4LE5A

Structure of an unusual s-adenosylmethionine synthetase from campylobacter jejuni
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
399
structure length
388
Chain Sequence
MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVAGNKVVIGGEVKSNHKLSKADYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNEQSGETGAGDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPHELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMKIEDLRSLVMKLILDSNLPKELFDPNKTRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTKVDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSLTPNWIRDKFHLDKPSKETFLYADVAARGQVGQKDYPWEKLDALEQFKKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an unusual S-adenosylmethionine synthetase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
total genus 137
structure length 388
sequence length 399
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A02
4L4QA 1XRCA 4KTVA 2P02A 3SO4A 3RV2A 1O90A 1FUGA 4ODJA 1QM4A 3S82A 1MXBA 5T8SA 3IMLA 4HPVA 5A1GA 2DPLA 4WS9A 4K0BA 4LE5A 3TDEA 4L2ZA 1MXCA 5T8TA 3TQIA 1O9TA 1P7LA 2YWCA 2OBVA 1GPMA 1XRAA 4KTTA 1MXAA 5A19A 4NDNA 2YWBA 5A1IA 4L7IA 1XRBA 1O93A 5H9UA 1O92A 1RG9A 3A4IA 3UOWA
chains in the Genus database with same CATH superfamily
1JOSA 2OO4A 2QVYX 3GR1A 4GKKC 1J5EC 3IMLA 1NY8A 4HPVA 5E7QA 3H2TA 2M5HA 3L95X 3AY0A 5AE1A 4DV0C 4OYCA 5GTDA 3CJEA 3C5EA 2CU6A 2HHHC 4PUHA 5BUSA 3DLPX 5IFIA 4LF8C 2E8FA 5K85A 4B3TC 3LUSA 1TH5A 5CZXA 2ONFA 1UWDA 4PHTA 2VQEC 4D4IA 2KDNA 4DCVA 2D28C 3N54B 5CZVA 4BSZA 1ZB9A 3CW8X 1V60A 1IBKC 4LFAC 2XR1A 1IBLC 3AF6A 3SO4A 1T5HX 3LGXA 2HJGA 5JRHA 2DYJA 2OPLA 1RY2A 4FTFA 3TR3A 4L2ZA 1T5DX 1HNXC 2P2QA 2Y4OA 4DV3C 1MKYA 2YWCA 2EGTA 3AF5A 3J81D 3UEBA 3I08A 4G37A 4D57A 1IB8A 4D4GA 3A4IA 1ULTA 1HNWC 2P2MA 3A26A 4DG8A 3DHVA 3CQ2A 3E7WA 4B3SC 4R1LA 4R1MA 2D27A 3VNQA 1N34C 4JI1C 2E0GA 4DR7C 2UXCC 4BBYA 3UZ0A 2ZZNA 2JNVA 2E7GA 4NXMC 2P2FA 2OPLB 1XS3A 1NYEA 4GS5A 3E7XA 1BA3A 4LF7C 4NXNC 4LF4C 1HNZC 1ZB8A 4DR3C 1LCIA 4IZ6A 4ZLPA 4RLFA 5BSRA 3IEUA 3G7SA 5KYTA 4X66C 3UX3A 2DHMA 3IPLA 4LF5C 3L8CA 5LMNC 4JI7C 4B3MC 1XMOC 2Y4NA 1GPMA 2UUBC 2D1QA 4DV6C 1ML8A 4OX9C 5BURA 5A2QD 4KTVA 2D1RA 3FCEA 1HH2P 2E5LC 2ZZMA 1L2FA 2P2BA 4XX2A 4X62C 3I07A 3CW9A 3T1YC 3TDEA 4RVOA 3R9WA 1PU1A 2ASBA 5BUQA 1USPB 2UUCC 2VQFC 4IR7A 5H9UA 4TPSB 2BJOA 4DCUA 2P02A 1FJGC 1XHJA 1FUGA 4PUIA 3J80D 1YJ7A 4LFBC 2V7BA 5AE2A 3CQ1A 5LCIA 2D7VA 3A9UA 4D56A 2Y27A 2Z51A 3A25A 5FLXD 2OBVA 4ZJZA 4JI5C 2MCQA 1WF3A 1O92A 4DV2C 4LFCC 2MM9A 4FUQA 4L4QA 1VLAA 2WD9A 4DCTA 1V25A 4DV4C 1N2FA 4JI3C 1WH9A 2E8CA 4YHHC 3GR0A 4I9FA 2CY1A 2YWBA 1MDFA 5KEIA 4MH4A 1HR0C 3UX2A 3N2QA 3RV2A 5BSWA 3B7WA 4BC9A 1I94C 1AMUA 4DR5C 4JI2C 4PZPA 2P20A 2DPLA 4WS9A 4JV5C 2F4VC 4K0BA 1QWIA 3PESA 4R0MA 4LF6C 3TQIA 1IBMC 1M6XC 4DCSA 5A19A 3IEVA 3K6RA 4L7IA 2UXDC 4PUGA 2CXCA 1XNQC 1LQLA 2D1TA 2PT7G 1MD9A 4DR1C 1V26A 5KYVA 4WV3A 3LAXA 4DR2C 2UUAC 5A1GA 5K8FA 1N36C 4FUTA 1PG4A 1P4EA 4LF9C 5DV9A 4U5YD 5IT9D 1P7LA 2D1SA 2QVZX 1XRAA 4BCAA 5IWAC 4DUYC 4NDNA 2VZEA 4K0KC 3RG2A 3O2EA 1O90A 4ODJA 3CQ3A 1N33C 1MXBA 5T8SA 4DV1C 2UU9C 1PA4A 3EQ6A 4JI4C 1USPA 5BSTA 2QL8A 4RVNA 4G36A 4KTTA 3NI2A 3ETCA 2UXBC 4ISBA 1KKGA 4BC7A 2ZM6C 3LNOA 3NPDA 3PBKA 1UKKA 2YCBA 1EGAA 1XMQC 4AQYC 4KHPC 3R9XA 5BSMA 4DUZC 2MMAB 3UOWA 1M6XA 2AYAA 2P2JA 4PROC 3PROC 2ATWA 3TUFA 3T1HC 4LE5A 1MXCA 4NOZA 4RM2A 3DAYA 2QW0X 2PROA 4JI0C 1XRCA 4GXRA 3OTOC 4B3RC 4EATA 4JM1A 1QM4A 2E8EA 1FLOA 2QVXX 3NYQA 4X64C 3VNRA 3JAMD 4DV7C 4JI8C 2WP0C 5BR8C 4RLQA 1WCJA 4MTNA 4JYAC 1XRBA 2M5OA 4DR4C 5AE3A 4GKJC 2BH1X 4DV5C 4DR6C 4JI6C 5BSUA 3FCCA 3KXWA 4X65C 2PN2A 1VEHA 2VSQA 5T8TA 1O9TA 1N32C 3R44A 4OXIA 1MDBA 5A1IA 5LMUC 1K0RA 4G1IA 2KZFA 2YX1A 3A9VA 1XNRC 1P4EC 2NCLA 5BSVA 3NYRA 4RM3A 3ETOA 3S82A 1PG3A 2JMPA 4I9GA 4GXQA 2KZ0A 3GKUA 5ADZA 3VNSA 3LNVA 4YY3C 1MXAA 3GPCA 4RMNA 1O93A 3EERA 1RG9A 4DG9A
chains in the Genus database with same CATH topology
1JOSA 2OO4A 2QVYX 3GR1A 4GKKC 1J5EC 3IMLA 4HPVA 5E7QA 3H2TA 3L95X 5AE1A 4DV0C 4OYCA 5GTDA 3CJEA 3C5EA 2HHHC 5BUSA 3DLPX 5IFIA 4LF8C 2E8FA 5K85A 4B3TC 3LUSA 5CZXA 2ONFA 4PHTA 2VQEC 4D4IA 4DCVA 2D28C 3N54B 5CZVA 4BSZA 1ZB9A 3CW8X 1IBKC 4LFAC 2XR1A 1IBLC 3AF6A 3SO4A 1T5HX 3LGXA 2HJGA 5JRHA 2DYJA 2OPLA 1RY2A 4FTFA 4L2ZA 1T5DX 1HNXC 2P2QA 2Y4OA 4DV3C 1MKYA 2YWCA 2EGTA 3AF5A 3J81D 3I08A 4G37A 4D57A 4D4GA 3A4IA 1ULTA 1HNWC 2P2MA 4DG8A 3DHVA 3E7WA 4B3SC 4R1LA 4R1MA 2D27A 3VNQA 1N34C 4JI1C 2E0GA 4DR7C 2UXCC 4BBYA 3UZ0A 2E7GA 4NXMC 2P2FA 2OPLB 1NYEA 4GS5A 3E7XA 1BA3A 4LF7C 4NXNC 4LF4C 1HNZC 1ZB8A 4DR3C 1LCIA 4IZ6A 4ZLPA 4RLFA 5BSRA 3IEUA 3G7SA 5KYTA 4X66C 3IPLA 4LF5C 3L8CA 5LMNC 4JI7C 4B3MC 1XMOC 2Y4NA 1GPMA 2UUBC 2D1QA 4DV6C 1ML8A 4OX9C 5BURA 5A2QD 4KTVA 2D1RA 3FCEA 1HH2P 2E5LC 1L2FA 2P2BA 4XX2A 4X62C 3I07A 3CW9A 3T1YC 3TDEA 4RVOA 3R9WA 2ASBA 5BUQA 1USPB 2UUCC 2VQFC 4IR7A 5H9UA 4TPSB 2BJOA 4DCUA 2P02A 1FJGC 1FUGA 3J80D 1YJ7A 4LFBC 2V7BA 5AE2A 2D7VA 3A9UA 4D56A 2Y27A 5FLXD 2OBVA 4ZJZA 4JI5C 1WF3A 1O92A 4DV2C 4LFCC 4FUQA 4L4QA 1VLAA 2WD9A 4DCTA 1V25A 4DV4C 1N2FA 4JI3C 1WH9A 2E8CA 4YHHC 3GR0A 4I9FA 2CY1A 2YWBA 1MDFA 5KEIA 4MH4A 1HR0C 3N2QA 3RV2A 5BSWA 3B7WA 4BC9A 1I94C 1AMUA 4DR5C 4JI2C 4PZPA 2P20A 2DPLA 4WS9A 4JV5C 2F4VC 4K0BA 1QWIA 3PESA 4R0MA 4LF6C 3TQIA 1IBMC 4DCSA 5A19A 3IEVA 4L7IA 2UXDC 2CXCA 1XNQC 1LQLA 2D1TA 2PT7G 1MD9A 4DR1C 1V26A 5KYVA 4WV3A 3LAXA 4DR2C 2UUAC 5A1GA 5K8FA 1N36C 4FUTA 1PG4A 4LF9C 5DV9A 4U5YD 5IT9D 1P7LA 2D1SA 2QVZX 1XRAA 4BCAA 5IWAC 4DUYC 4NDNA 2VZEA 4K0KC 3RG2A 1O90A 4ODJA 1N33C 1MXBA 5T8SA 4DV1C 2UU9C 1PA4A 3EQ6A 4JI4C 1USPA 5BSTA 2QL8A 4RVNA 4G36A 4KTTA 3NI2A 3ETCA 2UXBC 4ISBA 1KKGA 4BC7A 2ZM6C 3NPDA 3PBKA 1UKKA 2YCBA 1EGAA 1XMQC 4AQYC 4KHPC 3R9XA 5BSMA 4DUZC 3UOWA 2AYAA 2P2JA 4PROC 3PROC 2ATWA 3TUFA 3T1HC 4LE5A 1MXCA 4NOZA 4RM2A 3DAYA 2QW0X 2PROA 4JI0C 1XRCA 4GXRA 3OTOC 4B3RC 4EATA 4JM1A 1QM4A 2E8EA 2QVXX 3NYQA 4X64C 3VNRA 3JAMD 4DV7C 4JI8C 2WP0C 5BR8C 4RLQA 4JYAC 4MTNA 1XRBA 4DR4C 5AE3A 4GKJC 2BH1X 4DV5C 4DR6C 4JI6C 5BSUA 3FCCA 3KXWA 4X65C 2PN2A 2VSQA 5T8TA 1O9TA 1N32C 3R44A 4OXIA 1MDBA 5A1IA 5LMUC 1K0RA 4G1IA 2KZFA 3A9VA 1XNRC 5BSVA 3NYRA 4RM3A 3ETOA 3S82A 1PG3A 2JMPA 4I9GA 4GXQA 3GKUA 5ADZA 3VNSA 3LNVA 4YY3C 1MXAA 3GPCA 4RMNA 1O93A 3EERA 1RG9A 4DG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L4Q A;  1XRC A;  4KTV A;  2P02 A;  3SO4 A;  3RV2 A;  1O90 A;  1FUG A;  4ODJ A;  1QM4 A;  3S82 A;  1MXB A;  5T8S A;  3IML A;  4HPV A;  5A1G A;  2DPL A;  4WS9 A;  4K0B A;  4LE5 A;  3TDE A;  4L2Z A;  1MXC A;  5T8T A;  3TQI A;  1O9T A;  1P7L A;  2YWC A;  2OBV A;  1GPM A;  1XRA A;  4KTT A;  1MXA A;  5A19 A;  4NDN A;  2YWB A;  5A1I A;  4L7I A;  1XRB A;  1O93 A;  5H9U A;  1O92 A;  1RG9 A;  3A4I A;  3UOW A; 
#chains in the Genus database with same CATH topology
 1JOS A;  2OO4 A;  2QVY X;  3GR1 A;  4GKK C;  1J5E C;  3IML A;  1NY8 A;  4HPV A;  5E7Q A;  3H2T A;  2M5H A;  3L95 X;  3AY0 A;  5AE1 A;  4DV0 C;  4OYC A;  5GTD A;  3CJE A;  3C5E A;  2CU6 A;  2HHH C;  4PUH A;  5BUS A;  3DLP X;  5IFI A;  4LF8 C;  2E8F A;  5K85 A;  4B3T C;  3LUS A;  1TH5 A;  5CZX A;  2ONF A;  1UWD A;  4PHT A;  2VQE C;  4D4I A;  2KDN A;  4DCV A;  2D28 C;  3N54 B;  5CZV A;  4BSZ A;  1ZB9 A;  3CW8 X;  1V60 A;  1IBK C;  4LFA C;  2XR1 A;  1IBL C;  3AF6 A;  3SO4 A;  1T5H X;  3LGX A;  2HJG A;  5JRH A;  2DYJ A;  2OPL A;  1RY2 A;  4FTF A;  3TR3 A;  4L2Z A;  1T5D X;  1HNX C;  2P2Q A;  2Y4O A;  4DV3 C;  1MKY A;  2YWC A;  2EGT A;  3AF5 A;  3J81 D;  3UEB A;  3I08 A;  4G37 A;  4D57 A;  1IB8 A;  4D4G A;  3A4I A;  1ULT A;  1HNW C;  2P2M A;  3A26 A;  4DG8 A;  3DHV A;  3CQ2 A;  3E7W A;  4B3S C;  4R1L A;  4R1M A;  2D27 A;  3VNQ A;  1N34 C;  4JI1 C;  2E0G A;  4DR7 C;  2UXC C;  4BBY A;  3UZ0 A;  2ZZN A;  2JNV A;  2E7G A;  4NXM C;  2P2F A;  2OPL B;  1XS3 A;  1NYE A;  4GS5 A;  3E7X A;  1BA3 A;  4LF7 C;  4NXN C;  4LF4 C;  1HNZ C;  1ZB8 A;  4DR3 C;  1LCI A;  4IZ6 A;  4ZLP A;  4RLF A;  5BSR A;  3IEU A;  3G7S A;  5KYT A;  4X66 C;  3UX3 A;  2DHM A;  3IPL A;  4LF5 C;  3L8C A;  5LMN C;  4JI7 C;  4B3M C;  1XMO C;  2Y4N A;  1GPM A;  2UUB C;  2D1Q A;  4DV6 C;  1ML8 A;  4OX9 C;  5BUR A;  5A2Q D;  4KTV A;  2D1R A;  3FCE A;  1HH2 P;  2E5L C;  2ZZM A;  1L2F A;  2P2B A;  4XX2 A;  4X62 C;  3I07 A;  3CW9 A;  3T1Y C;  3TDE A;  4RVO A;  3R9W A;  1PU1 A;  2ASB A;  5BUQ A;  1USP B;  2UUC C;  2VQF C;  4IR7 A;  5H9U A;  4TPS B;  2BJO A;  4DCU A;  2P02 A;  1FJG C;  1XHJ A;  1FUG A;  4PUI A;  3J80 D;  1YJ7 A;  4LFB C;  2V7B A;  5AE2 A;  3CQ1 A;  5LCI A;  2D7V A;  3A9U A;  4D56 A;  2Y27 A;  2Z51 A;  3A25 A;  5FLX D;  2OBV A;  4ZJZ A;  4JI5 C;  2MCQ A;  1WF3 A;  1O92 A;  4DV2 C;  4LFC C;  2MM9 A;  4FUQ A;  4L4Q A;  1VLA A;  2WD9 A;  4DCT A;  1V25 A;  4DV4 C;  1N2F A;  4JI3 C;  1WH9 A;  2E8C A;  4YHH C;  3GR0 A;  4I9F A;  2CY1 A;  2YWB A;  1MDF A;  5KEI A;  4MH4 A;  1HR0 C;  3UX2 A;  3N2Q A;  3RV2 A;  5BSW A;  3B7W A;  4BC9 A;  1I94 C;  1AMU A;  4DR5 C;  4JI2 C;  4PZP A;  2P20 A;  2DPL A;  4WS9 A;  4JV5 C;  2F4V C;  4K0B A;  1QWI A;  3PES A;  4R0M A;  4LF6 C;  3TQI A;  1IBM C;  1M6X C;  4DCS A;  5A19 A;  3IEV A;  3K6R A;  4L7I A;  2UXD C;  4PUG A;  2CXC A;  1XNQ C;  1LQL A;  2D1T A;  2PT7 G;  1MD9 A;  4DR1 C;  1V26 A;  5KYV A;  4WV3 A;  3LAX A;  4DR2 C;  2UUA C;  5A1G A;  5K8F A;  1N36 C;  4FUT A;  1PG4 A;  1P4E A;  4LF9 C;  5DV9 A;  4U5Y D;  5IT9 D;  1P7L A;  2D1S A;  2QVZ X;  1XRA A;  4BCA A;  5IWA C;  4DUY C;  4NDN A;  2VZE A;  4K0K C;  3RG2 A;  3O2E A;  1O90 A;  4ODJ A;  3CQ3 A;  1N33 C;  1MXB A;  5T8S A;  4DV1 C;  2UU9 C;  1PA4 A;  3EQ6 A;  4JI4 C;  1USP A;  5BST A;  2QL8 A;  4RVN A;  4G36 A;  4KTT A;  3NI2 A;  3ETC A;  2UXB C;  4ISB A;  1KKG A;  4BC7 A;  2ZM6 C;  3LNO A;  3NPD A;  3PBK A;  1UKK A;  2YCB A;  1EGA A;  1XMQ C;  4AQY C;  4KHP C;  3R9X A;  5BSM A;  4DUZ C;  2MMA B;  3UOW A;  1M6X A;  2AYA A;  2P2J A;  4PRO C;  3PRO C;  2ATW A;  3TUF A;  3T1H C;  4LE5 A;  1MXC A;  4NOZ A;  4RM2 A;  3DAY A;  2QW0 X;  2PRO A;  4JI0 C;  1XRC A;  4GXR A;  3OTO C;  4B3R C;  4EAT A;  4JM1 A;  1QM4 A;  2E8E A;  1FLO A;  2QVX X;  3NYQ A;  4X64 C;  3VNR A;  3JAM D;  4DV7 C;  4JI8 C;  2WP0 C;  5BR8 C;  4RLQ A;  1WCJ A;  4MTN A;  4JYA C;  1XRB A;  2M5O A;  4DR4 C;  5AE3 A;  4GKJ C;  2BH1 X;  4DV5 C;  4DR6 C;  4JI6 C;  5BSU A;  3FCC A;  3KXW A;  4X65 C;  2PN2 A;  1VEH A;  2VSQ A;  5T8T A;  1O9T A;  1N32 C;  3R44 A;  4OXI A;  1MDB A;  5A1I A;  5LMU C;  1K0R A;  4G1I A;  2KZF A;  2YX1 A;  3A9V A;  1XNR C;  1P4E C;  2NCL A;  5BSV A;  3NYR A;  4RM3 A;  3ETO A;  3S82 A;  1PG3 A;  2JMP A;  4I9G A;  4GXQ A;  2KZ0 A;  3GKU A;  5ADZ A;  3VNS A;  3LNV A;  4YY3 C;  1MXA A;  3GPC A;  4RMN A;  1O93 A;  3EER A;  1RG9 A;  4DG9 A; 
#chains in the Genus database with same CATH homology
 1JOS A;  2OO4 A;  2QVY X;  3GR1 A;  4GKK C;  1J5E C;  3IML A;  4HPV A;  5E7Q A;  3H2T A;  3L95 X;  5AE1 A;  4DV0 C;  4OYC A;  5GTD A;  3CJE A;  3C5E A;  2HHH C;  5BUS A;  3DLP X;  5IFI A;  4LF8 C;  2E8F A;  5K85 A;  4B3T C;  3LUS A;  5CZX A;  2ONF A;  4PHT A;  2VQE C;  4D4I A;  4DCV A;  2D28 C;  3N54 B;  5CZV A;  4BSZ A;  1ZB9 A;  3CW8 X;  1IBK C;  4LFA C;  2XR1 A;  1IBL C;  3AF6 A;  3SO4 A;  1T5H X;  3LGX A;  2HJG A;  5JRH A;  2DYJ A;  2OPL A;  1RY2 A;  4FTF A;  4L2Z A;  1T5D X;  1HNX C;  2P2Q A;  2Y4O A;  4DV3 C;  1MKY A;  2YWC A;  2EGT A;  3AF5 A;  3J81 D;  3I08 A;  4G37 A;  4D57 A;  4D4G A;  3A4I A;  1ULT A;  1HNW C;  2P2M A;  4DG8 A;  3DHV A;  3E7W A;  4B3S C;  4R1L A;  4R1M A;  2D27 A;  3VNQ A;  1N34 C;  4JI1 C;  2E0G A;  4DR7 C;  2UXC C;  4BBY A;  3UZ0 A;  2E7G A;  4NXM C;  2P2F A;  2OPL B;  1NYE A;  4GS5 A;  3E7X A;  1BA3 A;  4LF7 C;  4NXN C;  4LF4 C;  1HNZ C;  1ZB8 A;  4DR3 C;  1LCI A;  4IZ6 A;  4ZLP A;  4RLF A;  5BSR A;  3IEU A;  3G7S A;  5KYT A;  4X66 C;  3IPL A;  4LF5 C;  3L8C A;  5LMN C;  4JI7 C;  4B3M C;  1XMO C;  2Y4N A;  1GPM A;  2UUB C;  2D1Q A;  4DV6 C;  1ML8 A;  4OX9 C;  5BUR A;  5A2Q D;  4KTV A;  2D1R A;  3FCE A;  1HH2 P;  2E5L C;  1L2F A;  2P2B A;  4XX2 A;  4X62 C;  3I07 A;  3CW9 A;  3T1Y C;  3TDE A;  4RVO A;  3R9W A;  2ASB A;  5BUQ A;  1USP B;  2UUC C;  2VQF C;  4IR7 A;  5H9U A;  4TPS B;  2BJO A;  4DCU A;  2P02 A;  1FJG C;  1FUG A;  3J80 D;  1YJ7 A;  4LFB C;  2V7B A;  5AE2 A;  2D7V A;  3A9U A;  4D56 A;  2Y27 A;  5FLX D;  2OBV A;  4ZJZ A;  4JI5 C;  1WF3 A;  1O92 A;  4DV2 C;  4LFC C;  4FUQ A;  4L4Q A;  1VLA A;  2WD9 A;  4DCT A;  1V25 A;  4DV4 C;  1N2F A;  4JI3 C;  1WH9 A;  2E8C A;  4YHH C;  3GR0 A;  4I9F A;  2CY1 A;  2YWB A;  1MDF A;  5KEI A;  4MH4 A;  1HR0 C;  3N2Q A;  3RV2 A;  5BSW A;  3B7W A;  4BC9 A;  1I94 C;  1AMU A;  4DR5 C;  4JI2 C;  4PZP A;  2P20 A;  2DPL A;  4WS9 A;  4JV5 C;  2F4V C;  4K0B A;  1QWI A;  3PES A;  4R0M A;  4LF6 C;  3TQI A;  1IBM C;  4DCS A;  5A19 A;  3IEV A;  4L7I A;  2UXD C;  2CXC A;  1XNQ C;  1LQL A;  2D1T A;  2PT7 G;  1MD9 A;  4DR1 C;  1V26 A;  5KYV A;  4WV3 A;  3LAX A;  4DR2 C;  2UUA C;  5A1G A;  5K8F A;  1N36 C;  4FUT A;  1PG4 A;  4LF9 C;  5DV9 A;  4U5Y D;  5IT9 D;  1P7L A;  2D1S A;  2QVZ X;  1XRA A;  4BCA A;  5IWA C;  4DUY C;  4NDN A;  2VZE A;  4K0K C;  3RG2 A;  1O90 A;  4ODJ A;  1N33 C;  1MXB A;  5T8S A;  4DV1 C;  2UU9 C;  1PA4 A;  3EQ6 A;  4JI4 C;  1USP A;  5BST A;  2QL8 A;  4RVN A;  4G36 A;  4KTT A;  3NI2 A;  3ETC A;  2UXB C;  4ISB A;  1KKG A;  4BC7 A;  2ZM6 C;  3NPD A;  3PBK A;  1UKK A;  2YCB A;  1EGA A;  1XMQ C;  4AQY C;  4KHP C;  3R9X A;  5BSM A;  4DUZ C;  3UOW A;  2AYA A;  2P2J A;  4PRO C;  3PRO C;  2ATW A;  3TUF A;  3T1H C;  4LE5 A;  1MXC A;  4NOZ A;  4RM2 A;  3DAY A;  2QW0 X;  2PRO A;  4JI0 C;  1XRC A;  4GXR A;  3OTO C;  4B3R C;  4EAT A;  4JM1 A;  1QM4 A;  2E8E A;  2QVX X;  3NYQ A;  4X64 C;  3VNR A;  3JAM D;  4DV7 C;  4JI8 C;  2WP0 C;  5BR8 C;  4RLQ A;  4JYA C;  4MTN A;  1XRB A;  4DR4 C;  5AE3 A;  4GKJ C;  2BH1 X;  4DV5 C;  4DR6 C;  4JI6 C;  5BSU A;  3FCC A;  3KXW A;  4X65 C;  2PN2 A;  2VSQ A;  5T8T A;  1O9T A;  1N32 C;  3R44 A;  4OXI A;  1MDB A;  5A1I A;  5LMU C;  1K0R A;  4G1I A;  2KZF A;  3A9V A;  1XNR C;  5BSV A;  3NYR A;  4RM3 A;  3ETO A;  3S82 A;  1PG3 A;  2JMP A;  4I9G A;  4GXQ A;  3GKU A;  5ADZ A;  3VNS A;  3LNV A;  4YY3 C;  1MXA A;  3GPC A;  4RMN A;  1O93 A;  3EER A;  1RG9 A;  4DG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...