4LE5A

Structure of an unusual s-adenosylmethionine synthetase from campylobacter jejuni
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
399
structure length
388
Chain Sequence
b'MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVAGNKVVIGGEVKSNHKLSKADYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNEQSGETGAGDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPHELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMKIEDLRSLVMKLILDSNLPKELFDPNKTRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTKVDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSLTPNWIRDKFHLDKPSKETFLYADVAARGQVGQKDYPWEKLDALEQFKKLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthetase
publication title Structure of an unusual S-adenosylmethionine synthetase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
total genus 137
structure length 388
sequence length 399
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A02
1XRCA 1XRAA 1MXAA 4ODJA 3UOWA 4WS9A 1MXCA 1P7LA 1FUGA 3TDEA 4LE5A 5A1IA 2P02A 4KTTA 1O92A 5T8SA 1MXBA 4KTVA 5A19A 3TQIA 4L4QA 4L2ZA 2YWBA 1O90A 3IMLA 1O9TA 2YWCA 4HPVA 5H9UA 1GPMA 1RG9A 2OBVA 2DPLA 5T8TA 3RV2A 3S82A 4NDNA 1O93A 1QM4A 5A1GA 3A4IA 3SO4A 4L7IA 4K0BA 1XRBA
chains in the Genus database with same CATH superfamily
4B3RC 4X66C 1M6XC 1IB8A 1XNQC 2D7VA 2D27A 3EERA 3I07A 3TUFA 1WH9A 4JI1C 5BSWA 3CJEA 5AE2A 2YWCA 4DV7C 1HH2P 4GS5A 3IEUA 2DPLA 2CU6A 4RM3A 3O2EA 2JNVA 1HNWC 4L7IA 3UX3A 1USPA 4G36A 1ULTA 4JI6C 4R0MA 1MXCA 3LNVA 4OYCA 3EQ6A 2Y4OA 4D4GA 3UEBA 5BSMA 1PG3A 1BA3A 4BC7A 4GXQA 1IBKC 5T8TA 1LCIA 2DHMA 5LCIA 4RLQA 4JI0C 4B3SC 4DR6C 1L2FA 4DCUA 3DLPX 1USPB 4MTNA 1PA4A 2QVZX 4G37A 2D1RA 5A19A 2P2MA 2QVXX 3NI2A 4FUTA 3R9XA 3N2QA 5BSUA 2KZ0A 4DG9A 2E5LC 4RM2A 2M5HA 1P4EA 2E7GA 4G1IA 2D1SA 4RMNA 4IR7A 4EATA 2E8FA 1N33C 1XMOC 3KXWA 3J80D 1P4EC 4ISBA 1V25A 1ZB9A 4DV0C 5BSRA 3VNQA 2WP0C 1XRAA 5BUQA 4GKKC 2ZZMA 4DV4C 4LF6C 2D1QA 3FCEA 1N34C 2UXBC 4DUYC 3R44A 2P2JA 3I08A 2UUBC 3K6RA 2ATWA 3A26A 2E0GA 2P2QA 3LNOA 5E7QA 4LFBC 5IFIA 2OBVA 3RV2A 3LUSA 3LAXA 3J81D 4BSZA 1UWDA 1O93A 4AQYC 1UKKA 2VQFC 1QWIA 3NYQA 3PROC 1NY8A 4ODJA 2EGTA 4BBYA 3CW9A 4X65C 4MH4A 5JRHA 5KYVA 3VNRA 5IWAC 3A25A 4BC9A 2F4VC 3FCCA 3GR1A 1NYEA 5BUSA 4JI5C 2OO4A 1EGAA 3A4IA 1XRBA 4LF8C 1MXAA 3GR0A 3CQ1A 3UZ0A 2M5OA 4DV1C 5AE3A 5LMNC 2D1TA 1XMQC 4D4IA 5H9UA 1RG9A 4RLFA 1J5EC 4PUGA 4TPSB 5A1GA 4PUIA 4JV5C 3VNSA 2P2FA 5CZVA 4OXIA 4B3MC 2ZM6C 4DV2C 1PG4A 1RY2A 4WS9A 2XR1A 2D28C 1ZB8A 3NPDA 1MXBA 3LGXA 2YWBA 3IMLA 1VLAA 3ETCA 4DV3C 4LF4C 1MD9A 3E7XA 4FUQA 3CW8X 4DR3C 1XRCA 3L95X 3TR3A 4R1LA 3TDEA 3PESA 3N54B 2P02A 4KTTA 1T5DX 2KDNA 4L4QA 3A9VA 2V7BA 1JOSA 4HPVA 3T1YC 2VZEA 2QL8A 4R1MA 1I94C 2Y4NA 3L8CA 1KKGA 5A1IA 2UUAC 5FLXD 1T5HX 5KYTA 1VEHA 3TQIA 4L2ZA 4ZLPA 4ZJZA 2P20A 4D56A 1IBMC 2E8EA 4DR2C 4FTFA 1XNRC 3S82A 3IEVA 3OTOC 1LQLA 5K85A 4DCVA 3R9WA 2HHHC 2BH1X 1AMUA 3G7SA 4JI7C 2WD9A 5BURA 1TH5A 1V60A 4DG8A 4OX9C 2ZZNA 5AE1A 5ADZA 2QVYX 5DV9A 4RVOA 2MCQA 4X64C 3E7WA 3AF5A 3IPLA 4XX2A 3GKUA 1K0RA 3T1HC 4DR5C 5GTDA 5BR8C 1FUGA 4K0KC 5CZXA 2OPLA 2QW0X 3DHVA 5T8SA 2BJOA 1ML8A 3B7WA 2YCBA 1N2FA 4JI8C 3DAYA 4KHPC 3C5EA 1FLOA 2PT7G 3PBKA 1GPMA 2E8CA 1XHJA 3H2TA 4DV6C 1WF3A 4I9FA 4PZPA 4RVNA 4YY3C 4YHHC 4K0BA 4BCAA 2Y27A 4IZ6A 2NCLA 4I9GA 3UOWA 5K8FA 4LE5A 4DCSA 4KTVA 4DUZC 4PUHA 4GKJC 2OPLB 1O90A 1HNXC 1MKYA 3UX2A 2JMPA 4LF7C 2Z51A 4DR7C 3SO4A 3JAMD 5A2QD 2ASBA 3A9UA 3CQ2A 2AYAA 1P7LA 2UXDC 3ETOA 4GXRA 4PHTA 1V26A 2UU9C 2MM9A 4B3TC 1O92A 2PN2A 2UXCC 1N36C 4DV5C 5IT9D 1IBLC 1PU1A 3AF6A 4DR1C 4WV3A 4NDNA 3GPCA 1QM4A 2DYJA 4LF5C 2MMAB 4NXMC 4X62C 2VSQA 2UUCC 5BSVA 4PROC 1XS3A 2P2BA 4DR4C 4U5YD 2PROA 4D57A 3CQ3A 1O9TA 1FJGC 1N32C 1WCJA 2HJGA 2VQEC 2KZFA 1HR0C 4LFAC 4NOZA 3NYRA 4LF9C 4JYAC 4LFCC 3AY0A 5KEIA 4NXNC 1M6XA 1YJ7A 1HNZC 4JI2C 4DCTA 2CY1A 2YX1A 5LMUC 4JM1A 5BSTA 2CXCA 4JI3C 1MDFA 1MDBA 4JI4C 2ONFA 3RG2A
chains in the Genus database with same CATH topology
4B3RC 4X66C 1XNQC 2D7VA 2D27A 3EERA 3I07A 3TUFA 1WH9A 4JI1C 5BSWA 3CJEA 5AE2A 2YWCA 4DV7C 1HH2P 4GS5A 3IEUA 2DPLA 4RM3A 1HNWC 4L7IA 1USPA 4G36A 1ULTA 4JI6C 4R0MA 1MXCA 3LNVA 4OYCA 3EQ6A 2Y4OA 4D4GA 5BSMA 1PG3A 1BA3A 4BC7A 4GXQA 1IBKC 5T8TA 1LCIA 4RLQA 4JI0C 4B3SC 4DR6C 1L2FA 4DCUA 3DLPX 1USPB 4MTNA 1PA4A 2QVZX 4G37A 2D1RA 5A19A 2P2MA 2QVXX 3NI2A 4FUTA 3R9XA 3N2QA 5BSUA 4DG9A 2E5LC 4RM2A 2E7GA 4G1IA 2D1SA 4RMNA 4IR7A 4EATA 2E8FA 1N33C 1XMOC 3KXWA 3J80D 4ISBA 1V25A 1ZB9A 4DV0C 5BSRA 3VNQA 2WP0C 1XRAA 5BUQA 4GKKC 4DV4C 4LF6C 2D1QA 3FCEA 1N34C 2UXBC 4DUYC 3R44A 2P2JA 3I08A 2UUBC 2ATWA 2E0GA 2P2QA 5E7QA 4LFBC 5IFIA 2OBVA 3RV2A 3LUSA 3LAXA 3J81D 4BSZA 1O93A 4AQYC 1UKKA 2VQFC 1QWIA 3NYQA 3PROC 4ODJA 2EGTA 4BBYA 3CW9A 4X65C 4MH4A 5JRHA 5KYVA 3VNRA 5IWAC 4BC9A 2F4VC 3FCCA 3GR1A 1NYEA 5BUSA 4JI5C 2OO4A 1EGAA 3A4IA 1XRBA 4LF8C 1MXAA 3GR0A 3UZ0A 4DV1C 5AE3A 5LMNC 2D1TA 1XMQC 4D4IA 5H9UA 1RG9A 4RLFA 1J5EC 4TPSB 5A1GA 4JV5C 3VNSA 2P2FA 5CZVA 4OXIA 4B3MC 2ZM6C 4DV2C 1PG4A 1RY2A 4WS9A 2XR1A 2D28C 1ZB8A 3NPDA 1MXBA 3LGXA 2YWBA 3IMLA 1VLAA 3ETCA 4DV3C 4LF4C 1MD9A 3E7XA 4FUQA 3CW8X 4DR3C 1XRCA 3L95X 4R1LA 3TDEA 3PESA 3N54B 2P02A 4KTTA 1T5DX 4L4QA 3A9VA 2V7BA 1JOSA 4HPVA 3T1YC 2VZEA 2QL8A 4R1MA 1I94C 2Y4NA 3L8CA 1KKGA 5A1IA 2UUAC 5FLXD 1T5HX 5KYTA 3TQIA 4L2ZA 4ZLPA 4ZJZA 2P20A 4D56A 1IBMC 2E8EA 4DR2C 4FTFA 1XNRC 3S82A 3IEVA 3OTOC 1LQLA 5K85A 4DCVA 3R9WA 2HHHC 2BH1X 1AMUA 3G7SA 4JI7C 2WD9A 5BURA 4DG8A 4OX9C 5AE1A 5ADZA 2QVYX 5DV9A 4RVOA 4X64C 3E7WA 3AF5A 3IPLA 4XX2A 3GKUA 1K0RA 3T1HC 4DR5C 5GTDA 5BR8C 1FUGA 4K0KC 5CZXA 2OPLA 2QW0X 3DHVA 5T8SA 2BJOA 1ML8A 3B7WA 2YCBA 1N2FA 4JI8C 3DAYA 4KHPC 3C5EA 2PT7G 3PBKA 1GPMA 2E8CA 3H2TA 4DV6C 1WF3A 4I9FA 4PZPA 4RVNA 4YY3C 4YHHC 4K0BA 4BCAA 2Y27A 4IZ6A 4I9GA 3UOWA 5K8FA 4LE5A 4DCSA 4KTVA 4DUZC 4GKJC 2OPLB 1O90A 1HNXC 1MKYA 2JMPA 4LF7C 4DR7C 3SO4A 3JAMD 5A2QD 2ASBA 3A9UA 2AYAA 1P7LA 2UXDC 3ETOA 4GXRA 4PHTA 1V26A 2UU9C 4B3TC 1O92A 2PN2A 2UXCC 1N36C 4DV5C 5IT9D 1IBLC 3AF6A 4DR1C 4WV3A 4NDNA 3GPCA 1QM4A 2DYJA 4LF5C 4NXMC 4X62C 2VSQA 2UUCC 5BSVA 4PROC 2P2BA 4DR4C 4U5YD 2PROA 4D57A 1FJGC 1O9TA 1N32C 2HJGA 2VQEC 2KZFA 1HR0C 4LFAC 4NOZA 3NYRA 4LF9C 4JYAC 4LFCC 5KEIA 4NXNC 1YJ7A 1HNZC 4JI2C 4DCTA 2CY1A 5LMUC 4JM1A 5BSTA 2CXCA 4JI3C 1MDFA 1MDBA 4JI4C 2ONFA 3RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRC A;  1XRA A;  1MXA A;  4ODJ A;  3UOW A;  4WS9 A;  1MXC A;  1P7L A;  1FUG A;  3TDE A;  4LE5 A;  5A1I A;  2P02 A;  4KTT A;  1O92 A;  5T8S A;  1MXB A;  4KTV A;  5A19 A;  3TQI A;  4L4Q A;  4L2Z A;  2YWB A;  1O90 A;  3IML A;  1O9T A;  2YWC A;  4HPV A;  5H9U A;  1GPM A;  1RG9 A;  2OBV A;  2DPL A;  5T8T A;  3RV2 A;  3S82 A;  4NDN A;  1O93 A;  1QM4 A;  5A1G A;  3A4I A;  3SO4 A;  4L7I A;  4K0B A;  1XRB A; 
#chains in the Genus database with same CATH topology
 4B3R C;  4X66 C;  1M6X C;  1IB8 A;  1XNQ C;  2D7V A;  2D27 A;  3EER A;  3I07 A;  3TUF A;  1WH9 A;  4JI1 C;  5BSW A;  3CJE A;  5AE2 A;  2YWC A;  4DV7 C;  1HH2 P;  4GS5 A;  3IEU A;  2DPL A;  2CU6 A;  4RM3 A;  3O2E A;  2JNV A;  1HNW C;  4L7I A;  3UX3 A;  1USP A;  4G36 A;  1ULT A;  4JI6 C;  4R0M A;  1MXC A;  3LNV A;  4OYC A;  3EQ6 A;  2Y4O A;  4D4G A;  3UEB A;  5BSM A;  1PG3 A;  1BA3 A;  4BC7 A;  4GXQ A;  1IBK C;  5T8T A;  1LCI A;  2DHM A;  5LCI A;  4RLQ A;  4JI0 C;  4B3S C;  4DR6 C;  1L2F A;  4DCU A;  3DLP X;  1USP B;  4MTN A;  1PA4 A;  2QVZ X;  4G37 A;  2D1R A;  5A19 A;  2P2M A;  2QVX X;  3NI2 A;  4FUT A;  3R9X A;  3N2Q A;  5BSU A;  2KZ0 A;  4DG9 A;  2E5L C;  4RM2 A;  2M5H A;  1P4E A;  2E7G A;  4G1I A;  2D1S A;  4RMN A;  4IR7 A;  4EAT A;  2E8F A;  1N33 C;  1XMO C;  3KXW A;  3J80 D;  1P4E C;  4ISB A;  1V25 A;  1ZB9 A;  4DV0 C;  5BSR A;  3VNQ A;  2WP0 C;  1XRA A;  5BUQ A;  4GKK C;  2ZZM A;  4DV4 C;  4LF6 C;  2D1Q A;  3FCE A;  1N34 C;  2UXB C;  4DUY C;  3R44 A;  2P2J A;  3I08 A;  2UUB C;  3K6R A;  2ATW A;  3A26 A;  2E0G A;  2P2Q A;  3LNO A;  5E7Q A;  4LFB C;  5IFI A;  2OBV A;  3RV2 A;  3LUS A;  3LAX A;  3J81 D;  4BSZ A;  1UWD A;  1O93 A;  4AQY C;  1UKK A;  2VQF C;  1QWI A;  3NYQ A;  3PRO C;  1NY8 A;  4ODJ A;  2EGT A;  4BBY A;  3CW9 A;  4X65 C;  4MH4 A;  5JRH A;  5KYV A;  3VNR A;  5IWA C;  3A25 A;  4BC9 A;  2F4V C;  3FCC A;  3GR1 A;  1NYE A;  5BUS A;  4JI5 C;  2OO4 A;  1EGA A;  3A4I A;  1XRB A;  4LF8 C;  1MXA A;  3GR0 A;  3CQ1 A;  3UZ0 A;  2M5O A;  4DV1 C;  5AE3 A;  5LMN C;  2D1T A;  1XMQ C;  4D4I A;  5H9U A;  1RG9 A;  4RLF A;  1J5E C;  4PUG A;  4TPS B;  5A1G A;  4PUI A;  4JV5 C;  3VNS A;  2P2F A;  5CZV A;  4OXI A;  4B3M C;  2ZM6 C;  4DV2 C;  1PG4 A;  1RY2 A;  4WS9 A;  2XR1 A;  2D28 C;  1ZB8 A;  3NPD A;  1MXB A;  3LGX A;  2YWB A;  3IML A;  1VLA A;  3ETC A;  4DV3 C;  4LF4 C;  1MD9 A;  3E7X A;  4FUQ A;  3CW8 X;  4DR3 C;  1XRC A;  3L95 X;  3TR3 A;  4R1L A;  3TDE A;  3PES A;  3N54 B;  2P02 A;  4KTT A;  1T5D X;  2KDN A;  4L4Q A;  3A9V A;  2V7B A;  1JOS A;  4HPV A;  3T1Y C;  2VZE A;  2QL8 A;  4R1M A;  1I94 C;  2Y4N A;  3L8C A;  1KKG A;  5A1I A;  2UUA C;  5FLX D;  1T5H X;  5KYT A;  1VEH A;  3TQI A;  4L2Z A;  4ZLP A;  4ZJZ A;  2P20 A;  4D56 A;  1IBM C;  2E8E A;  4DR2 C;  4FTF A;  1XNR C;  3S82 A;  3IEV A;  3OTO C;  1LQL A;  5K85 A;  4DCV A;  3R9W A;  2HHH C;  2BH1 X;  1AMU A;  3G7S A;  4JI7 C;  2WD9 A;  5BUR A;  1TH5 A;  1V60 A;  4DG8 A;  4OX9 C;  2ZZN A;  5AE1 A;  5ADZ A;  2QVY X;  5DV9 A;  4RVO A;  2MCQ A;  4X64 C;  3E7W A;  3AF5 A;  3IPL A;  4XX2 A;  3GKU A;  1K0R A;  3T1H C;  4DR5 C;  5GTD A;  5BR8 C;  1FUG A;  4K0K C;  5CZX A;  2OPL A;  2QW0 X;  3DHV A;  5T8S A;  2BJO A;  1ML8 A;  3B7W A;  2YCB A;  1N2F A;  4JI8 C;  3DAY A;  4KHP C;  3C5E A;  1FLO A;  2PT7 G;  3PBK A;  1GPM A;  2E8C A;  1XHJ A;  3H2T A;  4DV6 C;  1WF3 A;  4I9F A;  4PZP A;  4RVN A;  4YY3 C;  4YHH C;  4K0B A;  4BCA A;  2Y27 A;  4IZ6 A;  2NCL A;  4I9G A;  3UOW A;  5K8F A;  4LE5 A;  4DCS A;  4KTV A;  4DUZ C;  4PUH A;  4GKJ C;  2OPL B;  1O90 A;  1HNX C;  1MKY A;  3UX2 A;  2JMP A;  4LF7 C;  2Z51 A;  4DR7 C;  3SO4 A;  3JAM D;  5A2Q D;  2ASB A;  3A9U A;  3CQ2 A;  2AYA A;  1P7L A;  2UXD C;  3ETO A;  4GXR A;  4PHT A;  1V26 A;  2UU9 C;  2MM9 A;  4B3T C;  1O92 A;  2PN2 A;  2UXC C;  1N36 C;  4DV5 C;  5IT9 D;  1IBL C;  1PU1 A;  3AF6 A;  4DR1 C;  4WV3 A;  4NDN A;  3GPC A;  1QM4 A;  2DYJ A;  4LF5 C;  2MMA B;  4NXM C;  4X62 C;  2VSQ A;  2UUC C;  5BSV A;  4PRO C;  1XS3 A;  2P2B A;  4DR4 C;  4U5Y D;  2PRO A;  4D57 A;  3CQ3 A;  1O9T A;  1FJG C;  1N32 C;  1WCJ A;  2HJG A;  2VQE C;  2KZF A;  1HR0 C;  4LFA C;  4NOZ A;  3NYR A;  4LF9 C;  4JYA C;  4LFC C;  3AY0 A;  5KEI A;  4NXN C;  1M6X A;  1YJ7 A;  1HNZ C;  4JI2 C;  4DCT A;  2CY1 A;  2YX1 A;  5LMU C;  4JM1 A;  5BST A;  2CXC A;  4JI3 C;  1MDF A;  1MDB A;  4JI4 C;  2ONF A;  3RG2 A; 
#chains in the Genus database with same CATH homology
 4B3R C;  4X66 C;  1XNQ C;  2D7V A;  2D27 A;  3EER A;  3I07 A;  3TUF A;  1WH9 A;  4JI1 C;  5BSW A;  3CJE A;  5AE2 A;  2YWC A;  4DV7 C;  1HH2 P;  4GS5 A;  3IEU A;  2DPL A;  4RM3 A;  1HNW C;  4L7I A;  1USP A;  4G36 A;  1ULT A;  4JI6 C;  4R0M A;  1MXC A;  3LNV A;  4OYC A;  3EQ6 A;  2Y4O A;  4D4G A;  5BSM A;  1PG3 A;  1BA3 A;  4BC7 A;  4GXQ A;  1IBK C;  5T8T A;  1LCI A;  4RLQ A;  4JI0 C;  4B3S C;  4DR6 C;  1L2F A;  4DCU A;  3DLP X;  1USP B;  4MTN A;  1PA4 A;  2QVZ X;  4G37 A;  2D1R A;  5A19 A;  2P2M A;  2QVX X;  3NI2 A;  4FUT A;  3R9X A;  3N2Q A;  5BSU A;  4DG9 A;  2E5L C;  4RM2 A;  2E7G A;  4G1I A;  2D1S A;  4RMN A;  4IR7 A;  4EAT A;  2E8F A;  1N33 C;  1XMO C;  3KXW A;  3J80 D;  4ISB A;  1V25 A;  1ZB9 A;  4DV0 C;  5BSR A;  3VNQ A;  2WP0 C;  1XRA A;  5BUQ A;  4GKK C;  4DV4 C;  4LF6 C;  2D1Q A;  3FCE A;  1N34 C;  2UXB C;  4DUY C;  3R44 A;  2P2J A;  3I08 A;  2UUB C;  2ATW A;  2E0G A;  2P2Q A;  5E7Q A;  4LFB C;  5IFI A;  2OBV A;  3RV2 A;  3LUS A;  3LAX A;  3J81 D;  4BSZ A;  1O93 A;  4AQY C;  1UKK A;  2VQF C;  1QWI A;  3NYQ A;  3PRO C;  4ODJ A;  2EGT A;  4BBY A;  3CW9 A;  4X65 C;  4MH4 A;  5JRH A;  5KYV A;  3VNR A;  5IWA C;  4BC9 A;  2F4V C;  3FCC A;  3GR1 A;  1NYE A;  5BUS A;  4JI5 C;  2OO4 A;  1EGA A;  3A4I A;  1XRB A;  4LF8 C;  1MXA A;  3GR0 A;  3UZ0 A;  4DV1 C;  5AE3 A;  5LMN C;  2D1T A;  1XMQ C;  4D4I A;  5H9U A;  1RG9 A;  4RLF A;  1J5E C;  4TPS B;  5A1G A;  4JV5 C;  3VNS A;  2P2F A;  5CZV A;  4OXI A;  4B3M C;  2ZM6 C;  4DV2 C;  1PG4 A;  1RY2 A;  4WS9 A;  2XR1 A;  2D28 C;  1ZB8 A;  3NPD A;  1MXB A;  3LGX A;  2YWB A;  3IML A;  1VLA A;  3ETC A;  4DV3 C;  4LF4 C;  1MD9 A;  3E7X A;  4FUQ A;  3CW8 X;  4DR3 C;  1XRC A;  3L95 X;  4R1L A;  3TDE A;  3PES A;  3N54 B;  2P02 A;  4KTT A;  1T5D X;  4L4Q A;  3A9V A;  2V7B A;  1JOS A;  4HPV A;  3T1Y C;  2VZE A;  2QL8 A;  4R1M A;  1I94 C;  2Y4N A;  3L8C A;  1KKG A;  5A1I A;  2UUA C;  5FLX D;  1T5H X;  5KYT A;  3TQI A;  4L2Z A;  4ZLP A;  4ZJZ A;  2P20 A;  4D56 A;  1IBM C;  2E8E A;  4DR2 C;  4FTF A;  1XNR C;  3S82 A;  3IEV A;  3OTO C;  1LQL A;  5K85 A;  4DCV A;  3R9W A;  2HHH C;  2BH1 X;  1AMU A;  3G7S A;  4JI7 C;  2WD9 A;  5BUR A;  4DG8 A;  4OX9 C;  5AE1 A;  5ADZ A;  2QVY X;  5DV9 A;  4RVO A;  4X64 C;  3E7W A;  3AF5 A;  3IPL A;  4XX2 A;  3GKU A;  1K0R A;  3T1H C;  4DR5 C;  5GTD A;  5BR8 C;  1FUG A;  4K0K C;  5CZX A;  2OPL A;  2QW0 X;  3DHV A;  5T8S A;  2BJO A;  1ML8 A;  3B7W A;  2YCB A;  1N2F A;  4JI8 C;  3DAY A;  4KHP C;  3C5E A;  2PT7 G;  3PBK A;  1GPM A;  2E8C A;  3H2T A;  4DV6 C;  1WF3 A;  4I9F A;  4PZP A;  4RVN A;  4YY3 C;  4YHH C;  4K0B A;  4BCA A;  2Y27 A;  4IZ6 A;  4I9G A;  3UOW A;  5K8F A;  4LE5 A;  4DCS A;  4KTV A;  4DUZ C;  4GKJ C;  2OPL B;  1O90 A;  1HNX C;  1MKY A;  2JMP A;  4LF7 C;  4DR7 C;  3SO4 A;  3JAM D;  5A2Q D;  2ASB A;  3A9U A;  2AYA A;  1P7L A;  2UXD C;  3ETO A;  4GXR A;  4PHT A;  1V26 A;  2UU9 C;  4B3T C;  1O92 A;  2PN2 A;  2UXC C;  1N36 C;  4DV5 C;  5IT9 D;  1IBL C;  3AF6 A;  4DR1 C;  4WV3 A;  4NDN A;  3GPC A;  1QM4 A;  2DYJ A;  4LF5 C;  4NXM C;  4X62 C;  2VSQ A;  2UUC C;  5BSV A;  4PRO C;  2P2B A;  4DR4 C;  4U5Y D;  2PRO A;  4D57 A;  1FJG C;  1O9T A;  1N32 C;  2HJG A;  2VQE C;  2KZF A;  1HR0 C;  4LFA C;  4NOZ A;  3NYR A;  4LF9 C;  4JYA C;  4LFC C;  5KEI A;  4NXN C;  1YJ7 A;  1HNZ C;  4JI2 C;  4DCT A;  2CY1 A;  5LMU C;  4JM1 A;  5BST A;  2CXC A;  4JI3 C;  1MDF A;  1MDB A;  4JI4 C;  2ONF A;  3RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...