 4BC9A 4FUTA 4DV7C 4RLQA 1NYEA 2CXCA 2P2QA 4I9FA 1HH2P 1O90A 5E7QA 5T8TA 1FUGA 4RVOA 4DV6C 1ZB9A 2Y27A 2KZFA 2PN2A 3GR1A 1MXCA 1WH9A 1O93A 2P2FA 1N2FA 1MKYA 2QL8A 4G37A 3JAMD 4B3SC 4R1LA 5LMNC 2YWBA 1QM4A 1N34C 4D4GA 4JV5C 4DR7C 4NOZA 3TDEA 4RLFA 4D4IA 4XX2A 4DUZC 4L4QA 3IEVA 4NXNC 4DR2C 5KYTA 4RVNA 4DR3C 3GR0A 2UXDC 5AE1A 3R9XA 5BSVA 4LF7C 4DV0C 4FUQA 2EGTA 2YWCA 4G36A 1IBKC 2D7VA 4JYAC 3A4IA 3J81D 1N32C 1HNZC 4DCUA 3LGXA 5BSWA 4D56A 1ML8A 2P2MA 4DV1C 1K0RA 3L95X 1N36C 2QVYX 2YCBA 1RG9A 4BSZA 2D27A 5IT9D 1PG3A 1PG4A 3I07A 3TQIA 1L2FA 5FLXD 1T5HX 4PZPA 5IWAC 3LNVA 4LF6C 4DR5C 3H2TA 1VLAA 1J5EC 5BUQA 1N33C 4WV3A 4YHHC 2BJOA 1V26A 5BSUA 4FTFA 4JI8C 4DCSA 2HJGA 2CY1A 3AF5A 4DR4C 4OYCA 3ETOA 4DV5C 1EGAA 4HPVA 2E8EA 1MXAA 3S82A 3KXWA 4R1MA 3NI2A 1XRBA 4JI3C 3EQ6A 2P20A 2WD9A 3I08A 1T5DX 5BSMA 4L7IA 1USPB 3NYQA 2F4VC 2PROA 4LF9C 3ETCA 2UUCC 3IEUA 1P7LA 4GKKC 3CW8X 4DV4C 2UXCC 2D1TA 3DHVA 5CZVA 3IPLA 3DLPX 4BC7A 4WS9A 1MDBA 4R0MA 4LFBC 4LE5A 1XRCA 4K0BA 2VQEC 3FCEA 1YJ7A 4JM1A 3G7SA 1XNRC 3RV2A 3DAYA 4JI7C 5BR8C 2JMPA 4NXMC 5K85A 5BURA 1ZB8A 4U5YD 4ISBA 1BA3A 1LCIA 3B7WA 2D1SA 3VNQA 5K8FA 3VNSA 4ZJZA 2E8CA 3CW9A 3NYRA 2VZEA 5AE3A 1HR0C 5LMUC 2ONFA 1KKGA 3OTOC 4AQYC 4DV3C 4GS5A 2ZM6C 4D57A 1XNQC 4GXRA 1IBMC 2ASBA 3LAXA 2P2JA 2PT7G 4PHTA 4KTTA 4LFCC 4KHPC 3R9WA 1ULTA 4L2ZA 1UKKA 1MD9A 3VNRA 4LF5C 4OXIA 5ADZA 3T1HC 4LF8C 4JI6C 4PROC 4DUYC 4LFAC 3C5EA 3A9UA 1V25A 5KYVA 2VSQA 4DV2C 1QWIA 4G1IA 4RMNA 3E7XA 2AYAA 1AMUA 1I94C 1LQLA 4LF4C 4JI0C 4GKJC 4NDNA 4YY3C 2OBVA 1WF3A 2Y4OA 5BSRA 4B3RC 3AF6A 5A1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC C;  1IBK C;  2D7V A;  4JYA C;  3J81 D;  2UUA C;  1PA4 A;  2E8F A;  2UU9 C;  2OPL B;  4MTN A;  4JI4 C;  3J80 D;  1N32 C;  1HNZ C;  4MH4 A;  4DCU A;  4DR6 C;  4LFB C;  4B3T C;  3EER A;  2VQE C;  1IBL C;  4K0K C;  4X65 C;  3T1Y C;  1ML8 A;  2E7G A;  4DR1 C;  1XNR C;  4DV1 C;  4DCV A;  1K0R A;  3GKU A;  2JMP A;  5BR8 C;  1N36 C;  4DV7 C;  1HNX C;  4JI7 C;  2YCB A;  4BSZ A;  1NYE A;  2VQF C;  2CXC A;  4NXM C;  5IT9 D;  5A2Q D;  3I07 A;  4JI5 C;  1ZB8 A;  1L2F A;  5FLX D;  4OX9 C;  5IWA C;  4LF6 C;  2E8C A;  1HNW C;  2HHH C;  1HH2 P;  4DR5 C;  1HR0 C;  5LMU C;  1VLA A;  2UXB C;  1J5E C;  4DV6 C;  1ZB9 A;  2ONF A;  1KKG A;  3OTO C;  4AQY C;  4DCT A;  1N33 C;  4DV3 C;  4YHH C;  2ZM6 C;  1XNQ C;  2UUB C;  2KZF A;  2PN2 A;  1JOS A;  1IBM C;  2BJO A;  1WH9 A;  4X66 C;  4JI8 C;  1N2F A;  4DCS A;  2ASB A;  1MKY A;  2HJG A;  2CY1 A;  2QL8 A;  3AF5 A;  1USP A;  4X64 C;  4JI2 C;  3CJE A;  2PT7 G;  3JAM D;  2XR1 A;  4B3S C;  4KHP C;  4LFC C;  5LMN C;  3R9W A;  4DR4 C;  1FJG C;  4DV5 C;  2OPL A;  1EGA A;  1UKK A;  2E8E A;  2E5L C;  1N34 C;  4LF5 C;  4JV5 C;  4DR7 C;  4NOZ A;  3T1H C;  4LF8 C;  4JI6 C;  4DUY C;  4XX2 A;  4DUZ C;  4LFA C;  2DYJ A;  4JI3 C;  3LUS A;  4DV2 C;  1QWI A;  3IEV A;  4NXN C;  4DR2 C;  4DR3 C;  1XMQ C;  1USP B;  1I94 C;  1XMO C;  2UXD C;  1LQL A;  4LF4 C;  4JI0 C;  3R9X A;  4GKJ C;  4JI1 C;  4YY3 C;  4LF7 C;  2F4V C;  4LF9 C;  4DV0 C;  1WF3 A;  2UUC C;  3IEU A;  4GKK C;  4B3M C;  4DV4 C;  2EGT A;  2ATW A;  4B3R C;  4X62 C;  3AF6 A; 
#chains in the Genus database with same CATH topology
 2QVZ X;  5AE2 A;  3A25 A;  2QVX X;  4KTV A;  2E8F A;  4JI4 C;  4MTN A;  5IFI A;  3J80 D;  4MH4 A;  3E7W A;  4DR6 C;  3EER A;  4I9G A;  1GPM A;  5CZX A;  3PBK A;  3A26 A;  3GPC A;  2E7G A;  4DR1 C;  2D28 C;  4DG9 A;  3CQ3 A;  4DCV A;  4ZLP A;  4BBY A;  1MXB A;  1HNX C;  3UX3 A;  2VQF C;  5A2Q D;  3CQ1 A;  5JRH A;  4JI5 C;  4RM3 A;  4TPS B;  3TUF A;  5H9U A;  4OX9 C;  2DHM A;  1HNW C;  3A9V A;  2HHH C;  3N54 B;  1O9T A;  2UXB C;  2E0G A;  2DPL A;  4DCT A;  2KZ0 A;  2V7B A;  5A19 A;  2UUB C;  3FCC A;  1JOS A;  2Y4N A;  3PES A;  3UOW A;  5A1G A;  3R44 A;  4X66 C;  4IZ6 A;  3SO4 A;  4JI2 C;  1USP A;  4X64 C;  3CJE A;  3N2Q A;  2XR1 A;  1FJG C;  2D1R A;  4BCA A;  5KEI A;  2OPL A;  4RM2 A;  3PRO C;  1M6X A;  2OO4 A;  2E5L C;  2BH1 X;  3UZ0 A;  4GXQ A;  1XRA A;  2DYJ A;  4IR7 A;  3LUS A;  1VEH A;  3LNO A;  3NPD A;  5T8S A;  2MMA B;  4ODJ A;  1XMQ C;  1TH5 A;  2D1Q A;  5BUS A;  4PUG A;  1XMO C;  3K6R A;  4JI1 C;  2WP0 C;  5DV9 A;  5GTD A;  4DG8 A;  2P02 A;  4B3M C;  2ATW A;  3RG2 A;  4X62 C;  2QW0 X;  2NCL A;  1MDF A;  1O92 A;  2P2B A;  2UUA C;  1PA4 A;  2UU9 C;  1FLO A;  2OPL B;  4B3T C;  1IBL C;  4K0K C;  4X65 C;  3T1Y C;  4EAT A;  1RY2 A;  3L8C A;  5BST A;  3IML A;  3GKU A;  4BC9 A;  4FUT A;  4DV7 C;  4RLQ A;  4PUH A;  1NYE A;  2CXC A;  2P2Q A;  2KDN A;  3UX2 A;  4I9F A;  2MCQ A;  1HH2 P;  1O90 A;  5E7Q A;  5T8T A;  1FUG A;  4RVO A;  4DV6 C;  1ZB9 A;  2Y27 A;  2KZF A;  2PN2 A;  3GR1 A;  1MXC A;  2ZZN A;  1WH9 A;  1O93 A;  1PU1 A;  2P2F A;  1N2F A;  1MKY A;  2QL8 A;  4G37 A;  3JAM D;  4B3S C;  4R1L A;  3TR3 A;  5LMN C;  2YWB A;  1QM4 A;  1XHJ A;  1P4E A;  1N34 C;  4D4G A;  4JV5 C;  4DR7 C;  4NOZ A;  3TDE A;  4RLF A;  2ZZM A;  4D4I A;  4DUZ C;  4XX2 A;  2JNV A;  4L4Q A;  3IEV A;  4NXN C;  4DR2 C;  5KYT A;  4RVN A;  4DR3 C;  3GR0 A;  2UXD C;  5AE1 A;  3R9X A;  5BSV A;  4LF7 C;  4DV0 C;  3UEB A;  4FUQ A;  2EGT A;  2YWC A;  4G36 A;  1IBK C;  2D7V A;  4JYA C;  3A4I A;  3J81 D;  1N32 C;  1HNZ C;  4DCU A;  1UWD A;  3LGX A;  5BSW A;  4D56 A;  1ML8 A;  2P2M A;  4DV1 C;  1K0R A;  3L95 X;  1N36 C;  2QVY X;  2YCB A;  1RG9 A;  4BSZ A;  2D27 A;  5IT9 D;  1PG3 A;  1PG4 A;  1IB8 A;  3I07 A;  3TQI A;  1L2F A;  5FLX D;  1T5H X;  4PZP A;  5IWA C;  3LNV A;  4LF6 C;  4DR5 C;  3H2T A;  1VLA A;  1J5E C;  5BUQ A;  1N33 C;  4WV3 A;  4YHH C;  2BJO A;  1V26 A;  5BSU A;  4FTF A;  4JI8 C;  4DCS A;  2HJG A;  2CY1 A;  3AF5 A;  1P4E C;  4DR4 C;  4OYC A;  3ETO A;  4DV5 C;  1EGA A;  4HPV A;  5LCI A;  2E8E A;  1MXA A;  3S82 A;  3KXW A;  4R1M A;  2CU6 A;  3NI2 A;  1XRB A;  4JI3 C;  3EQ6 A;  2P20 A;  2WD9 A;  3I08 A;  1T5D X;  5BSM A;  4L7I A;  1WCJ A;  1USP B;  2M5H A;  3NYQ A;  3AY0 A;  2F4V C;  2PRO A;  4LF9 C;  3ETC A;  2UUC C;  3IEU A;  1P7L A;  4GKK C;  3CW8 X;  4DV4 C;  2UXC C;  2D1T A;  3DHV A;  5CZV A;  3IPL A;  3DLP X;  2MM9 A;  4BC7 A;  4WS9 A;  1MDB A;  4R0M A;  1M6X C;  4LFB C;  4LE5 A;  1XRC A;  4K0B A;  2VQE C;  3FCE A;  1YJ7 A;  4JM1 A;  3G7S A;  1XNR C;  3RV2 A;  3DAY A;  4JI7 C;  5BR8 C;  2JMP A;  3CQ2 A;  4NXM C;  5K85 A;  5BUR A;  1ZB8 A;  4U5Y D;  4ISB A;  1BA3 A;  1LCI A;  3B7W A;  2D1S A;  2M5O A;  3VNQ A;  5K8F A;  3VNS A;  4ZJZ A;  2E8C A;  3CW9 A;  3NYR A;  2VZE A;  2YX1 A;  5AE3 A;  1HR0 C;  5LMU C;  4PUI A;  2ONF A;  1KKG A;  3OTO C;  4AQY C;  4DV3 C;  4GS5 A;  2ZM6 C;  4D57 A;  1XNQ C;  4GXR A;  1IBM C;  2ASB A;  3LAX A;  2P2J A;  2PT7 G;  4PHT A;  4KTT A;  4LFC C;  4KHP C;  3R9W A;  1ULT A;  4L2Z A;  2Z51 A;  1UKK A;  1MD9 A;  3VNR A;  4LF5 C;  1V60 A;  4OXI A;  5ADZ A;  3T1H C;  4LF8 C;  4JI6 C;  4PRO C;  4DUY C;  4LFA C;  3C5E A;  3A9U A;  1V25 A;  5KYV A;  2VSQ A;  4DV2 C;  1QWI A;  4G1I A;  4RMN A;  3E7X A;  2AYA A;  1AMU A;  3O2E A;  1I94 C;  1XS3 A;  1NY8 A;  1LQL A;  4LF4 C;  4JI0 C;  4GKJ C;  4NDN A;  4YY3 C;  2OBV A;  1WF3 A;  2Y4O A;  5BSR A;  4B3R C;  3AF6 A;  5A1I A; 
#chains in the Genus database with same CATH homology
 2QVZ X;  5AE2 A;  2QVX X;  4KTV A;  2E8F A;  4JI4 C;  4MTN A;  5IFI A;  3J80 D;  4MH4 A;  3E7W A;  4DR6 C;  3EER A;  4I9G A;  1GPM A;  5CZX A;  3PBK A;  3GPC A;  2E7G A;  4DR1 C;  2D28 C;  4DG9 A;  4DCV A;  4ZLP A;  4BBY A;  1MXB A;  1HNX C;  2VQF C;  5A2Q D;  5JRH A;  4JI5 C;  4RM3 A;  4TPS B;  3TUF A;  5H9U A;  4OX9 C;  1HNW C;  3A9V A;  2HHH C;  3N54 B;  1O9T A;  2UXB C;  2E0G A;  2DPL A;  4DCT A;  2V7B A;  5A19 A;  2UUB C;  3FCC A;  1JOS A;  2Y4N A;  3PES A;  3UOW A;  5A1G A;  3R44 A;  4X66 C;  4IZ6 A;  3SO4 A;  4JI2 C;  1USP A;  4X64 C;  3CJE A;  3N2Q A;  2XR1 A;  1FJG C;  2D1R A;  4BCA A;  2OPL A;  5KEI A;  4RM2 A;  3PRO C;  2OO4 A;  2E5L C;  2BH1 X;  3UZ0 A;  4GXQ A;  1XRA A;  2DYJ A;  4IR7 A;  3LUS A;  3NPD A;  5T8S A;  4ODJ A;  1XMQ C;  2D1Q A;  5BUS A;  1XMO C;  4JI1 C;  2WP0 C;  5DV9 A;  5GTD A;  4DG8 A;  2P02 A;  4B3M C;  2ATW A;  3RG2 A;  4X62 C;  2QW0 X;  1MDF A;  1O92 A;  2P2B A;  2UUA C;  1PA4 A;  2UU9 C;  2OPL B;  4B3T C;  1IBL C;  4K0K C;  4X65 C;  3T1Y C;  4EAT A;  1RY2 A;  3L8C A;  5BST A;  3IML A;  3GKU A;  4BC9 A;  4FUT A;  4DV7 C;  4RLQ A;  1NYE A;  2CXC A;  2P2Q A;  4I9F A;  1HH2 P;  1O90 A;  5E7Q A;  5T8T A;  1FUG A;  4RVO A;  4DV6 C;  1ZB9 A;  2Y27 A;  2KZF A;  2PN2 A;  3GR1 A;  1MXC A;  1WH9 A;  1O93 A;  2P2F A;  1N2F A;  1MKY A;  2QL8 A;  4G37 A;  3JAM D;  4B3S C;  4R1L A;  5LMN C;  2YWB A;  1QM4 A;  1N34 C;  4D4G A;  4JV5 C;  4DR7 C;  4NOZ A;  3TDE A;  4RLF A;  4D4I A;  4XX2 A;  4DUZ C;  4L4Q A;  3IEV A;  4NXN C;  4DR2 C;  5KYT A;  4RVN A;  4DR3 C;  3GR0 A;  2UXD C;  5AE1 A;  3R9X A;  5BSV A;  4LF7 C;  4DV0 C;  4FUQ A;  2EGT A;  2YWC A;  4G36 A;  1IBK C;  2D7V A;  4JYA C;  3A4I A;  3J81 D;  1N32 C;  1HNZ C;  4DCU A;  3LGX A;  5BSW A;  4D56 A;  1ML8 A;  2P2M A;  4DV1 C;  1K0R A;  3L95 X;  1N36 C;  2QVY X;  2YCB A;  1RG9 A;  4BSZ A;  2D27 A;  5IT9 D;  1PG3 A;  1PG4 A;  3I07 A;  3TQI A;  1L2F A;  5FLX D;  1T5H X;  4PZP A;  5IWA C;  3LNV A;  4LF6 C;  4DR5 C;  3H2T A;  1VLA A;  1J5E C;  5BUQ A;  1N33 C;  4WV3 A;  4YHH C;  2BJO A;  1V26 A;  5BSU A;  4FTF A;  4JI8 C;  4DCS A;  2HJG A;  2CY1 A;  3AF5 A;  4DR4 C;  4OYC A;  3ETO A;  4DV5 C;  1EGA A;  4HPV A;  2E8E A;  1MXA A;  3S82 A;  3KXW A;  4R1M A;  3NI2 A;  1XRB A;  4JI3 C;  3EQ6 A;  2P20 A;  2WD9 A;  3I08 A;  1T5D X;  5BSM A;  4L7I A;  1USP B;  3NYQ A;  2F4V C;  2PRO A;  4LF9 C;  3ETC A;  2UUC C;  3IEU A;  1P7L A;  4GKK C;  3CW8 X;  4DV4 C;  2UXC C;  2D1T A;  3DHV A;  5CZV A;  3IPL A;  3DLP X;  4BC7 A;  4WS9 A;  1MDB A;  4R0M A;  4LFB C;  4LE5 A;  1XRC A;  4K0B A;  2VQE C;  3FCE A;  1YJ7 A;  4JM1 A;  3G7S A;  1XNR C;  3RV2 A;  3DAY A;  4JI7 C;  5BR8 C;  2JMP A;  4NXM C;  5K85 A;  5BUR A;  1ZB8 A;  4U5Y D;  4ISB A;  1BA3 A;  1LCI A;  3B7W A;  2D1S A;  3VNQ A;  5K8F A;  3VNS A;  4ZJZ A;  2E8C A;  3CW9 A;  3NYR A;  2VZE A;  5AE3 A;  1HR0 C;  5LMU C;  2ONF A;  1KKG A;  3OTO C;  4AQY C;  4DV3 C;  4GS5 A;  2ZM6 C;  4D57 A;  1XNQ C;  4GXR A;  1IBM C;  2ASB A;  3LAX A;  2P2J A;  2PT7 G;  4PHT A;  4KTT A;  4LFC C;  4KHP C;  3R9W A;  1ULT A;  4L2Z A;  1UKK A;  1MD9 A;  3VNR A;  4LF5 C;  4OXI A;  5ADZ A;  3T1H C;  4LF8 C;  4JI6 C;  4PRO C;  4DUY C;  4LFA C;  3C5E A;  3A9U A;  1V25 A;  5KYV A;  2VSQ A;  4DV2 C;  1QWI A;  4G1I A;  4RMN A;  3E7X A;  2AYA A;  1AMU A;  1I94 C;  1LQL A;  4LF4 C;  4JI0 C;  4GKJ C;  4NDN A;  4YY3 C;  2OBV A;  1WF3 A;  2Y4O A;  5BSR A;  4B3R C;  3AF6 A;  5A1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...