4LE5A

Structure of an unusual s-adenosylmethionine synthetase from campylobacter jejuni
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
399
structure length
388
Chain Sequence
MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVAGNKVVIGGEVKSNHKLSKADYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNEQSGETGAGDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPHELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMKIEDLRSLVMKLILDSNLPKELFDPNKTRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTKVDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSLTPNWIRDKFHLDKPSKETFLYADVAARGQVGQKDYPWEKLDALEQFKKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an unusual S-adenosylmethionine synthetase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
total genus 137
structure length 388
sequence length 399
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A02
5A1IA 3SO4A 4ODJA 3IMLA 2OBVA 3RV2A 1O92A 2YWBA 1QM4A 4L2ZA 4K0BA 5T8SA 1GPMA 1RG9A 1MXBA 1MXAA 1O90A 3TDEA 4KTTA 3TQIA 1FUGA 1XRBA 5T8TA 4HPVA 4NDNA 5H9UA 4WS9A 2P02A 2YWCA 2DPLA 4LE5A 1MXCA 5A1GA 1XRAA 4L7IA 3S82A 4KTVA 4L4QA 1P7LA 3A4IA 3UOWA 5A19A 1O9TA 1O93A 1XRCA
chains in the Genus database with same CATH superfamily
4GKKC 1P4EA 3NYQA 4DCSA 1KKGA 4R0MA 4DV4C 4KHPC 5CZXA 1T5DX 4DV0C 4G1IA 1ZB9A 5BURA 5IFIA 4I9GA 1XS3A 4XX2A 2KDNA 4JV5C 4X65C 3T1YC 1FJGC 5FLXD 4BC7A 2UXCC 5BSWA 4LF5C 3CW8X 2JNVA 4DR4C 5IWAC 4GKJC 1HNXC 3NYRA 5BR8C 4DV5C 4KTTA 4DCTA 4K0KC 4OX9C 1N34C 3NI2A 4DR1C 2E5LC 1WCJA 2WD9A 1O93A 3CQ2A 3CQ1A 4PUIA 2UXDC 4DCVA 3GR0A 1BA3A 2E8EA 3IEUA 3I08A 4JI4C 4LFCC 2VSQA 4AQYC 2KZ0A 3FCEA 1VLAA 5A1GA 5GTDA 2OPLB 3R44A 1YJ7A 1IBMC 1PG4A 1V60A 1P7LA 4IR7A 3A4IA 4LF9C 3GKUA 1TH5A 1JOSA 2Z51A 2OO4A 5AE3A 3NPDA 1LCIA 2D1QA 4RLFA 2QVZX 5BSVA 4DV6C 3G7SA 3RG2A 4D4GA 4DV3C 3CJEA 1K0RA 2PN2A 5A19A 3TUFA 3VNSA 1XHJA 4ODJA 2D1SA 2JMPA 3UEBA 2YWBA 1XNQC 1ZB8A 2QVXX 4NXMC 4RM2A 5JRHA 1XMQC 2Y27A 1XRBA 1ML8A 5T8TA 4MH4A 5A2QD 1PA4A 4ISBA 2DPLA 1HNZC 2QVYX 1M6XA 4DR6C 2ZZMA 4B3TC 2YCBA 2D1TA 5KYTA 2D7VA 2CU6A 4NOZA 5BSMA 4EATA 4K0BA 1MXAA 1VEHA 3J81D 4OYCA 4OXIA 2P20A 4LF7C 1FUGA 5H9UA 4DV1C 1XNRC 2MM9A 2BJOA 1J5EC 4TPSB 3A25A 4LF6C 3VNRA 3J80D 4L4QA 3E7XA 1IBKC 1AMUA 4LFAC 4U5YD 2ONFA 4DG8A 4RVOA 4JI8C 1V25A 2CXCA 4LF4C 5AE1A 3I07A 1RY2A 1WF3A 1ULTA 4YHHC 3LNVA 3IPLA 4R1MA 2OBVA 3CW9A 3OTOC 4PROC 2ASBA 5BUSA 4YY3C 4DR7C 1QM4A 3A9VA 2D1RA 1N33C 4WV3A 3TQIA 3N2QA 1UKKA 2P2JA 5BUQA 4B3RC 4X64C 4DR3C 4BSZA 1QWIA 3H2TA 1P4EC 4GS5A 2HJGA 2ZZNA 1WH9A 2UUAC 2AYAA 4JYAC 1O92A 2QL8A 3AY0A 5E7QA 4DR5C 1UWDA 3PESA 5T8SA 1IB8A 4B3SC 4JI1C 1MDFA 3LAXA 2P02A 4DUYC 2YWCA 3DAYA 3EERA 3CQ3A 2M5OA 2XR1A 4DCUA 4G36A 3EQ6A 4DV7C 3JAMD 1I94C 5DV9A 4JI6C 1FLOA 2Y4OA 2V7BA 4WS9A 4IZ6A 4LE5A 1N32C 1MXCA 2D27A 2E8CA 3S82A 1PG3A 3ETCA 4LFBC 1EGAA 3LNOA 2D28C 2P2MA 4JM1A 4X66C 3R9XA 1USPA 1MD9A 4JI7C 5LMNC 2UUBC 2F4VC 2OPLA 3UX3A 4NDNA 1HH2P 2P2BA 1LQLA 4D4IA 4PHTA 2DYJA 1IBLC 4MTNA 3B7WA 5A1IA 3A26A 5K85A 2M5HA 4L2ZA 3VNQA 2E8FA 1GPMA 4DG9A 4G37A 2NCLA 4PUHA 4BC9A 3DHVA 1XRAA 3N54B 4BBYA 3E7WA 1MKYA 2DHMA 1N2FA 2VZEA 3C5EA 1O9TA 5LMUC 1NYEA 3TR3A 4GXQA 1XRCA 2CY1A 3DLPX 4JI2C 2UU9C 2VQEC 3LUSA 3L8CA 4X62C 3O2EA 2EGTA 1O90A 3FCCA 4FUTA 3L95X 2PROA 2MMAB 3GPCA 4GXRA 1M6XC 3K6RA 4FTFA 2PT7G 4LF8C 5KEIA 5KYVA 4ZLPA 3RV2A 5AE2A 1T5HX 1PU1A 4B3MC 2KZFA 3R9WA 4DR2C 3UZ0A 3TDEA 1N36C 1NY8A 5LCIA 3KXWA 3PBKA 4BCAA 4HPVA 2P2FA 4RM3A 4R1LA 4NXNC 2E0GA 3LGXA 3UOWA 4RVNA 1L2FA 4JI3C 3SO4A 2UXBC 5ADZA 3IMLA 2E7GA 5K8FA 2VQFC 3T1HC 4DV2C 4RLQA 4D56A 4JI5C 2WP0C 3ETOA 4DUZC 3IEVA 4I9FA 1XMOC 2MCQA 2HHHC 5BSUA 4ZJZA 5CZVA 3GR1A 2UUCC 2BH1X 1HR0C 4KTVA 4D57A 4PZPA 3PROC 3A9UA 2P2QA 2Y4NA 5BSTA 2ZM6C 4FUQA 3AF6A 5BSRA 3UX2A 2YX1A 1RG9A 1MXBA 2ATWA 5IT9D 4PUGA 1V26A 1MDBA 4L7IA 2QW0X 3AF5A 1USPB 1HNWC 4JI0C 4RMNA
chains in the Genus database with same CATH topology
4GKKC 3NYQA 4DCSA 1KKGA 4R0MA 4DV4C 4KHPC 5CZXA 1T5DX 4DV0C 4G1IA 1ZB9A 5BURA 5IFIA 4I9GA 4XX2A 4JV5C 4X65C 3T1YC 1FJGC 5FLXD 4BC7A 2UXCC 5BSWA 4LF5C 3CW8X 4DR4C 5IWAC 4GKJC 1HNXC 3NYRA 5BR8C 4DV5C 4KTTA 4DCTA 4K0KC 4OX9C 1N34C 3NI2A 4DR1C 2E5LC 2WD9A 1O93A 2UXDC 4DCVA 3GR0A 1BA3A 2E8EA 3IEUA 3I08A 4JI4C 4LFCC 2VSQA 4AQYC 3FCEA 1VLAA 5A1GA 5GTDA 2OPLB 3R44A 1YJ7A 1IBMC 1PG4A 1P7LA 4IR7A 3A4IA 4LF9C 3GKUA 1JOSA 2OO4A 5AE3A 3NPDA 1LCIA 2D1QA 4RLFA 2QVZX 5BSVA 4DV6C 3G7SA 3RG2A 4D4GA 4DV3C 3CJEA 1K0RA 2PN2A 5A19A 3TUFA 3VNSA 4ODJA 2D1SA 2JMPA 2YWBA 1XNQC 1ZB8A 2QVXX 4NXMC 4RM2A 1XMQC 5JRHA 2Y27A 1XRBA 1ML8A 5T8TA 4MH4A 5A2QD 1PA4A 4ISBA 2DPLA 1HNZC 2QVYX 4DR6C 4B3TC 2YCBA 2D1TA 5KYTA 2D7VA 4NOZA 5BSMA 4EATA 4K0BA 1MXAA 3J81D 4OYCA 4OXIA 2P20A 4LF7C 1FUGA 5H9UA 4DV1C 1XNRC 2BJOA 1J5EC 4TPSB 4LF6C 3VNRA 3J80D 4L4QA 3E7XA 1IBKC 1AMUA 4LFAC 4U5YD 2ONFA 4DG8A 4RVOA 4JI8C 1V25A 2CXCA 4LF4C 5AE1A 3I07A 1RY2A 1WF3A 1ULTA 4YHHC 3LNVA 3IPLA 4R1MA 2OBVA 3CW9A 3OTOC 4PROC 2ASBA 5BUSA 4YY3C 4DR7C 1QM4A 3A9VA 2D1RA 1N33C 4WV3A 3TQIA 3N2QA 1UKKA 2P2JA 5BUQA 4B3RC 4X64C 4DR3C 4BSZA 1QWIA 3H2TA 4GS5A 2HJGA 1WH9A 2UUAC 2AYAA 4JYAC 1O92A 2QL8A 5E7QA 4DR5C 3PESA 5T8SA 4B3SC 4JI1C 1MDFA 3LAXA 2P02A 4DUYC 2YWCA 3DAYA 3EERA 2XR1A 4DCUA 4G36A 3EQ6A 4DV7C 3JAMD 1I94C 5DV9A 4JI6C 2Y4OA 2V7BA 4WS9A 4IZ6A 4LE5A 1N32C 1MXCA 2D27A 2E8CA 3S82A 1PG3A 3ETCA 4LFBC 1EGAA 2D28C 2P2MA 4JM1A 4X66C 3R9XA 1USPA 1MD9A 4JI7C 5LMNC 2UUBC 2F4VC 2OPLA 4NDNA 1HH2P 2P2BA 1LQLA 4D4IA 4PHTA 2DYJA 1IBLC 4MTNA 3B7WA 5A1IA 5K85A 4L2ZA 3VNQA 2E8FA 1GPMA 4DG9A 4G37A 4BC9A 3DHVA 1XRAA 3N54B 4BBYA 1MKYA 2VZEA 1N2FA 3C5EA 3E7WA 1O9TA 5LMUC 1NYEA 1XRCA 4GXQA 2CY1A 3DLPX 4JI2C 2UU9C 2VQEC 3LUSA 3L8CA 4X62C 2EGTA 1O90A 3FCCA 4FUTA 3L95X 2PROA 3GPCA 4GXRA 4FTFA 2PT7G 4LF8C 5KEIA 5KYVA 4ZLPA 3RV2A 5AE2A 1T5HX 4B3MC 2KZFA 3R9WA 4DR2C 3UZ0A 3TDEA 1N36C 3KXWA 3PBKA 4BCAA 4HPVA 2P2FA 4RM3A 4R1LA 4NXNC 2E0GA 3LGXA 3UOWA 4RVNA 1L2FA 4JI3C 3SO4A 2UXBC 5ADZA 3IMLA 2E7GA 5K8FA 2VQFC 3T1HC 4DV2C 4RLQA 4D56A 4JI5C 2WP0C 3ETOA 4DUZC 3IEVA 4I9FA 1XMOC 2HHHC 5BSUA 4ZJZA 5CZVA 3GR1A 2UUCC 2BH1X 1HR0C 4KTVA 4D57A 4PZPA 3PROC 3A9UA 2P2QA 2Y4NA 5BSTA 2ZM6C 4FUQA 3AF6A 5BSRA 1RG9A 1MXBA 2ATWA 5IT9D 1V26A 1MDBA 4L7IA 2QW0X 3AF5A 1USPB 1HNWC 4JI0C 4RMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1I A;  3SO4 A;  4ODJ A;  3IML A;  2OBV A;  3RV2 A;  1O92 A;  2YWB A;  1QM4 A;  4L2Z A;  4K0B A;  5T8S A;  1GPM A;  1RG9 A;  1MXB A;  1MXA A;  1O90 A;  3TDE A;  4KTT A;  3TQI A;  1FUG A;  1XRB A;  5T8T A;  4HPV A;  4NDN A;  5H9U A;  4WS9 A;  2P02 A;  2YWC A;  2DPL A;  4LE5 A;  1MXC A;  5A1G A;  1XRA A;  4L7I A;  3S82 A;  4KTV A;  4L4Q A;  1P7L A;  3A4I A;  3UOW A;  5A19 A;  1O9T A;  1O93 A;  1XRC A; 
#chains in the Genus database with same CATH topology
 4GKK C;  1P4E A;  3NYQ A;  4DCS A;  1KKG A;  4R0M A;  4DV4 C;  4KHP C;  5CZX A;  1T5D X;  4DV0 C;  4G1I A;  1ZB9 A;  5BUR A;  5IFI A;  4I9G A;  1XS3 A;  4XX2 A;  2KDN A;  4JV5 C;  4X65 C;  3T1Y C;  1FJG C;  5FLX D;  4BC7 A;  2UXC C;  5BSW A;  4LF5 C;  3CW8 X;  2JNV A;  4DR4 C;  5IWA C;  4GKJ C;  1HNX C;  3NYR A;  5BR8 C;  4DV5 C;  4KTT A;  4DCT A;  4K0K C;  4OX9 C;  1N34 C;  3NI2 A;  4DR1 C;  2E5L C;  1WCJ A;  2WD9 A;  1O93 A;  3CQ2 A;  3CQ1 A;  4PUI A;  2UXD C;  4DCV A;  3GR0 A;  1BA3 A;  2E8E A;  3IEU A;  3I08 A;  4JI4 C;  4LFC C;  2VSQ A;  4AQY C;  2KZ0 A;  3FCE A;  1VLA A;  5A1G A;  5GTD A;  2OPL B;  3R44 A;  1YJ7 A;  1IBM C;  1PG4 A;  1V60 A;  1P7L A;  4IR7 A;  3A4I A;  4LF9 C;  3GKU A;  1TH5 A;  1JOS A;  2Z51 A;  2OO4 A;  5AE3 A;  3NPD A;  1LCI A;  2D1Q A;  4RLF A;  2QVZ X;  5BSV A;  4DV6 C;  3G7S A;  3RG2 A;  4D4G A;  4DV3 C;  3CJE A;  1K0R A;  2PN2 A;  5A19 A;  3TUF A;  3VNS A;  1XHJ A;  4ODJ A;  2D1S A;  2JMP A;  3UEB A;  2YWB A;  1XNQ C;  1ZB8 A;  2QVX X;  4NXM C;  4RM2 A;  5JRH A;  1XMQ C;  2Y27 A;  1XRB A;  1ML8 A;  5T8T A;  4MH4 A;  5A2Q D;  1PA4 A;  4ISB A;  2DPL A;  1HNZ C;  2QVY X;  1M6X A;  4DR6 C;  2ZZM A;  4B3T C;  2YCB A;  2D1T A;  5KYT A;  2D7V A;  2CU6 A;  4NOZ A;  5BSM A;  4EAT A;  4K0B A;  1MXA A;  1VEH A;  3J81 D;  4OYC A;  4OXI A;  2P20 A;  4LF7 C;  1FUG A;  5H9U A;  4DV1 C;  1XNR C;  2MM9 A;  2BJO A;  1J5E C;  4TPS B;  3A25 A;  4LF6 C;  3VNR A;  3J80 D;  4L4Q A;  3E7X A;  1IBK C;  1AMU A;  4LFA C;  4U5Y D;  2ONF A;  4DG8 A;  4RVO A;  4JI8 C;  1V25 A;  2CXC A;  4LF4 C;  5AE1 A;  3I07 A;  1RY2 A;  1WF3 A;  1ULT A;  4YHH C;  3LNV A;  3IPL A;  4R1M A;  2OBV A;  3CW9 A;  3OTO C;  4PRO C;  2ASB A;  5BUS A;  4YY3 C;  4DR7 C;  1QM4 A;  3A9V A;  2D1R A;  1N33 C;  4WV3 A;  3TQI A;  3N2Q A;  1UKK A;  2P2J A;  5BUQ A;  4B3R C;  4X64 C;  4DR3 C;  4BSZ A;  1QWI A;  3H2T A;  1P4E C;  4GS5 A;  2HJG A;  2ZZN A;  1WH9 A;  2UUA C;  2AYA A;  4JYA C;  1O92 A;  2QL8 A;  3AY0 A;  5E7Q A;  4DR5 C;  1UWD A;  3PES A;  5T8S A;  1IB8 A;  4B3S C;  4JI1 C;  1MDF A;  3LAX A;  2P02 A;  4DUY C;  2YWC A;  3DAY A;  3EER A;  3CQ3 A;  2M5O A;  2XR1 A;  4DCU A;  4G36 A;  3EQ6 A;  4DV7 C;  3JAM D;  1I94 C;  5DV9 A;  4JI6 C;  1FLO A;  2Y4O A;  2V7B A;  4WS9 A;  4IZ6 A;  4LE5 A;  1N32 C;  1MXC A;  2D27 A;  2E8C A;  3S82 A;  1PG3 A;  3ETC A;  4LFB C;  1EGA A;  3LNO A;  2D28 C;  2P2M A;  4JM1 A;  4X66 C;  3R9X A;  1USP A;  1MD9 A;  4JI7 C;  5LMN C;  2UUB C;  2F4V C;  2OPL A;  3UX3 A;  4NDN A;  1HH2 P;  2P2B A;  1LQL A;  4D4I A;  4PHT A;  2DYJ A;  1IBL C;  4MTN A;  3B7W A;  5A1I A;  3A26 A;  5K85 A;  2M5H A;  4L2Z A;  3VNQ A;  2E8F A;  1GPM A;  4DG9 A;  4G37 A;  2NCL A;  4PUH A;  4BC9 A;  3DHV A;  1XRA A;  3N54 B;  4BBY A;  3E7W A;  1MKY A;  2DHM A;  1N2F A;  2VZE A;  3C5E A;  1O9T A;  5LMU C;  1NYE A;  3TR3 A;  4GXQ A;  1XRC A;  2CY1 A;  3DLP X;  4JI2 C;  2UU9 C;  2VQE C;  3LUS A;  3L8C A;  4X62 C;  3O2E A;  2EGT A;  1O90 A;  3FCC A;  4FUT A;  3L95 X;  2PRO A;  2MMA B;  3GPC A;  4GXR A;  1M6X C;  3K6R A;  4FTF A;  2PT7 G;  4LF8 C;  5KEI A;  5KYV A;  4ZLP A;  3RV2 A;  5AE2 A;  1T5H X;  1PU1 A;  4B3M C;  2KZF A;  3R9W A;  4DR2 C;  3UZ0 A;  3TDE A;  1N36 C;  1NY8 A;  5LCI A;  3KXW A;  3PBK A;  4BCA A;  4HPV A;  2P2F A;  4RM3 A;  4R1L A;  4NXN C;  2E0G A;  3LGX A;  3UOW A;  4RVN A;  1L2F A;  4JI3 C;  3SO4 A;  2UXB C;  5ADZ A;  3IML A;  2E7G A;  5K8F A;  2VQF C;  3T1H C;  4DV2 C;  4RLQ A;  4D56 A;  4JI5 C;  2WP0 C;  3ETO A;  4DUZ C;  3IEV A;  4I9F A;  1XMO C;  2MCQ A;  2HHH C;  5BSU A;  4ZJZ A;  5CZV A;  3GR1 A;  2UUC C;  2BH1 X;  1HR0 C;  4KTV A;  4D57 A;  4PZP A;  3PRO C;  3A9U A;  2P2Q A;  2Y4N A;  5BST A;  2ZM6 C;  4FUQ A;  3AF6 A;  5BSR A;  3UX2 A;  2YX1 A;  1RG9 A;  1MXB A;  2ATW A;  5IT9 D;  4PUG A;  1V26 A;  1MDB A;  4L7I A;  2QW0 X;  3AF5 A;  1USP B;  1HNW C;  4JI0 C;  4RMN A; 
#chains in the Genus database with same CATH homology
 4GKK C;  3NYQ A;  4DCS A;  1KKG A;  4R0M A;  4DV4 C;  4KHP C;  5CZX A;  1T5D X;  4DV0 C;  4G1I A;  1ZB9 A;  5BUR A;  5IFI A;  4I9G A;  4XX2 A;  4JV5 C;  4X65 C;  3T1Y C;  1FJG C;  5FLX D;  4BC7 A;  2UXC C;  5BSW A;  4LF5 C;  3CW8 X;  4DR4 C;  5IWA C;  4GKJ C;  1HNX C;  3NYR A;  5BR8 C;  4DV5 C;  4KTT A;  4DCT A;  4K0K C;  4OX9 C;  1N34 C;  3NI2 A;  4DR1 C;  2E5L C;  2WD9 A;  1O93 A;  2UXD C;  4DCV A;  3GR0 A;  1BA3 A;  2E8E A;  3IEU A;  3I08 A;  4JI4 C;  4LFC C;  2VSQ A;  4AQY C;  3FCE A;  1VLA A;  5A1G A;  5GTD A;  2OPL B;  3R44 A;  1YJ7 A;  1IBM C;  1PG4 A;  1P7L A;  4IR7 A;  3A4I A;  4LF9 C;  3GKU A;  1JOS A;  2OO4 A;  5AE3 A;  3NPD A;  1LCI A;  2D1Q A;  4RLF A;  2QVZ X;  5BSV A;  4DV6 C;  3G7S A;  3RG2 A;  4D4G A;  4DV3 C;  3CJE A;  1K0R A;  2PN2 A;  5A19 A;  3TUF A;  3VNS A;  4ODJ A;  2D1S A;  2JMP A;  2YWB A;  1XNQ C;  1ZB8 A;  2QVX X;  4NXM C;  4RM2 A;  1XMQ C;  5JRH A;  2Y27 A;  1XRB A;  1ML8 A;  5T8T A;  4MH4 A;  5A2Q D;  1PA4 A;  4ISB A;  2DPL A;  1HNZ C;  2QVY X;  4DR6 C;  4B3T C;  2YCB A;  2D1T A;  5KYT A;  2D7V A;  4NOZ A;  5BSM A;  4EAT A;  4K0B A;  1MXA A;  3J81 D;  4OYC A;  4OXI A;  2P20 A;  4LF7 C;  1FUG A;  5H9U A;  4DV1 C;  1XNR C;  2BJO A;  1J5E C;  4TPS B;  4LF6 C;  3VNR A;  3J80 D;  4L4Q A;  3E7X A;  1IBK C;  1AMU A;  4LFA C;  4U5Y D;  2ONF A;  4DG8 A;  4RVO A;  4JI8 C;  1V25 A;  2CXC A;  4LF4 C;  5AE1 A;  3I07 A;  1RY2 A;  1WF3 A;  1ULT A;  4YHH C;  3LNV A;  3IPL A;  4R1M A;  2OBV A;  3CW9 A;  3OTO C;  4PRO C;  2ASB A;  5BUS A;  4YY3 C;  4DR7 C;  1QM4 A;  3A9V A;  2D1R A;  1N33 C;  4WV3 A;  3TQI A;  3N2Q A;  1UKK A;  2P2J A;  5BUQ A;  4B3R C;  4X64 C;  4DR3 C;  4BSZ A;  1QWI A;  3H2T A;  4GS5 A;  2HJG A;  1WH9 A;  2UUA C;  2AYA A;  4JYA C;  1O92 A;  2QL8 A;  5E7Q A;  4DR5 C;  3PES A;  5T8S A;  4B3S C;  4JI1 C;  1MDF A;  3LAX A;  2P02 A;  4DUY C;  2YWC A;  3DAY A;  3EER A;  2XR1 A;  4DCU A;  4G36 A;  3EQ6 A;  4DV7 C;  3JAM D;  1I94 C;  5DV9 A;  4JI6 C;  2Y4O A;  2V7B A;  4WS9 A;  4IZ6 A;  4LE5 A;  1N32 C;  1MXC A;  2D27 A;  2E8C A;  3S82 A;  1PG3 A;  3ETC A;  4LFB C;  1EGA A;  2D28 C;  2P2M A;  4JM1 A;  4X66 C;  3R9X A;  1USP A;  1MD9 A;  4JI7 C;  5LMN C;  2UUB C;  2F4V C;  2OPL A;  4NDN A;  1HH2 P;  2P2B A;  1LQL A;  4D4I A;  4PHT A;  2DYJ A;  1IBL C;  4MTN A;  3B7W A;  5A1I A;  5K85 A;  4L2Z A;  3VNQ A;  2E8F A;  1GPM A;  4DG9 A;  4G37 A;  4BC9 A;  3DHV A;  1XRA A;  3N54 B;  4BBY A;  1MKY A;  2VZE A;  1N2F A;  3C5E A;  3E7W A;  1O9T A;  5LMU C;  1NYE A;  1XRC A;  4GXQ A;  2CY1 A;  3DLP X;  4JI2 C;  2UU9 C;  2VQE C;  3LUS A;  3L8C A;  4X62 C;  2EGT A;  1O90 A;  3FCC A;  4FUT A;  3L95 X;  2PRO A;  3GPC A;  4GXR A;  4FTF A;  2PT7 G;  4LF8 C;  5KEI A;  5KYV A;  4ZLP A;  3RV2 A;  5AE2 A;  1T5H X;  4B3M C;  2KZF A;  3R9W A;  4DR2 C;  3UZ0 A;  3TDE A;  1N36 C;  3KXW A;  3PBK A;  4BCA A;  4HPV A;  2P2F A;  4RM3 A;  4R1L A;  4NXN C;  2E0G A;  3LGX A;  3UOW A;  4RVN A;  1L2F A;  4JI3 C;  3SO4 A;  2UXB C;  5ADZ A;  3IML A;  2E7G A;  5K8F A;  2VQF C;  3T1H C;  4DV2 C;  4RLQ A;  4D56 A;  4JI5 C;  2WP0 C;  3ETO A;  4DUZ C;  3IEV A;  4I9F A;  1XMO C;  2HHH C;  5BSU A;  4ZJZ A;  5CZV A;  3GR1 A;  2UUC C;  2BH1 X;  1HR0 C;  4KTV A;  4D57 A;  4PZP A;  3PRO C;  3A9U A;  2P2Q A;  2Y4N A;  5BST A;  2ZM6 C;  4FUQ A;  3AF6 A;  5BSR A;  1RG9 A;  1MXB A;  2ATW A;  5IT9 D;  1V26 A;  1MDB A;  4L7I A;  2QW0 X;  3AF5 A;  1USP B;  1HNW C;  4JI0 C;  4RMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...