4LE5A

Structure of an unusual s-adenosylmethionine synthetase from campylobacter jejuni
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
399
structure length
388
Chain Sequence
MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVAGNKVVIGGEVKSNHKLSKADYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNEQSGETGAGDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPHELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMKIEDLRSLVMKLILDSNLPKELFDPNKTRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTKVDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSLTPNWIRDKFHLDKPSKETFLYADVAARGQVGQKDYPWEKLDALEQFKKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine synthetase
publication title Structure of an unusual S-adenosylmethionine synthetase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
total genus 137
structure length 388
sequence length 399
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A02
1MXAA 5T8SA 1XRBA 3IMLA 1XRCA 2YWBA 5A19A 4L4QA 4ODJA 1QM4A 3UOWA 4L7IA 2DPLA 3TQIA 4LE5A 2YWCA 5H9UA 1RG9A 1XRAA 1O90A 5T8TA 1O9TA 3S82A 2OBVA 3A4IA 1GPMA 2P02A 4HPVA 1MXBA 4K0BA 3TDEA 3SO4A 4WS9A 4KTTA 1P7LA 1O92A 1FUGA 5A1GA 4KTVA 4NDNA 1O93A 5A1IA 4L2ZA 1MXCA 3RV2A
chains in the Genus database with same CATH superfamily
3VNSA 4LF7C 2VQEC 1XMQC 2ONFA 2Y27A 2MM9A 2P2MA 5BSWA 1O90A 2UU9C 4PUHA 3A4IA 4LF6C 2OO4A 2JMPA 1MXBA 2D7VA 1I94C 4DV6C 5BSTA 4R1LA 4TPSB 1USPA 4D4IA 1XHJA 3CW8X 3RV2A 5KYVA 2BH1X 4G1IA 4LF8C 4DCSA 1N2FA 1QM4A 3UOWA 3VNQA 4LFCC 1N32C 2YWCA 4BC7A 3R9WA 3S82A 4DV5C 1XNQC 3GR1A 2P02A 3EQ6A 2UUAC 3I08A 1IB8A 3LGXA 4DV0C 2ZM6C 2QW0X 2PN2A 5JRHA 1XNRC 4X65C 5T8SA 3C5EA 4YHHC 4RVOA 4FTFA 3FCCA 1HNXC 4G36A 2KZ0A 1GPMA 3LNOA 1V25A 5BR8C 3A9UA 4IR7A 2YX1A 2PT7G 5BUQA 5BSVA 1FLOA 2HJGA 4JI3C 3IEVA 4X62C 4DUZC 1M6XC 4LE5A 3T1YC 5IFIA 4NXMC 4FUQA 2E5LC 4D57A 2KDNA 4WS9A 3A26A 5AE3A 1QWIA 2DHMA 4JI5C 1N34C 2CY1A 3NI2A 3IMLA 3NYQA 4XX2A 4D4GA 3OTOC 4OXIA 3GR0A 4BCAA 4K0KC 2QVYX 3JAMD 3LAXA 4RLFA 3DHVA 4DR7C 2E8EA 3CQ2A 4GXRA 4BBYA 3T1HC 4DV3C 1XMOC 3VNRA 2D1TA 5K8FA 1XS3A 5BSMA 1NYEA 3ETCA 3UX3A 4L4QA 2V7BA 1RY2A 5BSRA 3LNVA 5T8TA 1XRAA 2Y4NA 4DR3C 4R1MA 3TDEA 4D56A 4DCVA 2JNVA 1WH9A 5A1GA 1LQLA 1USPB 3PBKA 5DV9A 5LMNC 4B3SC 2M5OA 3R9XA 1MD9A 4ODJA 4B3MC 4DCUA 2UXBC 4JI7C 5FLXD 4RM2A 4DV7C 1YJ7A 2EGTA 2ZZNA 3O2EA 2UXCC 2MCQA 5IWAC 5CZXA 4WV3A 3J80D 4B3RC 1LCIA 3AF5A 4RLQA 4DV1C 1K0RA 3CW9A 4JV5C 2VZEA 3CQ3A 4RM3A 4PHTA 4DR6C 3H2TA 4DV2C 3CJEA 2P2FA 5AE2A 4PZPA 4NDNA 4L2ZA 1N36C 5IT9D 1ZB9A 3GKUA 2YWBA 1V60A 4JI0C 2PROA 2DYJA 4U5YD 5H9UA 2ZZMA 4GKJC 5LMUC 4MH4A 4GXQA 2YCBA 1VLAA 4DUYC 1M6XA 3A9VA 4LFBC 3AY0A 4KTVA 3ETOA 4RVNA 5A1IA 1IBKC 3J81D 2D27A 2CU6A 3K6RA 2MMAB 1T5HX 1AMUA 1TH5A 4JI2C 2E7GA 4L7IA 3G7SA 4BC9A 3NYRA 3E7XA 1MDFA 2QVXX 4KTTA 5E7QA 2AYAA 3A25A 2E8CA 1ML8A 2CXCA 4EATA 4DCTA 1HNWC 1HR0C 2P2JA 3LUSA 1XRCA 1VEHA 2OPLA 2P2BA 5A19A 2P2QA 1BA3A 2WP0C 1T5DX 1RG9A 4OX9C 5BURA 1WF3A 2UUCC 1HH2P 3DLPX 4HPVA 2QL8A 1FUGA 3B7WA 5BSUA 1EGAA 3IPLA 5LCIA 4IZ6A 1XRBA 2ASBA 3I07A 2KZFA 3TQIA 4DR2C 3RG2A 3L8CA 2UXDC 1JOSA 1ULTA 5ADZA 5CZVA 1N33C 5A2QD 4GS5A 2BJOA 4JI6C 1PG3A 4B3TC 3N54B 3N2QA 4NOZA 3UX2A 1KKGA 4LFAC 4DR1C 5KEIA 4JI1C 1J5EC 2VSQA 2VQFC 1WCJA 5BUSA 1IBMC 3AF6A 3L95X 4K0BA 4BSZA 3PROC 3PESA 1P7LA 1O92A 4LF5C 5GTDA 2E8FA 3GPCA 1O93A 4JYAC 4RMNA 4JI8C 3R44A 1MDBA 2XR1A 3TUFA 4DG8A 4GKKC 4KHPC 2D28C 1FJGC 2WD9A 4DG9A 2D1QA 4MTNA 1MKYA 5K85A 2HHHC 1NY8A 2D1SA 3TR3A 4YY3C 2ATWA 1V26A 1HNZC 4ZJZA 4PUGA 1L2FA 3DAYA 4ZLPA 2M5HA 4DR4C 2Z51A 4PROC 4PUIA 4ISBA 1IBLC 2DPLA 1PU1A 5AE1A 2P20A 3FCEA 3UEBA 3UZ0A 4X64C 3KXWA 4LF9C 4I9GA 4DV4C 3CQ1A 4R0MA 5KYTA 3E7WA 4G37A 4JI4C 1MXCA 3IEUA 1MXAA 1PG4A 2OPLB 4I9FA 4AQYC 2F4VC 4JM1A 2D1RA 1UWDA 4OYCA 2QVZX 1ZB8A 2UUBC 1O9TA 4NXNC 1PA4A 1UKKA 4X66C 2OBVA 1P4EC 3SO4A 4LF4C 2E0GA 2Y4OA 1P4EA 3NPDA 4DR5C 4FUTA 2NCLA 3EERA
chains in the Genus database with same CATH topology
3VNSA 4LF7C 2VQEC 1XMQC 2ONFA 2Y27A 2P2MA 5BSWA 1O90A 2UU9C 3A4IA 4LF6C 2OO4A 2JMPA 1MXBA 2D7VA 1I94C 4DV6C 5BSTA 4R1LA 4TPSB 1USPA 4D4IA 3CW8X 3RV2A 5KYVA 2BH1X 4G1IA 4LF8C 4DCSA 1N2FA 1QM4A 3UOWA 3VNQA 4LFCC 1N32C 2YWCA 4BC7A 3R9WA 3S82A 4DV5C 1XNQC 3GR1A 2P02A 3EQ6A 2UUAC 3I08A 4DV0C 3LGXA 2ZM6C 2QW0X 2PN2A 5JRHA 1XNRC 4X65C 5T8SA 3C5EA 4YHHC 4RVOA 4FTFA 3FCCA 1HNXC 4G36A 1GPMA 1V25A 5BR8C 3A9UA 4IR7A 2PT7G 5BUQA 5BSVA 2HJGA 4JI3C 3IEVA 4X62C 4DUZC 4LE5A 3T1YC 5IFIA 4NXMC 4FUQA 2E5LC 4D57A 4WS9A 5AE3A 1QWIA 4JI5C 1N34C 2CY1A 3NI2A 3IMLA 3NYQA 4XX2A 4D4GA 3OTOC 4OXIA 3GR0A 4BCAA 4K0KC 2QVYX 3JAMD 3LAXA 4RLFA 3DHVA 4DR7C 2E8EA 4GXRA 4BBYA 3T1HC 4DV3C 1XMOC 3VNRA 2D1TA 5K8FA 5BSMA 1NYEA 3ETCA 4L4QA 2V7BA 1RY2A 5BSRA 3LNVA 5T8TA 1XRAA 2Y4NA 4DR3C 4R1MA 3TDEA 4D56A 4DCVA 1WH9A 5A1GA 1LQLA 1USPB 3PBKA 5DV9A 5LMNC 4B3SC 3R9XA 1MD9A 4ODJA 4B3MC 4DCUA 2UXBC 4JI7C 5FLXD 4RM2A 4DV7C 1YJ7A 2EGTA 2UXCC 5IWAC 5CZXA 4WV3A 3J80D 4B3RC 1LCIA 3AF5A 4RLQA 4DV1C 1K0RA 3CW9A 4JV5C 2VZEA 4RM3A 4PHTA 4DR6C 3H2TA 4DV2C 3CJEA 2P2FA 5AE2A 4PZPA 4NDNA 4L2ZA 1N36C 5IT9D 1ZB9A 3GKUA 2YWBA 4JI0C 2PROA 2DYJA 4U5YD 5H9UA 4GKJC 5LMUC 4MH4A 4GXQA 2YCBA 1VLAA 4DUYC 3A9VA 4LFBC 4KTVA 3ETOA 4RVNA 5A1IA 1IBKC 3J81D 2D27A 1T5HX 1AMUA 4JI2C 2E7GA 4L7IA 3G7SA 4BC9A 3NYRA 3E7XA 1MDFA 2QVXX 4KTTA 5E7QA 2AYAA 2E8CA 1ML8A 2CXCA 4EATA 4DCTA 1HNWC 1HR0C 2P2JA 3LUSA 1XRCA 2OPLA 2P2BA 5A19A 2P2QA 1BA3A 2WP0C 1T5DX 1RG9A 4OX9C 5BURA 1WF3A 2UUCC 1HH2P 3DLPX 4HPVA 2QL8A 1FUGA 3B7WA 5BSUA 1EGAA 3IPLA 4IZ6A 1XRBA 2ASBA 3I07A 2KZFA 3TQIA 4DR2C 3RG2A 3L8CA 2UXDC 1JOSA 1ULTA 5ADZA 5CZVA 1N33C 5A2QD 4GS5A 2BJOA 4JI6C 1PG3A 4B3TC 3N54B 3N2QA 4NOZA 1KKGA 4LFAC 4DR1C 5KEIA 4JI1C 1J5EC 2VSQA 2VQFC 5BUSA 1IBMC 3AF6A 3L95X 4K0BA 4BSZA 3PROC 3PESA 1P7LA 1O92A 4LF5C 5GTDA 2E8FA 3GPCA 1O93A 4JYAC 4RMNA 4JI8C 3R44A 1MDBA 2XR1A 3TUFA 4DG8A 4GKKC 4KHPC 2D28C 1FJGC 2WD9A 4DG9A 2D1QA 4MTNA 1MKYA 5K85A 2HHHC 2D1SA 2ATWA 4YY3C 1V26A 1HNZC 4ZJZA 1L2FA 3DAYA 4ZLPA 4DR4C 4PROC 4ISBA 1IBLC 2DPLA 5AE1A 2P20A 3FCEA 3UZ0A 4X64C 3KXWA 4LF9C 4I9GA 4DV4C 4R0MA 5KYTA 3E7WA 4G37A 4JI4C 1MXCA 3IEUA 1MXAA 1PG4A 2OPLB 4I9FA 4AQYC 2F4VC 4JM1A 2D1RA 4OYCA 2QVZX 1ZB8A 2UUBC 1O9TA 4NXNC 1PA4A 1UKKA 4X66C 2OBVA 3SO4A 4LF4C 2E0GA 2Y4OA 3NPDA 4DR5C 4FUTA 3EERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXA A;  5T8S A;  1XRB A;  3IML A;  1XRC A;  2YWB A;  5A19 A;  4L4Q A;  4ODJ A;  1QM4 A;  3UOW A;  4L7I A;  2DPL A;  3TQI A;  4LE5 A;  2YWC A;  5H9U A;  1RG9 A;  1XRA A;  1O90 A;  5T8T A;  1O9T A;  3S82 A;  2OBV A;  3A4I A;  1GPM A;  2P02 A;  4HPV A;  1MXB A;  4K0B A;  3TDE A;  3SO4 A;  4WS9 A;  4KTT A;  1P7L A;  1O92 A;  1FUG A;  5A1G A;  4KTV A;  4NDN A;  1O93 A;  5A1I A;  4L2Z A;  1MXC A;  3RV2 A; 
#chains in the Genus database with same CATH topology
 3VNS A;  4LF7 C;  2VQE C;  1XMQ C;  2ONF A;  2Y27 A;  2MM9 A;  2P2M A;  5BSW A;  1O90 A;  2UU9 C;  4PUH A;  3A4I A;  4LF6 C;  2OO4 A;  2JMP A;  1MXB A;  2D7V A;  1I94 C;  4DV6 C;  5BST A;  4R1L A;  4TPS B;  1USP A;  4D4I A;  1XHJ A;  3CW8 X;  3RV2 A;  5KYV A;  2BH1 X;  4G1I A;  4LF8 C;  4DCS A;  1N2F A;  1QM4 A;  3UOW A;  3VNQ A;  4LFC C;  1N32 C;  2YWC A;  4BC7 A;  3R9W A;  3S82 A;  4DV5 C;  1XNQ C;  3GR1 A;  2P02 A;  3EQ6 A;  2UUA C;  3I08 A;  1IB8 A;  3LGX A;  4DV0 C;  2ZM6 C;  2QW0 X;  2PN2 A;  5JRH A;  1XNR C;  4X65 C;  5T8S A;  3C5E A;  4YHH C;  4RVO A;  4FTF A;  3FCC A;  1HNX C;  4G36 A;  2KZ0 A;  1GPM A;  3LNO A;  1V25 A;  5BR8 C;  3A9U A;  4IR7 A;  2YX1 A;  2PT7 G;  5BUQ A;  5BSV A;  1FLO A;  2HJG A;  4JI3 C;  3IEV A;  4X62 C;  4DUZ C;  1M6X C;  4LE5 A;  3T1Y C;  5IFI A;  4NXM C;  4FUQ A;  2E5L C;  4D57 A;  2KDN A;  4WS9 A;  3A26 A;  5AE3 A;  1QWI A;  2DHM A;  4JI5 C;  1N34 C;  2CY1 A;  3NI2 A;  3IML A;  3NYQ A;  4XX2 A;  4D4G A;  3OTO C;  4OXI A;  3GR0 A;  4BCA A;  4K0K C;  2QVY X;  3JAM D;  3LAX A;  4RLF A;  3DHV A;  4DR7 C;  2E8E A;  3CQ2 A;  4GXR A;  4BBY A;  3T1H C;  4DV3 C;  1XMO C;  3VNR A;  2D1T A;  5K8F A;  1XS3 A;  5BSM A;  1NYE A;  3ETC A;  3UX3 A;  4L4Q A;  2V7B A;  1RY2 A;  5BSR A;  3LNV A;  5T8T A;  1XRA A;  2Y4N A;  4DR3 C;  4R1M A;  3TDE A;  4D56 A;  4DCV A;  2JNV A;  1WH9 A;  5A1G A;  1LQL A;  1USP B;  3PBK A;  5DV9 A;  5LMN C;  4B3S C;  2M5O A;  3R9X A;  1MD9 A;  4ODJ A;  4B3M C;  4DCU A;  2UXB C;  4JI7 C;  5FLX D;  4RM2 A;  4DV7 C;  1YJ7 A;  2EGT A;  2ZZN A;  3O2E A;  2UXC C;  2MCQ A;  5IWA C;  5CZX A;  4WV3 A;  3J80 D;  4B3R C;  1LCI A;  3AF5 A;  4RLQ A;  4DV1 C;  1K0R A;  3CW9 A;  4JV5 C;  2VZE A;  3CQ3 A;  4RM3 A;  4PHT A;  4DR6 C;  3H2T A;  4DV2 C;  3CJE A;  2P2F A;  5AE2 A;  4PZP A;  4NDN A;  4L2Z A;  1N36 C;  5IT9 D;  1ZB9 A;  3GKU A;  2YWB A;  1V60 A;  4JI0 C;  2PRO A;  2DYJ A;  4U5Y D;  5H9U A;  2ZZM A;  4GKJ C;  5LMU C;  4MH4 A;  4GXQ A;  2YCB A;  1VLA A;  4DUY C;  1M6X A;  3A9V A;  4LFB C;  3AY0 A;  4KTV A;  3ETO A;  4RVN A;  5A1I A;  1IBK C;  3J81 D;  2D27 A;  2CU6 A;  3K6R A;  2MMA B;  1T5H X;  1AMU A;  1TH5 A;  4JI2 C;  2E7G A;  4L7I A;  3G7S A;  4BC9 A;  3NYR A;  3E7X A;  1MDF A;  2QVX X;  4KTT A;  5E7Q A;  2AYA A;  3A25 A;  2E8C A;  1ML8 A;  2CXC A;  4EAT A;  4DCT A;  1HNW C;  1HR0 C;  2P2J A;  3LUS A;  1XRC A;  1VEH A;  2OPL A;  2P2B A;  5A19 A;  2P2Q A;  1BA3 A;  2WP0 C;  1T5D X;  1RG9 A;  4OX9 C;  5BUR A;  1WF3 A;  2UUC C;  1HH2 P;  3DLP X;  4HPV A;  2QL8 A;  1FUG A;  3B7W A;  5BSU A;  1EGA A;  3IPL A;  5LCI A;  4IZ6 A;  1XRB A;  2ASB A;  3I07 A;  2KZF A;  3TQI A;  4DR2 C;  3RG2 A;  3L8C A;  2UXD C;  1JOS A;  1ULT A;  5ADZ A;  5CZV A;  1N33 C;  5A2Q D;  4GS5 A;  2BJO A;  4JI6 C;  1PG3 A;  4B3T C;  3N54 B;  3N2Q A;  4NOZ A;  3UX2 A;  1KKG A;  4LFA C;  4DR1 C;  5KEI A;  4JI1 C;  1J5E C;  2VSQ A;  2VQF C;  1WCJ A;  5BUS A;  1IBM C;  3AF6 A;  3L95 X;  4K0B A;  4BSZ A;  3PRO C;  3PES A;  1P7L A;  1O92 A;  4LF5 C;  5GTD A;  2E8F A;  3GPC A;  1O93 A;  4JYA C;  4RMN A;  4JI8 C;  3R44 A;  1MDB A;  2XR1 A;  3TUF A;  4DG8 A;  4GKK C;  4KHP C;  2D28 C;  1FJG C;  2WD9 A;  4DG9 A;  2D1Q A;  4MTN A;  1MKY A;  5K85 A;  2HHH C;  1NY8 A;  2D1S A;  3TR3 A;  4YY3 C;  2ATW A;  1V26 A;  1HNZ C;  4ZJZ A;  4PUG A;  1L2F A;  3DAY A;  4ZLP A;  2M5H A;  4DR4 C;  2Z51 A;  4PRO C;  4PUI A;  4ISB A;  1IBL C;  2DPL A;  1PU1 A;  5AE1 A;  2P20 A;  3FCE A;  3UEB A;  3UZ0 A;  4X64 C;  3KXW A;  4LF9 C;  4I9G A;  4DV4 C;  3CQ1 A;  4R0M A;  5KYT A;  3E7W A;  4G37 A;  4JI4 C;  1MXC A;  3IEU A;  1MXA A;  1PG4 A;  2OPL B;  4I9F A;  4AQY C;  2F4V C;  4JM1 A;  2D1R A;  1UWD A;  4OYC A;  2QVZ X;  1ZB8 A;  2UUB C;  1O9T A;  4NXN C;  1PA4 A;  1UKK A;  4X66 C;  2OBV A;  1P4E C;  3SO4 A;  4LF4 C;  2E0G A;  2Y4O A;  1P4E A;  3NPD A;  4DR5 C;  4FUT A;  2NCL A;  3EER A; 
#chains in the Genus database with same CATH homology
 3VNS A;  4LF7 C;  2VQE C;  1XMQ C;  2ONF A;  2Y27 A;  2P2M A;  5BSW A;  1O90 A;  2UU9 C;  3A4I A;  4LF6 C;  2OO4 A;  2JMP A;  1MXB A;  2D7V A;  1I94 C;  4DV6 C;  5BST A;  4R1L A;  4TPS B;  1USP A;  4D4I A;  3CW8 X;  3RV2 A;  5KYV A;  2BH1 X;  4G1I A;  4LF8 C;  4DCS A;  1N2F A;  1QM4 A;  3UOW A;  3VNQ A;  4LFC C;  1N32 C;  2YWC A;  4BC7 A;  3R9W A;  3S82 A;  4DV5 C;  1XNQ C;  3GR1 A;  2P02 A;  3EQ6 A;  2UUA C;  3I08 A;  4DV0 C;  3LGX A;  2ZM6 C;  2QW0 X;  2PN2 A;  5JRH A;  1XNR C;  4X65 C;  5T8S A;  3C5E A;  4YHH C;  4RVO A;  4FTF A;  3FCC A;  1HNX C;  4G36 A;  1GPM A;  1V25 A;  5BR8 C;  3A9U A;  4IR7 A;  2PT7 G;  5BUQ A;  5BSV A;  2HJG A;  4JI3 C;  3IEV A;  4X62 C;  4DUZ C;  4LE5 A;  3T1Y C;  5IFI A;  4NXM C;  4FUQ A;  2E5L C;  4D57 A;  4WS9 A;  5AE3 A;  1QWI A;  4JI5 C;  1N34 C;  2CY1 A;  3NI2 A;  3IML A;  3NYQ A;  4XX2 A;  4D4G A;  3OTO C;  4OXI A;  3GR0 A;  4BCA A;  4K0K C;  2QVY X;  3JAM D;  3LAX A;  4RLF A;  3DHV A;  4DR7 C;  2E8E A;  4GXR A;  4BBY A;  3T1H C;  4DV3 C;  1XMO C;  3VNR A;  2D1T A;  5K8F A;  5BSM A;  1NYE A;  3ETC A;  4L4Q A;  2V7B A;  1RY2 A;  5BSR A;  3LNV A;  5T8T A;  1XRA A;  2Y4N A;  4DR3 C;  4R1M A;  3TDE A;  4D56 A;  4DCV A;  1WH9 A;  5A1G A;  1LQL A;  1USP B;  3PBK A;  5DV9 A;  5LMN C;  4B3S C;  3R9X A;  1MD9 A;  4ODJ A;  4B3M C;  4DCU A;  2UXB C;  4JI7 C;  5FLX D;  4RM2 A;  4DV7 C;  1YJ7 A;  2EGT A;  2UXC C;  5IWA C;  5CZX A;  4WV3 A;  3J80 D;  4B3R C;  1LCI A;  3AF5 A;  4RLQ A;  4DV1 C;  1K0R A;  3CW9 A;  4JV5 C;  2VZE A;  4RM3 A;  4PHT A;  4DR6 C;  3H2T A;  4DV2 C;  3CJE A;  2P2F A;  5AE2 A;  4PZP A;  4NDN A;  4L2Z A;  1N36 C;  5IT9 D;  1ZB9 A;  3GKU A;  2YWB A;  4JI0 C;  2PRO A;  2DYJ A;  4U5Y D;  5H9U A;  4GKJ C;  5LMU C;  4MH4 A;  4GXQ A;  2YCB A;  1VLA A;  4DUY C;  3A9V A;  4LFB C;  4KTV A;  3ETO A;  4RVN A;  5A1I A;  1IBK C;  3J81 D;  2D27 A;  1T5H X;  1AMU A;  4JI2 C;  2E7G A;  4L7I A;  3G7S A;  4BC9 A;  3NYR A;  3E7X A;  1MDF A;  2QVX X;  4KTT A;  5E7Q A;  2AYA A;  2E8C A;  1ML8 A;  2CXC A;  4EAT A;  4DCT A;  1HNW C;  1HR0 C;  2P2J A;  3LUS A;  1XRC A;  2OPL A;  2P2B A;  5A19 A;  2P2Q A;  1BA3 A;  2WP0 C;  1T5D X;  1RG9 A;  4OX9 C;  5BUR A;  1WF3 A;  2UUC C;  1HH2 P;  3DLP X;  4HPV A;  2QL8 A;  1FUG A;  3B7W A;  5BSU A;  1EGA A;  3IPL A;  4IZ6 A;  1XRB A;  2ASB A;  3I07 A;  2KZF A;  3TQI A;  4DR2 C;  3RG2 A;  3L8C A;  2UXD C;  1JOS A;  1ULT A;  5ADZ A;  5CZV A;  1N33 C;  5A2Q D;  4GS5 A;  2BJO A;  4JI6 C;  1PG3 A;  4B3T C;  3N54 B;  3N2Q A;  4NOZ A;  1KKG A;  4LFA C;  4DR1 C;  5KEI A;  4JI1 C;  1J5E C;  2VSQ A;  2VQF C;  5BUS A;  1IBM C;  3AF6 A;  3L95 X;  4K0B A;  4BSZ A;  3PRO C;  3PES A;  1P7L A;  1O92 A;  4LF5 C;  5GTD A;  2E8F A;  3GPC A;  1O93 A;  4JYA C;  4RMN A;  4JI8 C;  3R44 A;  1MDB A;  2XR1 A;  3TUF A;  4DG8 A;  4GKK C;  4KHP C;  2D28 C;  1FJG C;  2WD9 A;  4DG9 A;  2D1Q A;  4MTN A;  1MKY A;  5K85 A;  2HHH C;  2D1S A;  2ATW A;  4YY3 C;  1V26 A;  1HNZ C;  4ZJZ A;  1L2F A;  3DAY A;  4ZLP A;  4DR4 C;  4PRO C;  4ISB A;  1IBL C;  2DPL A;  5AE1 A;  2P20 A;  3FCE A;  3UZ0 A;  4X64 C;  3KXW A;  4LF9 C;  4I9G A;  4DV4 C;  4R0M A;  5KYT A;  3E7W A;  4G37 A;  4JI4 C;  1MXC A;  3IEU A;  1MXA A;  1PG4 A;  2OPL B;  4I9F A;  4AQY C;  2F4V C;  4JM1 A;  2D1R A;  4OYC A;  2QVZ X;  1ZB8 A;  2UUB C;  1O9T A;  4NXN C;  1PA4 A;  1UKK A;  4X66 C;  2OBV A;  3SO4 A;  4LF4 C;  2E0G A;  2Y4O A;  3NPD A;  4DR5 C;  4FUT A;  3EER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...