3FCCA

Crystal structure of dlta protein in complex with atp and magnesium
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
504
structure length
500
Chain Sequence
MKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSGPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of Bacillus cereus D-alanyl carrier protein ligase (DltA) in complex with ATP.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
total genus 147
structure length 500
sequence length 504
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3fccA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fccA01
4R1LA 5BSMA 5BUQA 4W8OA 3WV5A 3FCCA 2P2JA 5BSTA 2WD9A 4G36A 3IEPA 3VNRA 1MD9A 3NI2A 3R44A 4GR5A 2QVZX 4ZJZA 3O84A 4G37A 3L8CA 4D4IA 4IR7A 3LNVA 5BSVA 3KXWA 4PZPA 5K85A 3DAYA 4RM2A 4GXRA 3VNQA 4M46A 4ISBA 4R1MA 4LGCA 2QVYX 5DWVA 3IESA 3WV4A 3GPCA 3WVNA 4WV3A 4FUQA 5BURA 2P2FA 2V7BA 4RLFA 2P2MA 4IZ6A 1MDFA 3E7WA 5KEIA 5IFIA 4U5YD 1LCIA 1AMUA 3A9VA 4RMNA 4RVOA 4D4HA 2VZEA 4D57A 3QYAA 1PG3A 4DG8A 1PG4A 3A9UA 4OXIA 1V26A 5KYVA 3E7XA 3O82A 1V25A 3PBKA 3G7SA 2Y4OA 3O83A 5GTDA 5KYTA 3FCEA 4R0MA 3TSYA 3T5CA 1RY2A 3T5AA 5JRHA 1MDBA 5BUSA 5BSRA 3IVRA 2D1SA 5K8FA 3T5BA 2P20A 1YJ7A 5E7QA 3VNSA 2QVXX 2P2QA 4GR4A 3RIXA 1T5DX 4D56A 2P2BA 3ETCA 3LGXA 3U16A 3RG2A 3NYRA 1BA3A 3NYQA 4D4GA 5BSWA 3EQ6A 4E5DA 3B7WA 2D1QA 5D6NA 3DHVA 2VSQA 3CW9A 5BSUA 4GS5A 2D1TA 4DG9A 1ULTA 4FUTA 4OYCA 2Y27A 3ITEA 2D1RA 4EATA 4GXQA 3U17A 3C5EA 3IPLA 3E53A 1T5HX 3CW8X 2QW0X 4RVNA 3IERA 4RM3A 3DLPX 4RLQA 3LAXA 5DV9A 2Y4NA
chains in the Genus database with same CATH superfamily
3JX9A 1V9CA 5G0WA 3KJFA 1YFKA 4KNVA 2W2MA 3PDIB 4M7WA 1RW4A 1JDBB 4DEYA 1O97D 2J30A 2OK7A 2QRNA 3AMVA 4MITA 3K9NA 4AKGA 2C4UA 3GR6A 1MG0A 4KR9A 1UT8A 5IBCA 2REQB 2XB8A 1BW9B 1ZUNB 2GD2A 5F7JA 2R1VB 3BDAA 4PHFA 3ZU4A 2JIQA 2EBWA 2DKFA 2FFAA 4D8TA 1QPGA 1Z28A 1C3LA 1JT2A 1PVDA 2WSSD 1PT9A 4KZKA 2OGZA 1MO5A 1XP8A 1OH6A 1Z4IA 4MI3A 3D4LA 4LRTB 4BFYA 1GD1O 2QGNA 4UU1A 3V1YA 4ZGWA 1KY5A 2YZNA 5I7AA 3JQ6A 3X2EA 2RHLA 3G9UA 3X1KA 4J16A 3DHNA 5ES3A 1SD5A 3HB5X 1Z2EA 2CXPA 1W0CA 4TMWA 3SHQA 1GGHA 2GBPA 1G42A 2DRIA 3QFRA 4D9IA 4RETA 1EFVB 1V1MB 2M9MA 2AE2A 4KTVE 2A9KA 3O7WA 1XZKA 4A6DA 2GCPA 2OK8A 4UM9D 2PUVA 4NYMQ 2HA4A 2HCJB 4MYSA 1OH5A 2OBFA 5KTOA 1B6SA 1NW3A 3D6JA 2J3MA 4IS3A 2R7AA 2ISSD 3B6JA 3QE3A 4TMXA 5HG0A 1OXSC 3K9HA 5FR1A 1LF0A 3RQIA 4LX0A 3FVWA 4FXOA 1C7IA 1JFSA 4XB1A 1JPUA 1J9GA 3GLHA 3Q6IA 4A5SA 1USVA 3MPOA 1IHYA 2M5HA 1WTCA 2QD2A 4MRPA 4GM1A 4ZQEA 5TS2A 3U80A 1CUIA 1MXAA 2IXFA 2I7TA 3R5KA 5EXTA 5ICCA 4PUIA 4QYXA 3DEZA 4BKQA 4C1BA 4E5YA 4RULA 1HDCA 1FU7A 1W1UA 3AG5A 3IT3A 2VR1A 1QYDA 1NF3A 2NPIA 5B57C 3AOEC 2I91A 2EDAA 4B7AA 2EFYA 4GPZA 3LUCA 4A0RA 8ATCA 2JANA 4WBNF 1VYUA 2PYDA 2FE1A 1UPTA 1ZVMA 4D9FA 2QJWA 4BFXA 4IEFB 5TDHA 1DCFA 2BF4A 2FPGB 4PNEA 2VHUA 4H27A 1N9GB 1YS6A 1LDYA 1YRQA 1QGYA 4JIGA 4KXXA 1RLJA 1WZEA 2DQYA 2ZAYA 4MUAA 4R81A 2NQTA 3OESA 3UQYS 2YJTD 2VJQA 1BA3A 3Q3CA 2P62A 5JD3A 4PG8A 5HR5A 3QE2A 2JH8A 1SOMA 1UZAA 1XDSA 1MJFA 1KQGA 4GLJA 3R5JA 2RHTA 4UEQA 1JJIA 2GAJA 1O95C 1X0VA 3NC0C 3P4UA 1Y3DE 3BGOS 4JI7C 1ADCA 1RLTA 1A2BA 1OXVA 3KP1A 2GCNA 4PANA 4JGIA 4YP0A 3OZWA 3JR3A 1FTGA 2YHAA 2MSKA 1SBHA 3ZIAA 4OQEA 4NQRA 4GE0A 1A88A 5AVKA 4GXQA 3D02A 2BEVB 3M6LA 2VH2A 5LCIA 2SECE 3UHOA 1HNZB 4RVNA 1C0EA 3L18A 3LLVA 3EWIA 3JZMA 3TMAA 4JYCA 2ZYTX 1ZGZA 2MMCA 3HBLA 5GADl 3QM1A 3HGTA 3OE7D 2VZ0A 1FVHA 2HJ9A 3IVAA 4DCGA 5LP6C 2G1PA 4ZEMA 1XDDA 1YULA 4FZ5A 4G56A 5LA6F 3DG9A 2GM9A 1FQKA 3N86A 2A1UB 4LHZA 4U2FA 1QYXA 4L02A 1MD9A 2QZPA 3J81D 3BIJA 3DMHA 5H82A 1PSWA 3KDPA 4B73A 2BFNA 2Q29A 4U2DA 3NP7A 2NXEA 2WFLB 3KPUA 5TY0A 1M2VA 4YY3B 4FYHA 1DX9A 3L0IB 1IJBA 4A6PA 4EBBA 2RGGA 2XVZA 1IB0A 2YJ5A 3DEYX 2F67A 3OZGA 4TPSB 2XWBF 3B6IA 3P2EA 4LTNA 4PBRA 1DMSA 5AK4A 1FRNA 1SULA 2QG6A 2FX2A 3T7EA 5IDYA 3WLNA 2PAAA 3EVGA 1B0AA 1SVUA 4JI6C 1UDRA 4C7KA 1YJ8A 1JR2A 1Y3CE 4PG6A 2B8WA 3I58A 1DXQA 2W5UA 1HA3A 1QU3A 5EE9A 1FTNA 3R9XA 2WC1A 4KXVA 2Y66A 2JEOA 4I9GA 3GRFA 4FCWA 5AKLA 4BXOA 1TK9A 4ND8B 4OV6B 1VCIA 3R1IA 4YFYA 5B4UA 1KYZA 1B76A 3ROXA 1WAMA 1PR2A 1UJ6A 4RZIA 3M6MD 4RPKA 5HF8A 3QFHA 4Z1MD 4TYYA 2Z83A 4PSCA 3RKUA 3K6SB 5GGYA 1L4KA 1VJRA 1P19A 3ROQA 1VBFA 1V8PA 1MO4A 1XNJA 1YK1A 4B87A 2OQRA 1PAUA 5TX7A 4ZANA 2DQKA 4R1TA 2BSXA 2HRCA 5EIFA 3U9TA 1IG3A 3N7UA 2FFRA 5EPUA 3WYCA 1DO8A 1EH5A 3G9ZA 4JBIA 1JHRA 5KDLA 1TJ5A 5AKHA 4IV0A 4NBNA 2WIBA 4OUDB 2FV8A 3B48A 1OHHD 2E21A 5JJIA 1RJWA 4KXNA 1XCLA 4AWBA 1Z0AA 4V0KA 4P9NA 1FNSA 2MHCA 1KE1A 1L5LA 1SG6A 2ASVA 4E6PA 1PJCA 3I6MA 1PJSA 1YA4A 2COKA 4YRRA 3ZV5A 4XPIA 2RSLA 3MBOA 5C7LO 3EZNA 4WY5A 3HVKA 3U39A 1E89A 1XHLA 4B4KA 1BMFA 4B44A 5G4KA 1JG7A 2J3HA 2QM7A 2OLKA 4B6GA 1MB3A 4NBSA 2CHQA 1JIQA 10MHA 3GDWA 1NTRA 2IUFA 2ASEA 1HDXA 2FK7A 4D45A 5ELXA 4PGFA 3TQCA 1UBOS 3ZS9A 1Q2UA 2AK2A 2I65A 1ISPA 1F1BA 3DXZA 3MPUA 3H5LA 1T4CA 1QH1A 3A6ZA 1K9SA 2XYHA 3EIOA 3ZHZA 4NWIA 4WN3A 5AJXA 3L84A 4PYNA 2VAVA 4GKKC 2D28C 2QAJA 4Q6BA 5B53A 3SVZA 3UVEA 1F8GA 3C5VA 2QTGA 3PNVA 1WUYA 2YFHA 2AV6A 1I7NA 2D1RA 1PA4A 1L0BA 3G9XA 2CLEB 3OETA 3QOWA 1TU0A 1XTVA 2P2LA 4Q7KA 3VFDA 1L4GA 1UPBA 4E15A 3LT5A 3OTWA 5C8DA 3HY6A 1JALA 2B4AA 2J5BA 2PA3A 1GPKA 3BGSA 4RIEA 1IWPB 5U1PA 4ARBA 5EIXA 1PKEA 4BBPA 2HI0A 5G40A 1TEZA 1KF0A 1UXGA 4KCGA 2QNRA 5HDQA 1RJFA 1NVTA 3CUVA 4MWCA 2Z8YM 1Y8CA 1Z56C 2Q5LA 4ZO4A 2B9EA 5DNCA 1BU8A 3ZQJA 1E2JA 3I9OA 4AZ0B 1SVSA 2BBOA 1EGMB 2VDPB 5KKAA 1L8OA 1UK9A 4KQGA 4BQRA 4H4EA 4MS3A 4IF6A 2Y0EA 2C2GA 3CH5A 1H69A 1QYIA 2F1JA 2QU8A 3PQ4A 4R83A 4FGKA 4CEIB 1W46A 2QP3A 1ZOLA 2PGOA 2PZAA 1QXSA 3CF0A 3OU7A 4BQNA 3ADKA 1ZITA 3N8NA 3HB9A 3SSOA 1LBTA 3C15C 4WKGA 3BIXA 3A0RB 2OECA 4PNPA 2PROA 1NHWA 2HH9A 2JA2A 3KFVA 4PNHA 4XPZA 4EP1A 3OC0A 5EFZA 3KB8A 4H15A 3X2FA 1Z8HA 1CXZA 3GFVA 4RVFA 1BKSB 1KOJA 2ZPTX 3C16C 2A9PA 3NB0A 4Q02A 5BOVA 2IXDA 3ONFA 1DJQA 1DFIA 4IIUA 3I08A 1P60A 2RGYA 2P75A 1TM7E 4GGOA 3B1ZA 2FWJA 3UGTA 4JJZA 2BMEA 3VAAA 4A36A 2HQSA 1QQ7A 4U8HA 1TIBA 2XNHA 1XQVA 4KE8A 4YLEA 5I51A 3Q8KA 2W6OA 2NU7A 1F2DA 1Y48E 3KHKA 3GH3A 3WJ7A 4GKBA 2BUCA 1IEWA 2IP1A 1T26A 3JRWA 4R84A 3NETA 2JC3A 5CD9A 2H9YA 4ARIA 1QTRA 4KVFA 3A2MA 1UJMA 1ML3A 2GX6A 3PC4A 4GRAA 1YJCA 3C74A 4HX2A 1MHTA 1GKUB 2JIOA 3BKXA 5KQPA 6REQA 3EPJA 5HF5A 3TQTA 1RMYA 1R3DA 2NXWA 4XIYA 1SD1A 2AC7A 4DIOA 1ZD9A 1T9GR 4BATA 4ZU1X 3IH5A 1YR2A 4BB5A 1DXOA 3L7CA 2YHIA 4AJLA 3WL6A 2DUNA 3D8BA 1HV8A 4NCAA 2JS7A 3RK0A 1T9AA 2YC4C 2Q0SA 4DDVA 1XMOB 2EJUA 3DBRA 4AROA 2VYFA 4E3ZA 2GYYA 3SQXA 4XJVA 1M8JA 4KW7A 2M1ZA 2P9YA 2QGFA 3PICA 1D6MA 3IMEA 1JIVA 2X1HA 2EW2A 4Y1EA 4D4GA 5BW4A 3KEOA 4HLUC 4IHJA 2D1QA 4Y6SA 2D06A 5K3OA 5ALEA 4HMPA 2O2ZA 3ILHA 1GZ5A 2BISA 4IDAA 1S7CA 3COJA 1EAMA 1AF7A 1GTJ1 2IY8A 1E1LA 1X7YA 3NANA 5CVDA 4C0XA 5KMGB 2OZLB 3GA5A 4NBRA 1LVGA 3DL7A 3QP9A 4Q82A 3SPXA 2GDJA 3HBJA 3WGYA 3WLHA 3MGAA 4E5SA 4QQFA 4DRZA 1M7GA 5MHTA 421PA 5HOQA 3F9CA 3K9GA 1LQTA 5IKEA 1H1LA 1W5BA 1HT1E 4JDPA 2XRMA 3GMIA 4WMLA 1J7KA 1Q77A 2GB4A 4AY5A 4HO1X 3WRYC 2OUKA 3WIEA 3COYA 1ZIPA 1Y4ZA 3HVIA 4N12A 1YR6A 4IXMA 2FETA 1KDPA 3S1SA 1DKQA 1JEYB 3AI7A 4RYLA 2JGKA 2HA2A 4MJLA 2V6GA 2IS1A 1LZLA 3PPVA 4GGPA 1YFLA 1E2IA 3QUBA 4MQFA 1VE5A 3A36A 3WNCA 4KG7A 3U3MA 2QRLA 3LDHA 3SZLA 2BHSA 2Q6OA 2VJKA 4QYIB 2FMIA 5T7BA 2RI6A 1XHFA 1D5WA 1GCIA 1SA0A 1U3WA 3JQCA 1J1UA 1QGOA 4U7PB 4Q9LA 3E5MA 3PRJA 1C0KA 1LTHR 3F98A 3AFOA 3LP6A 3SEQA 5IT4A 2I2BA 1U4NA 3EVBA 3UUGA 4Z8XA 2AWNA 2CLIB 1KSGA 4YJFA 2AJLI 1RQRA 1GSAA 2WTMA 5AW0A 3P0FA 2XKAA 3KYDA 4B3SC 1LLDA 2XKBA 3C14C 1MEOA 3AONB 1BE0A 1VKHA 2VH1A 4PAMA 4WK2B 4BCCA 1FLVA 5KYYA 5TMPA 3K5IA 1SUDA 3O2NA 2LNDA 3GR1A 2PSHA 2HBRA 5JAQA 1EVZA 3M9LA 3QVLA 2ATWA 4MUXA 4X8HA 1K8QA 2ZU0C 2JJYA 5FBZA 4YYEA 4P4GA 1MOQA 4RH0A 1YDWA 2EFGA 2OVFA 3GFQA 3UV3A 1ZIOA 4DCTA 1ADGA 3OE5A 2P78A 1E79A 2R6DA 4O0MA 5FBLB 3E9RA 1CP3A 1B74A 1G20E 4RVOA 1SPXA 2P30A 3DT9A 3QYAA 1M76A 3O1JC 4BN0A 2NSJA 2WIKA 4BC7A 1K6MA 2ZUCA 2O52A 1DOHA 1XXLA 2I2CA 4IGFA 1CR6A 3HHPA 4X7MA 2HBQA 1G2QA 3GJ0A 3H04A 4KQEA 3KC2A 1Z2DA 3O74A 3VU9B 1G59A 3B9BA 4EHHA 3V97A 2G9RA 4WZAB 4BAUA 3BHMA 1GA1A 5AW3A 2D5IA 1GTRA 4MRMA 3PUKA 4O4HA 1XZDA 3B7PA 3Q7RA 5AI4A 1I13A 3LO8A 1TJNA 3EFOA 3B13B 2XI4A 4ER3A 2CZQA 3LPDA 1QRDA 4NFHA 4MXDA 3FYSA 5CTJA 4UTPA 1OIVA 1M2WA 5DH9A 4Y2HA 1HMYA 3NTVA 4OUKX 3V4FA 1GZ4A 5LWHA 3DUFB 2GBGA 2VYVA 4D4LA 2V6MA 4HVCA 5AM5A 2OMEA 4YRTA 2B36A 3LPCA 1E63A 1PNRA 4HNRA 2GPBA 4RUKA 3STVA 2O06A 1KOLA 3DAFA 3DHVA 1PJZA 4KMOA 4MZDA 1Y0BA 5I48A 1EWQA 4MCIA 3UFBA 1TTPB 5ULLA 4C6RA 1R9GA 1ZICA 5B2FA 3QWAA 1U8AA 3FF1A 4JC0A 3Q6MA 2OV4A 3U3KA 4UUAA 2GXUA 5BQOA 4AX8A 4RACA 3AERB 4ETIA 2ZAGA 2BJVA 4QNRA 1JKFA 3QYPA 4CLRA 2B7LA 4RX1A 2A1TR 1AGPA 2JZOA 1M10A 1RWMA 4NCHA 4UMVA 3TR0A 3IUSA 4EL0A 5DXJA 3SQWA 1ZSNA 3C85A 5JJLA 1S5PA 1P6UA 4MVJA 1HTBA 4NR0A 2OPHA 5HTOA 3FR7A 4DANA 3TTTA 2ETVA 2NU6A 2XRFA 4CR7A 1H4VB 1W44A 2ZIEA 4QHSA 5B3JA 3VAYA 4NPHA 2IGBA 4KWCA 4JYPA 1VRCA 1YXMA 3V3TA 2DWCA 1EQ2A 1WD5A 2F43A 2AN3A 2YWXA 3GZNB 3IBTA 1CY0A 4XRRA 2FW1A 4E14A 4OFWA 1MIHA 3JQ9A 4Q18A 3CVOA 3DKRA 1VPVA 4Y2TA 4Q7QA 2WG1A 4ZAFA 3CG0A 1YU6A 2OXCA 3EC1A 3G0GA 3OIUA 4IDQA 2GCOB 1HC7A 4LRXA 1A96A 2Q1UA 3GDFA 3PE3A 4MV6A 4F85A 4BZZA 1Z3IX 5K4AA 1X8LA 1WPRA 1FYVA 3N2GB 3SIXA 3QPBA 3IR5A 2VQ6A 4X24A 3INYA 1XVIA 4ICIA 4R1MA 4U7HA 3SHTA 1E6WA 3UJ9A 4WJKB 4XIGS 3WNZA 4QJ4A 2NZUG 4DXAA 4CL3A 5HIKA 3K6SA 4JB8A 2I7DA 2PA0A 4GZ3A 5J2UB 2G8LA 3GRRA 5HK9A 5K6AA 1BQ3A 3SKXA 5AM3A 3ND6A 4II3A 1A82A 4E08A 1SXJE 2QL5A 2DLCX 2DBZA 2SHKA 2O8DB 3A1NA 1M2JA 1P91A 2JCXA 2BMJA 4JKIA 3SZ3A 3KOZA 4D98A 4HYYA 3JSXA 4ZAVA 2X7XA 2XBLA 5K3FB 2FR8C 4B7CA 2R4UA 3EHDA 4DUPA 1CP2A 2VNIA 4JQYA 1RFLA 4OHMA 4RXTA 2CZGA 3RVSA 3MT7A 3TBHA 1O9HA 2Y76A 5T8TA 3H1AA 2CJPA 3QLVA 1F2VA 1A95A 2EZ4A 3EVNA 4QYSA 1GLVA 5CNMA 3WP0A 4G4IA 3LL7A 4P84A 5CYOA 4AO6A 2QMYA 4HUTA 1S2DA 2H08A 1PW5A 3D5QA 4Y6PA 5EI5A 4XARA 4Y2SA 3STXA 2IS4A 3AEQA 2OGTA 4QJ5A 1JN0A 3ETGA 1AGYA 3DZIA 2OV3A 1K8RA 3G5MA 1SHJA 3OT4A 5TJHA 1UFOA 4QQRA 4ZU3A 1FOEB 2WSLA 4FHZA 5AVSA 2ATEA 1PE0A 2X8AA 3URMA 4R1QA 4NBWA 4OLFA 2RK4A 4KO2S 1PUXA 2I1WA 3F9RA 4HDOB 4B3BA 2Q9CA 1MRNA 2PQ6A 3JV7A 3OEEA 4EZIA 1MT3A 4MV9A 3EVAA 5AKZA 3IURA 4BO7A 2RH9B 1SZCA 3GX1A 3A1EA 3OA2A 3H5AA 5EUQB 2CJXA 3U1VA 1SUCA 3PV0A 4IUDS 5KYXA 1IAVA 4XYGA 1FMFA 3TDNA 3ZZTA 2PKXA 3JQBA 1CT9A 1D8AA 1IB6A 4GUDA 2XYVA 1LPSA 3HDHA 4MUIA 2D7CA 2O2IA 1QGDA 3BF7A 4LZOA 3FDZA 2BJHA 4Q1EA 2FN8A 3O9VA 4G5QA 4GVPA 3BJZA 4YBRA 1K6EA 3GEBA 3QV2A 2W6NA 1EXDA 2ZT8A 3R9WA 1KSJA 3PC2A 2QX8A 5KQSA 1J0BA 1RPNA 3AXSA 1HRKA 1V39A 4LF5B 2IV7A 3W3AH 3B2EA 1N2CE 3UC5A 1RRCA 3O90A 5E1OA 2MSEB 2G40A 1NDQA 1DAFA 2HPZA 3NI2A 5LDGA 4KKXB 3UK1A 3MJRA 1SWWA 5FPPA 2QXUA 5JSKA 5K2MA 4DZRA 1IN5A 2FPLA 2R6AA 3N8HA 5E4TA 5JNLA 4NE7A 3VO8A 1GUAA 4TT3D 2AEEA 4UOEA 1BKYA 1DAMA 1QH0A 3JYOA 4RTMA 2GAFA 3L92A 4GLLA 1VZ2A 4F3NA 2ZU6A 4KZPA 3HTXA 4FYMA 2BJOA 3HB4X 4G5GA 5ALMA 1NJFA 3E7PA 4MW2A 4US2R 1I4EB 4IRUB 1O87A 4MKGA 4O5OA 2MCFA 4BO6A 3DFIA 4DR5B 4MO9A 2IZOA 1TD1A 1KJ9A 3RT9A 3I9JA 1JLRA 3CQ2A 2UUOA 4KQXA 1GPUA 1Q7EA 2EFHB 4B75A 3WLPA 4L5AA 4U6QA 2AKAB 3K1AA 3K4HA 3UFXA 5B4TA 1KVUA 3GJ3A 1JKJB 2GLUA 4K8RB 4YJHB 2SCUA 3HDYA 4L1KA 3WKBA 2JFOA 4TSKA 2OFWA 5IDVA 4LWPA 5A9SB 4N4AA 1HI9A 3BKWA 4L5CA 1QZUA 3B38A 3FDJA 5JS2A 3UMSA 1K5DA 1RJGA 2H1FA 3VVCA 5LLSA 3BZWA 3O47A 1S96A 1SQGA 3Q10A 2VXYA 4RLSA 3U13A 2DULA 4HF7A 1H4SA 4A0HA 4DLYA 2GN8A 3T3DA 3WGQA 1AA9A 1RXYA 2GBIA 3KT8A 4C43A 5IWCA 3AETB 4JJAA 3A4VA 4QBIA 3GAMA 4QU9A 3WKAA 4W9RA 3ZJVA 1G9XA 2V7VA 3QBTA 3DAOA 4QSMA 3VBCA 3QEAZ 1V25A 1LFDB 4ALNA 1IB8A 3S40A 4EZEA 1C9JA 4NOLA 5FWAA 3REGA 1I3MA 3QA3E 1HNXB 2Z56A 1BXRA 4IIJA 4O63O 3BL5A 1QOQB 5DGCA 3GZTB 3TTVA 1XELA 1JQ3A 1U28A 2LP4Y 1Y1PA 1YBMA 4AJIA 3ZTYA 1M1YB 1QGZA 3EFBA 3KTFA 2WI8A 3ZHUA 3UT5A 3BX1A 1RVDA 4JB2A 5IN4A 3LXMA 1CVRA 4KH0A 1KU0A 2EP8A 2C3OA 1PR5A 4RH3A 3AG6A 2HT6A 4LE2A 2RAFA 4WXEA 5KTPA 2Y1EA 1VEHA 3A31A 2GM5A 1NIJA 4JUFA 3FVTA 5IPFA 2QRPA 4WK0B 3SFVA 1AHPA 3DBHB 1ML4A 4NK5A 4I50A 5T4HA 5FLXA 4V0LA 2HWXA 5TXGA 1JW9B 3G17A 5ECDA 5I7HA 2AI2A 3A4TA 1IU9A 1DPFA 4I7EA 3EY4A 1QDLB 4IAOA 1VCMA 5A5FA 2IYLD 1K2WA 1ZN2A 2HEGA 2O2SA 4AJ2A 1SEVA 1BQ4A 1VL8A 4CLXA 2J9GA 1XCBA 1O3YA 3MGBA 2OO3A 5AUNB 5JG7A 1DV1A 3OY7A 4UQPA 2C0PA 4JUBA 4ZWNA 3GLUA 4NG5A 3ET5A 1U1EA 3C5EA 4DUYC 3QLJA 1ZVKA 2VRBA 3K2BA 4DIUA 5B1YA 3P0HA 4X6XA 2RGCA 1U9CA 2B8EA 1S8OA 3MGCA 1SWVA 5CK5A 2QRMA 2PYZA 1K1EA 3RSSA 2CFIA 4H3KB 4E94A 5AJYA 1UBNA 4JLWA 3VKHA 3QTBA 4J0HA 1N3BA 1JEQB 1Y42X 3NNNA 1SOAA 1PZXA 4FFBA 5FA8A 1R8XA 5JS6A 2YICA 5K4HA 1G8HA 3P0IA 2Q07A 3LK7A 2Z5LA 3JQEA 5BSVA 2JHCA 2VBFA 3OMLA 1ZPDA 4N5MA 4P54A 3UJDA 3WHPA 1HTTA 2FGJA 4RFSA 1FPMA 5IM4F 1KYYA 1W93A 4WKCA 5T3UA 1RDFA 3EOBI 1KAMA 1C4OA 3HU2A 4R01A 4MIEA 3EEOA 5ITZA 1E64A 2OEPA 1U3CA 1XQXA 3LA6A 3QWFA 3TRKA 1SBNE 1A5SB 1IY9A 1G0NA 2ZRIA 4LRWA 1N4AA 4HDQB 2BVNA 2XGJA 1ODTC 1X86B 2O23A 3E4DA 3N0XA 5BR7A 1CETA 3UAZA 4WKBA 3IP8A 1UBFA 3ZCSA 1YJ5A 1VYTA 5ALUA 3W5IA 2MU1A 2NXCA 1JEDA 1ONPA 1E2EA 4G5OA 2WTUA 4UHKA 3L05A 2HU5A 4BAGA 1UBRS 3FJYA 1MXBA 4FCTA 4JP2A 4NH0A 3TM4A 2A5GA 1JIXA 2JRLA 3DZHA 2GVZC 3MBIA 3MT9A 3T41A 2ZBFA 1Y6JA 3D7KA 1KY2A 4I8IA 2OYCA 3IT0A 4JT8A 5BRNA 4DREA 4JLDA 2VJLA 5BV2P 2LRHA 2R00C 5A7GA 3CE6A 4HXFB 1G7CA 5KOHA 1KOGA 2AJ8A 1NXWA 4AW9A 2AHRA 2WSYB 4LGVA 1OAKA 1MG5A 3HCFA 5FCDA 1GUZA 1HKHA 1KO8A 1YKFA 2MYUA 2NAPA 3L5KA 1DBWA 1JTFA 3FB1A 2LZ0A 2P2ZA 3N3AC 1PCXA 2AZMA 4PE5B 1T4BA 2NTEA 4U3JB 1L4YA 4BGEA 5ICSA 4HR7A 4DYVA 4G0YA 3LPMA 4UVHA 1I4LD 3NTUA 3IEXA 3L1HA 4CMEC 1HE2A 3CZAA 5I4IA 5JNTA 2C96A 1J1IA 4KIFA 2DAPA 1H3NA 3CO0S 1ISMA 1V8FA 2CZCA 3GBPA 3GMDA 4JJ8A 4A0FA 4GWLA 4N3GA 4QYTA 4DCCA 4R8RA 5A3JA 4HPVA 4FE4A 1SOUA 2HLDA 3EDCA 1T5LA 3Q9UA 4W6QA 1KHTA 2W2LD 2Z30A 5FULA 3H5OA 1BN6A 3RUEA 4BMXA 3PUJA 2NZYA 4Q1CA 3DTTA 4N3CA 2A0KA 2G5TA 3FZNA 3IHKA 1ODIA 3BVPA 3JS5A 5A3SA 2FZCA 3EQ2A 3GQBB 5LD2C 1NY6A 2BT4A 3FHLA 5CJJA 2FX5A 3U4HA 1KTVA 3ZUGA 1DBQA 1Z5GA 3UJBA 3ZWQA 4B76A 4L3VA 4EG7A 4HNUA 1GGKA 5FBKA 4EL5A 3WYBA 1AKVA 1XU7A 2XZLA 3D6UA 1Q1EA 1VI2A 2WEKA 4XR9A 2AR9A 5CYFA 1QVVA 1RAGA 1VIMA 2FA9A 2IH2A 1WVMA 2NOAA 2ZRQA 3NHBA 4CLOB 1XZPA 4O0LA 2QUBA 3EG9B 1M5UA 3RODA 1LWOA 3UPDA 2PYIA 1YJXA 3D2BA 3CLRC 3V48A 5SZHB 2I67A 1C9MA 3CVWA 2H4YA 2GF2A 5FFFA 2W2KB 4XWGA 3O8QA 2PXXA 4IIXA 4K2HA 1WXGA 5JH7A 4JLOA 5K8JB 1G9SA 3TTUA 1NN0A 2P69A 2PRIA 4INOA 4IXWA 1FZTA 2AMYA 4C9BA 4UASA 4RE5A 4IW3B 2IXGA 1PL8A 1JHVA 2CCGA 4WOJA 4AXBA 4DA6A 1QDUA 3TJMA 4KQ1A 3NM4A 4UVIA 2W2LA 3IQWA 5LCXA 3MWDA 3NIFB 4BQEA 3KZNA 3T5DA 1NI4B 3HJAA 5DWDA 3N2KA 5HFNA 2JLQA 2XQJA 1CE8A 2ZI3A 4KQ9A 5BWMA 1V35A 4OK6A 2ECOA 4DG5A 1FX0A 5FD8A 1SXJC 4HHEA 5JROA 2W2PA 2BBSA 2WZDA 4GKAA 1GG9A 1ORTA 3CURA 4M9UA 3ZIUA 5IH7A 3QLVC 2R68A 3UW1A 3L07A 1PYGA 4YCNA 3LOUA 5FOVA 3C8DA 5EWMA 2RK3A 4M8LA 1EFDN 4ZO6A 3A6DA 1A2QA 1P7LA 1TRKA 2NVOA 2ODTX 4FYYA 2XCIA 1O94A 2IY9A 2FEWB 2XEDA 2ALJA 4HGPA 4P58A 4KE9A 1JQEA 4QOFA 4PS1A 4OSPA 4YAUA 3OJEA 5ADVA 1OFUX 1SRRA 2SKDA 5EJ2A 2PUCA 3PEFA 3QZUA 4EY8A 3H19A 2QUZA 1OXKB 3NOOA 3M5PA 7REQA 4MUJA 4L4QA 4NYIR 4R9NA 4WD3A 2CLDX 4BO0A 4PYJA 5JI2E 4LF7B 3NHWA 1JQJC 2JFYA 4F2DA 1AA6A 4A15A 1THMA 3G79A 4JI1C 1CUXA 3HR8A 3KJIA 1EX7A 1GNVA 4MS3B 2O8BB 3QMWA 4KI0A 4Z6KA 1ULZA 4XCQA 5G1PA 1G20A 2XMZA 2FJ0A 3NIBA 3NGMA 3OJLA 4JBXA 4L8FA 5FPHA 2PMFA 3BCHA 5J4VA 1GADO 4HYQA 4U7JA 1HF3A 1M2OB 4UHFA 2I2WA 2QL9A 2QUIA 3O3OB 3RHTA 3WGZA 3WLKX 4DLSA 3O8CA 4X7BA 2GTHA 5I5GA 2HU7A 4P92A 1KDZA 1P31A 4OMDA 1RLOA 4IGEA 3T5AA 3Q3VA 3HO1A 5EE3A 3K4PA 2WJWA 4HK4A 2A9VA 1ESEA 4BN5A 1YDEA 1YI8A 1NVUQ 3GPBA 3DWFA 4JY7A 2FFQA 4MW4A 4AWAA 3BXGA 4MWOA 1IBLB 3I9V1 2VNHA 4B3TB 2FF7A 3JARB 3QELA 2P3QA 4OQMA 1U0FA 1QG0A 1RYMA 3V2UA 1V6AA 2AK3A 4LDJA 1Y4DE 2I7VA 3M89A 3ZCUA 3IRVA 3KXDA 5FWXB 1RP1A 4X93A 5LL6P 2XZDA 1RC8A 3TNYA 2RK6A 4JMPA 4EHDA 2IYSA 5JCPA 3A11A 3HDTA 5J2TB 1YT5A 2Q1TA 3EJ6A 1U2QA 3X1JA 2GD6A 3OSUA 4RV4A 5I7UA 1N33B 4OXNA 3VKVA 2JLSA 3BK7A 3W9YA 5JUWA 4UAVA 1AN0A 2FPRA 4OM7A 4R9VA 4B2PA 1GLNA 1XU4A 4CL2A 1QO9A 3T5PA 1O6GA 1SQFA 3KR2A 3FI0A 3EPPA 4KR6A 3SVTA 1DJOA 5B6JA 3VR5A 1JLSA 1EUDB 4MW6A 4BQPA 1VRWA 1KWGA 2EKDA 3D4BA 4FMPA 1SOVA 4AZTA 4JXZA 5CVVA 3FYDA 1DVRA 4JGGA 3JYNA 3UH1A 2G71A 3E9ZA 3R5TA 3U3ZA 1YTLA 5TQ2B 2NADA 1TYZA 3RBVA 5KTTA 3OLWA 1JDJA 1IJFA 3TIFA 3CUEF 2EHDA 5L51A 2BH1X 2NZ8A 2QTHA 3BSSA 3DBVO 3IXMA 3KYJB 4AT1A 1AKNA 4HUQB 2G0AA 1TKAA 4OB6A 5DM60 2QG9A 1PNOA 1QIMA 3DVAA 3CNLA 3I5AA 4OBWA 4RTQA 3EXHB 4RTKA 5EPOA 4ZKEA 3KQYA 1XPOA 1XVAA 3LHDA 2WABA 3CSUA 3ZGVA 2H48A 5EXDA 4XVQA 4YPOA 3FBWA 4MYTA 4GMDA 3DOOA 2XMQA 2R8YA 2FMFA 3TAXA 1I4DD 1XMQB 2NZ2A 3VYVA 1X1DA 1FSFA 3AKCA 4JQSA 4Q12A 5IH3A 5DCWA 4PZ9A 2EX1A 1H4TA 5IJXA 3G2NA 3LE8A 2XOKD 2ZIFA 3F5QA 3K1AB 4FQ5A 3WGMA 4WA7A 4D6YA 3L8HA 3T4UA 4PG4A 4X1IB 4WW0A 2OQ2A 3QBEA 5FBWB 4KOEC 2Q3JA 2B1IA 1JHYA 2HXGA 3L6UA 4MQBA 5EIWA 4EAQA 4Z4HA 3W5CA 2FEAA 2QXYA 2YHUA 5C7YA 4CM9D 4W1PA 4BKUA 5JXGA 4X44A 1ULBA 4I4IA 5BQPA 4F3YA 1IWBB 4LF9C 2C9MA 2FEOA 2ROQA 1X7GA 3TF5A 5T6BA 2IU6A 3PT9A 4ZDKA 4L4XA 3C5HA 1DV2A 2BGLA 2OQVA 4BO1A 1TO1E 1DTWA 3CZ4A 3FBTA 1VPTA 2A14A 2NXNA 3Q5DA 5K6TA 4KGZA 3FUXA 4GL2A 2BAGA 2GNPA 2WD7A 1AMUA 3BWBA 4HTAA 3SK0A 2DHEA 2HHJA 4FU0A 4HVTA 4ZC1A 3S29A 3IP1A 2WG0A 3D6MA 2A8YA 3OEHA 4ZRMA 3U7EB 3WQQA 5M04A 4BB0A 4XRGA 4BEWA 2IOHA 4NU5A 3TCNA 4GYWA 2GF9A 4RELA 1PTKA 3NTRA 2Y67A 4OP1A 3D7NA 4DCUA 1IM8A 1HE8B 2IHKA 3U4QA 3RARA 3WYDA 1H66A 2CSXA 3S81A 1D1PA 4NV0A 5DN9A 2DR2A 1MF7A 3SYLA 1ORDA 3LFHA 2YN0A 3KYDB 4PYOA 4R16A 2Q4OA 1P44A 2AD1A 4PBTA 3QQ5A 4LF9B 3H1TA 2WICA 4DWWA 1UIMA 3LQ2A 5LOVB 3R0JA 5LXTF 1DZIA 3OQIB 4YP6A 2Z8XA 5K0ZA 3HA2A 3S5UA 1ZNZA 3BRWA 4FPXA 4TV8B 2G76A 5E8RA 2HDHA 3T5GA 4D4JA 4Z1OA 2VRWA 3T3IA 4ASUD 1E6LA 4KIGA 3NH9A 4M53A 4PC1A 1VL2A 5CDYA 1RJDA 1RKXA 1KI1A 2A0YA 1KDRA 1RHRA 2NT3A 5IVDA 1RJ9A 3IQGX 1UXIA 1FZQA 2RKOA 3BXEA 1KMNA 2OB2A 1D2RA 1HE3A 1Z6QA 3D0KA 3DE4X 4KMSA 4BBJA 1PZGA 4R0VA 1S9DA 4ND7A 9GPBA 1X0XA 1N2BA 5ALVA 2WYVA 4R1SA 4TQUS 2E5FA 3EIEA 3OZEA 5JQGF 4LC1A 5IUJC 2RHJA 4DR6C 1PU1A 1EU1A 4GS5A 1H05A 3DOCA 3ESDA 2JARA 3FCSB 4M7OA 3EXHC 4UUNA 1YHZA 4X7PA 4PC7A 5C8YA 1AKUA 1P7CA 3U62A 1FP1D 2GHIA 3DD5A 1HQKA 4OQLA 3ZV7A 1FRFS 1SIUA 4DGQA 4EM6A 4OP2A 2L2QA 5C46F 5AW8A 3STTA 1A04A 5AVQA 2WT8A 5JH7B 1HL3A 3MN1A 3X1YA 1TMGE 1WU8A 2QN7A 2XQFA 3BBPA 4GWGA 3LBHA 4CFSA 4ND2A 3P2JA 3WB0A 1K92A 2GARA 3CW8X 1YKGA 3HABA 1ZXXA 2QUAA 1EKXA 2X23A 3IERA 5EJAA 1QF6A 3B3JA 3DMTA 4Z4IA 3GV0A 4UUBA 5DV9A 1MOPA 1QX4A 3MT8A 2PLWA 4RTRA 3V34A 1G21E 3R7BA 1N8NA 1U90A 1YRLA 4KR3A 1JJAA 1PRYA 3BRWD 4BPBA 1G3MA 5F9HA 2MJLA 3BOSA 4CM4B 3WGIA 3AH8A 1P80A 3NJRA 2PJDA 3V1LA 4QTYA 1SKQA 1E32A 2V4ZA 1BX1A 2NVUB 3UXYA 4EQZA 3HBNA 1QRSA 3ASZA 3GGSA 1JH9A 4Z0TA 1XAHA 4D4IA 2A0XA 4GOJA 4JQCA 4AKSA 1ZZEA 2R6JA 1EA7A 5J3JA 1POXA 2QN6A 2CXCA 5CX4A 1RRMA 5C4GB 2QQ5A 4IYRA 2IT1A 1MXHA 3PGMA 3VTKA 3OFND 4BRZA 1WB6A 4FOPA 3FUVA 1CDOA 4GPIB 4A1OA 4ENQA 2BFMA 4KR7A 4B4DA 1QGAA 3HDQA 4V3BA 5FP0A 1RLUA 1R6VA 1H2FA 1WCYA 1OC4A 2FQXA 3SM3A 5KYWA 1F8XA 1QFZA 1QX3A 4DCSA 1LSOA 1VIDA 2WFAA 5DOZA 4BKPA 2ZUVA 3U3XA 4YQFA 3UMFA 2OORA 4U2CA 1Y3BE 3I83A 2C99A 2FZWA 2VHEA 2ODPA 4W5HA 4YAWA 3UTDA 2BPOA 4IGIA 4GZ5A 4UEJA 2HJSA 1HK7A 2FPIB 3W1EA 3PFGA 3GEHA 3WB1A 2GK3A 3TX2A 3GFRA 3MRSA 1JECA 4ZVSA 1CQPA 1MQSA 1Q0SA 2WU4A 3P94A 4FOOA 4F8JA 4QXPA 2DX7A 2ZJ3A 2GASA 1YCDA 2DUMA 5HQ3B 1ADYA 2AMLA 1HE4A 2QN1A 3K72B 1ZK2A 3F2IA 4NF2A 3T7DA 3VISA 4L7QA 2X0JA 3KE9A 3C43A 4FGJA 5EQJB 4R6WA 4LYDA 2YMPA 2Z3VA 4N54A 3TSYA 2EATA 1XP5A 5F5NA 3TLBA 2FUCA 1V6SA 3W06A 5JDCC 1A9RA 2AFHB 3F71A 3MINA 2FVXA 3E84A 4BQIA 1CS0B 4HYTA 3AJ9A 1J39A 1X8XA 2ZYGA 3H05A 4CQMA 2HYIC 3JWHA 4QATA 1CQZA 3UWOA 4XVHA 1O8CA 4TVOA 1TMYA 4UPVA 5DHSA 1W34A 1R0XA 3ASVA 1SHLA 4ZTZB 1WZ2A 1JDNA 2OHFA 4YC7A 1DELA 2VL7A 1L7BA 3GEEA 4KQHA 5L3QA 2FWMX 4D3FA 2BGNA 1Q7BA 2KSQA 3I1YA 3FNIA 3KBOA 4A8JA 1K0UA 2F1OA 3E0QA 4QBHA 3FYCA 4OCZA 1W35A 1O08A 1AQUA 4PZUA 5ER6A 1QC5B 3DCIA 5H1YA 3K20A 3RC2A 3H4TA 3LRPA 1JDPA 3B1KA 1CYDA 2I1QA 5JQGA 1NRWA 1BROA 4X85A 5JCJA 4WXYB 4EUHA 4L2IA 4Q7EA 3CBGA 3SIPA 2VSOA 3FE2A 3OPNA 3GEDA 2ODNA 3GYGA 2NUTA 5HA5A 3DPSA 4UUPA 3F3YA 4B2LA 2EG5A 1LQLA 5D3MA 3VPSA 1C0IA 2A94A 1DIAA 1TAHA 3GJZA 4TWBA 2KDNA 3RYHB 2ZQYA 3TLXA 3ZHTA 1Q0ZA 1KA9H 4TYQA 4WI1A 2VT3A 4UZFA 1T8RA 2PGNA 3BFPA 4N82A 4QDOA 3UJ7A 2BL4A 3RRYA 4AMYA 2GT1A 3EMVA 2WU3A 3RYIB 5EXXA 3IPAA 3U2QA 2YWCA 1T5OA 2YHBA 1VMEA 4Q4JA 3EGDA 5BOSA 3GNLA 3IPYA 4GICA 3RABA 4PCVA 2JD2A 3MMXA 5JZVA 2G4VA 3UGJA 3O84A 1SHUX 1U80A 1Z08A 3N0TA 4HDKA 1UKBA 4JWTA 4RDIA 1EXNA 3W4KA 4D80A 1OKKD 3H9UA 1E9FA 3LHSA 4HH3C 4XYLA 1CY7A 2IIPA 2QPAA 2V7UA 3ANNA 4PC2A 2L69A 2XD9A 4OPMA 4UMFA 3QEMA 5DYYA 3R7WB 2I78A 3BWVA 2XDAA 1XHJA 3C3MA 3MQ4A 1DIRA 3Q88A 5ENDA 3AVTA 3ZXYA 3H8WA 4YRDA 5HKKA 3B9PA 3LGSA 3DPIA 3MAJA 1E1CA 4FLFA 4JCCA 3V4RA 3PQ7A 4X00A 3RKRA 1TD9A 2H2DA 3DZKA 1FP4A 3L4BA 4TYMA 5J4HA 2ZM5A 4GHWA 4JLSA 3HPRA 1KGSA 5ERXA 1Q50A 2OT3B 3DF7A 3H4VA 2UYCA 4HB0A 2QMOA 2ZJ2A 4OL9A 1AJEA 1U6KA 2EKZA 4ITRC 3WICA 1Z5OA 2PIAA 3DEAA 3OCXA 4J43A 2ZRNA 1GU0A 3O9MA 4NBKA 1H1TA 2QG4A 2C3PA 4O2LA 4XQ9A 4CQMB 3LD9A 2VHZA 3NM6B 4HDMB 1HZZC 2R65A 4UFNA 4ZHSA 1QV9A 4FGWA 5T8KC 3SJAA 2OUIA 3VO2A 4RD3A 1JHQA 1N36B 1XRLA 4BRWA 2XZOA 1L3BA 1F3LA 4ISCA 3PI7A 3CKLA 3EY9A 3M3PA 1WCV1 3H9BA 2EWWA 2JLBA 1T9DA 2OCBA 3QBVA 1N2ZA 2OCGA 1L7RA 2PTGA 2Y2VA 4DABA 3T7AA 4Z3KA 1T5BA 1PQPA 5FLEX 2QYHA 5T4FA 1P62B 2R6FA 1FNMA 4QGAA 5IC4A 3L7LA 2IUTA 5FFMA 2V74B 5GY7A 4NE2A 3O1HB 3TH5A 5D1NA 5M3BA 1LA2A 1R50A 2HQBA 3RJTA 4MRNA 1PG5A 3LUPA 1MRZA 3PB3A 4ED9A 5FOQA 1B6TA 2JCGA 2BJWA 5F7ZA 1KAHA 4Q15A 2VPTA 4PNZA 2YBDA 1FDRA 3ZY3A 4BNXA 2P6RA 4ZI2A 2J3EA 1JJVA 5T3YA 1JLHA 2I4LA 2AW5A 1R4AA 3RJMA 3P9IA 1U94A 4BMSA 5IVKA 1NR1A 4DDTA 1FFYA 4CMIB 4ACBA 1TM2A 3LW8A 4LW8A 4S0XA 4DL9A 3NYRA 2G77B 4FHFA 4S1OA 1YVRA 4M1YA 5ALZA 4E5DA 1TJ4A 4YREA 3K0CC 1IOVA 4TT8A 1QIFA 1ZGHA 3PVZA 3IQFA 2OCXA 3UN1A 5EIEA 1OMOA 1J0AA 2OG2A 1YDFA 3RSFA 3PCTA 3VR3A 1OFGA 3PXDA 1B26A 4UNSA 3O8QB 1NNSA 2I2DA 3TDEA 1N1GA 2XMBA 2CLSA 2XNSA 2H7CA 1KPIA 2PL5A 5EVJA 3G0IA 1KNXA 3T54A 3DV2A 4ZHQB 1YONA 1L6RA 2F00A 1G2OA 3WMRA 3PFCA 1P9OA 4N5HX 1SXQA 4H3SA 5IYZF 2Q9UA 1M3SA 3OKAA 2PXCA 5EHXA 5LVAA 5AQEA 3EULA 2VSYA 3KAPA 4M8SA 1GRVA 4UEKA 1L1RA 3LDFA 4C05A 1KYVA 3HXTA 3QE4A 4AAYA 1FFXA 1V3TA 1RYBA 3LPLA 1YE3A 4EI7A 1Q1QA 4GH5A 1FFBA 3FCCA 1G1MA 4G86A 1Z63A 3KKMA 2VDNB 3JYPA 4QFMA 3UO8B 5TQ2A 3GARA 4ZAYA 3INRA 1QS0A 3V55A 1QORA 1XMPA 4CTKA 1XNQB 4ENVA 2FWAA 4MB0A 3QH4A 4HAWA 3T12A 4QVGA 2HYDA 1FXWF 1Z6ZA 2O8CB 3TQSA 1T4CB 1VBKA 4JJEA 4QREA 2ECFA 3WYGA 1C4WA 3EVDA 5IX8A 3M1YA 2PU5A 3NEYA 4N5LA 4OD0A 4O1HA 3OLVA 3VPFA 3I5YA 3I5XA 2ZKLA 2Z9CA 3PLRA 4WOBA 3ED1A 3GFOA 1G8SA 4TLLB 1ORIA 1YGYA 4OYHA 3AKYA 3NORA 4H0NA 2RI1A 2C0QA 2HWUA 3EMDA 1JLMA 5CA1A 4H1TA 2FDXA 1ETHA 1MUUA 2P9FA 3LM8A 2GJ8A 1LVUA 4LRSB 1UMCA 4UUOA 3QXJA 4PLTA 3LZCA 5JPDA 3LVFO 2IYTA 2M1XA 2AF3C 2QU7A 2YFYA 2VDRB 3DOEA 1ZOPA 1G41A 2XA1A 2YJ4A 3LQ4A 4XFKA 1A98A 2DBRA 2EEZA 3AJ8A 4KVZA 1QDEA 2O4CA 1SIWA 2BSAA 1XK7A 2HJGA 3E2MA 4DT1A 3RD5A 2OE2A 1GL9B 3D5EA 1WZNA 5ARDA 3VH1A 1JXOA 5ALOA 4RZSA 5L7YA 1S6YA 1J24A 3QFTA 2V58A 2J59A 1BNCA 2AOUB 2G80A 2G36A 2PTHA 1TOAA 4MVJP 1X70A 4V38A 2PK3A 1JG2A 2F1HA 5FEMA 4PG5A 4EVRA 1XI2A 3GRZA 4ALKA 2PCLA 2MWMA 3C39A 1IJEA 1DTWB 5GZ1A 5AKXA 4ZI7F 3AOGA 3M4NA 3S44A 2VT7A 1ZGGA 4UCQA 2Z8YA 1YBAA 5GONA 1Y1TA 5HRCA 3GA7A 4BLQA 3HDVA 2GXAA 1NBMD 2C8KA 3I05A 1L5SA 5KZMB 3H2BA 2VUSA 2V8OA 3PHHA 5JO0A 2E4ZA 1Z4PX 4C04A 3IXLA 1SVLA 3PFBA 4OHOA 3P9XA 4EFMA 5K01A 2QQ0A 3EUAA 3RE1A 4ME6A 4DQXA 3U44A 1RXSA 5JMTA 3QXCA 2H0AA 1G5PA 2EKBA 2W58A 4CDRA 4F38A 5TLSA 3L0PA 3MIZA 4RO0A 1YMQA 5FRDA 3OBIA 2FW0A 3W9BA 2JKVA 3QVGA 1MW9X 2J6HA 2V3CC 3ACBA 1YGPA 2JVKA 4YIKA 3PQ6A 4G23A 2IYVA 5C53B 1G17A 4D43A 2HV8A 1O92A 2O6LA 4TZKA 4RY8A 4PS0A 1PNQA 3JCZA 4LZJA 3D3WA 3DOIA 2ZLBA 4M6WA 2JGAA 3GZNA 5EXEA 2FZEA 3USCS 2XXBA 5AM4A 1SQ6A 1IM5A 4ANFA 3R6GA 3MWEB 4F56A 3BXZA 3DV0A 4IGAA 2VP3A 2P11A 3O3NB 4XWWA 3GVHA 3LX5A 1ACJA 1K75A 2UVPB 3A1CA 3PDJA 2OV6A 3WS7A 2IOFK 1R0RE 1JXAA 5BYAA 3DR5A 1T91A 1ECJA 5CB8A 5FPKA 1NSTA 3I2IA 5C5IA 4DLAA 3U31A 1P6QA 3ERCA 2VDWB 5DYIA 4AG3A 4WLVA 4QQ8A 3GJSA 4EFLA 5IJ0A 2V0GA 4I4TB 3OO1A 3WP1B 2GFIA 4NOZA 1EFTA 4GYYA 3IBYA 4Q47A 5JC8A 1R6UA 3ETNA 2YV3A 3D4NA 3WLLA 3NM5A 4C0SA 4M88A 4BDSA 4KH1A 4KTTE 1PBTA 3PQEA 3HO6A 4Q0MA 4ZJZA 4XFDA 4G1CA 5E1BA 3CTMA 1G291 3OCVA 4OI2A 2GRUA 4DV5B 4GVXA 5ALNA 4YLGA 5HYVA 1TCVA 2Y1LA 1SU7A 2Y0DA 3KXWA 2AN5A 2O2EA 4DPKA 3DE0X 1JIUA 1FU4A 2HY7A 4E32A 2D74A 3ROMA 1FDUA 3ZXSA 2Z8ZA 3C7TA 4Q9NA 1HEIA 2C2HA 1OTYA 1PV2A 2QAGC 4YROA 1X1TA 4XDYA 1JJBA 4EHJA 3I1IA 3SC4A 2VK8A 1XCOA 2X8WA 4RU1A 1XZ8A 1JU9A 1GEGA 1Y8RB 4MARA 4Z3DA 3S2YA 1GV1A 4D6XA 1CHNA 2H92A 1D4OA 3R7FA 4FCVA 3VC1A 3P2YA 5BORA 4KQKA 2AJTA 1QLWA 3GDHA 4IMRA 4RF5A 1NXTA 1OBOA 4NK4A 4F3CA 3WWYA 4N9QA 2XWSA 5KYYB 1U0BB 3BXXA 2DQ4A 3GCZA 4MUKA 2B83A 2CVHA 1Y7IA 2X9QA 4Q9DA 4JP1A 4MI6A 2B4KA 4XDGA 2ATXA 3FPJA 1Y7TA 1UJ5A 4QOSA 3VNVA 3G85A 5DBEX 5EJ5A 4DM3A 1DZ3A 3H11B 1N77A 5C80A 2GYUA 1BDMA 2FW7A 3BTVA 3K9WA 5I4KA 3HWRA 3A9UA 3ZG6A 1UIRA 4PX2A 2ZM6C 4QC2A 3V7NA 5HP4A 4KYUA 2KLBA 4ZOEA 1I2MA 1HWYA 1XQ9A 3ST7A 4QDJA 3AGPA 1VRVA 4ZYVA 3I2HA 4X1IA 1I94C 5J1SB 3THXB 4NXMB 4UBIA 1GPH1 3CFYA 3PHCA 2WSSA 3AVWA 4XLZA 4G3XA 4GI7A 3TB4A 3WRXC 3KKLA 3UJAA 4Q9KA 4CXMA 1IM2A 2P9TA 1Y9ZA 3HUUA 3OTOC 4CV1A 3JQAA 3U56A 4KXLA 4A0GA 1RI3A 3OO0A 1NJ1A 1ATIA 5MN4A 4RPHA 4L95C 3VHLB 4B83A 1U28C 5T4BA 2VDKB 4I1IA 2PR2A 1UAAA 1Z07A 1S3FA 3BPSA 3KWLA 3LGXA 2D1YA 2BHLA 3K0SA 4DV4B 1ZM3A 3ED5A 3RG2A 1CQWA 1K4MA 2I71A 2UZ3A 2POQX 3IQEA 4GOXA 2PUGA 4MIYA 3S1AA 4BMPB 4LHSA 4Z86A 3GUZA 2Z6VA 3V4OA 1EFPA 3WK8A 5KU1A 1C7QA 1Q3KA 2J9FA 2X9VA 4GT1A 4YV7A 1SIBE 1U1DA 3GP8A 2Y1DA 1T3GA 2VJDA 4LDQA 2J3QA 3AKZA 5KAPA 1M2FA 1RKBA 2G0TA 3I2GA 4WCFC 4HXYA 1QHNA 2H8KA 2FPWA 3VR4D 3AYXB 4JR0A 1U3TA 4G5XA 2FR8A 1F4VA 2OZVA 1WY5A 2CB9A 3UK2A 3UJ3X 3MCTA 2YCBA 3NASA 5JCOC 2A2ZA 4PZCA 4I46A 3D5TA 3TGLA 1UZMA 2O8FA 1B15A 1U3UA 1MQAA 2ZUDA 2RBGA 3T3MB 3L6CA 3WJ2A 1E6CA 2F43B 1X92A 4ESHA 2B25A 1N5JA 2CY0A 3M6AA 1HTWA 2PG3A 2XT6A 4B80A 1F2TB 2Z51A 3U49A 4DMUB 3G8BA 5NULA 4FSDA 1IOZA 1A9OA 1XZLA 4J94A 4RGYA 2NYRA 2HA3A 3E9MA 3M4ZA 3TYXA 4PHTA 3O26A 1YFJA 1KVRA 1SMKA 5EP4A 1JS1X 3CR3C 5DHAA 3NJ4A 4FMCB 1YB7A 4MJ7A 2O5CA 1G0OA 3O8OA 3NBXX 1PFKA 1H0SA 4HS9A 4UUMA 1ZK3A 4QZVA 4EITA 1PZHA 5BWLA 1UPAA 3LLSA 3DEJA 5I7RA 4JOCA 1YJBA 3HU5A 4FFMA 4D41A 2I9KA 2JGMA 1JYFA 3RBZA 3OD1A 2O8CA 3EFEA 3N75A 3WLRA 2C2KA 2PY6A 3RVOA 3E61A 3T5MA 4WZ6A 4P3OA 4XWKA 2DTEA 1JHDA 3SJUA 1A8PA 1B00A 3B5IA 5LYJA 3UZ0A 4C0JA 4P38A 4ZQBA 3UM9A 3HVRA 4UNPA 4BU1A 3WMXA 3PT5A 3K5HA 4A10A 3KPVA 3RTGA 1XRSB 3Q7EA 1NKTA 4ZVOA 5LPNA 2C4VA 5EHNA 3QVOA 1UINA 5G0TA 2WIDA 5E4FA 4INZA 3FFAA 1FTQA 5LSAA 1CNMA 3RUPA 4ZOBA 2EKPA 2ZYRA 1N2SA 5TMDA 1V8OA 1ZD5A 1O54A 1NOIA 1OZ0A 4ROTA 4XM0A 3F5DA 1EWVA 2WKSA 1W25A 3GQVA 3VKWA 4X1YA 3KT0A 2QM0A 2A9FA 4QOIA 1NY8A 2MYTA 3NUQA 2G7ZA 2VWQA 1TCAA 4GWKA 5AI8A 4EKYA 3QMVA 2QVCA 1YB1A 2V4UA 3OE7A 2FR1A 5HW0A 4LZLA 1HYBA 3OZAA 5THQA 3UKJA 4AF8A 3DLBA 4Y2VA 3PJGA 1XHEA 2JAUA 5HWSA 5IZ4A 2B4TO 2EYQA 2CV0A 2V6BA 4IIJB 1PG3A 1P72A 1M1YE 4G2TA 3FTCA 4BNTA 3HXQA 1ZVVA 2PJUA 3RTAA 3HM2A 4RAOA 4MTNA 1YE8A 2J9FB 3D43A 4LZWA 4TKVA 3BREA 2C31A 4EZBA 2DG2A 4F5ZA 2BKXA 1XTTA 1MOZA 1OTXA 5AXBA 4M1EA 1M1UA 4RPIA 5ELLA 2E89A 1TEHA 4NZNA 5LYYA 4A2QA 1Y1KE 4TWJA 1TQ2A 1J6UA 3KR9A 3T94A 1KI2A 3MJSA 2XE6A 3IVGA 4LJ7A 5FBVB 1EB8A 1KMHA 1OU0A 1ULSA 2RJOA 2XRYA 3E8SA 1K5HA 5GONB 2XHZA 1WXDA 1UFKA 2VF7A 4DCOA 1TIKA 4O25A 3CJQA 3T95A 5KX5B 4P4TA 1BWQA 4WKNA 3H2TA 2VZLA 1V48A 5K8FA 1CKEA 2HU2A 3O94A 3B9RA 3D8NA 1I0IA 1QO0D 4PAOA 3R8XA 1NOKA 3DZGA 2OD9A 3GD7A 3WRYA 3ABQB 1EGAA 1ACMA 4KXWA 4HWPA 1B41A 3I9V6 2NXJA 3REOA 4J1QA 5EMLA 1HOTA 2HW8A 1JAYA 1NAIA 1CRZA 2FRXA 2A9JA 3PPIA 4UZSA 5L4NA 3C6KA 1H3EA 2ZFUA 3C8HA 1EP1B 1K8XB 1OZFA 2VN8A 2WJGA 3T35A 1QWSA 2I3BA 3TLZA 2VAWA 3ME5A 3AJRA 1A9SA 3QX3A 3WKEA 2VG8A 4C3VA 1LSSA 2WIGA 2X2EA 1N57A 3OPQA 4JVMA 5K0GA 4HZIA 4B6PA 4IVPA 1PO7A 3RUAA 2R44A 4IBOA 3GLIE 1QAOA 4EATA 1ECBA 4QT0A 1E98A 1HDZA 2EVWX 3FYUA 1I2DA 4EGSA 1E9BA 1CUBA 4QXQA 4OA5A 1WUKS 3W04A 3WK6A 5LB4A 1H2ZA 4J7XA 1T8WA 4MKZA 1U3VA 3B9QA 4YXWA 3V7YA 5IBPA 1H6AA 1HH4A 2VHYA 3W6PA 5M5BA 1JEOA 1UWVA 2XUIA 3DPUA 1G8JA 4Q3LA 4LXTA 4KSCA 2H5EA 2HCFA 3OZTA 1WXXA 2XEXA 5KDOA 1HYQA 3QX9A 2DB3A 5DW0A 2CNLA 4IQFA 4O2BF 3M5WA 1PT7A 1R0LA 4BV8A 1TAQA 2YFKA 2ZVJA 2CD7A 3IVMA 3SNKA 5B7PA 4AJNA 5JYBA 1NVKA 5F7OA 2YVKA 5CFMA 4P33A 4XX0A 2B98A 4HSEA 4Q4AA 1MH1A 3MW8A 3UXMA 2GN6A 4YALA 1WEHA 2NV0A 3R7AA 2OTCA 4Q6WA 3GRVA 4O2AB 4RL4A 2CNWA 4M0MA 4L0CA 3WGHA 2ZW9A 4NZYA 4KQIA 5BYJA 4OJKA 3TW8B 3NHLA 5G0UA 2KM1A 1HFWA 4LK3A 2QTLA 4MA4A 2QLTA 1P2SA 2ASBA 4XUGB 2QHXA 1OIWA 4CN9A 4DARA 1RBQA 4BJ5A 4YY3C 4Q21A 4AUMA 3KQKA 3RHSA 3ZE8A 3DYBA 4A8HA 2FQYA 4RA6A 2Z4SA 1CU1A 1U3FA 3HPQA 1SO8A 2JLAA 5COAA 4EGAA 4OMCA 3ICPA 1ESNA 1NVVR 2PH5A 2QAGA 3SFZA 3TRHA 2J7PA 3AETA 4BTLA 3PIDA 2REOA 4C5BA 3EJWA 2X4DA 4ZVNA 3PC8A 3AGQA 3QOFA 5C8YF 1OVGA 4V0NA 5LQKA 4HRVA 3KT3A 3W5SA 4W5RA 2PWZA 3SC2A 4Q3DA 4NHOA 2VHQA 4X3CA 3VR3D 4R1PA 3OBBA 2VA9A 4W6ZA 7GPBA 5MN5A 1WP4A 4AJ4A 1U99A 3DWIA 2AOUA 1E3LA 3EF0A 4XR4A 5DNYB 3EERA 3GRYA 3AYZB 2VJPA 7ADHA 4RF2A 5JHHB 5KUTA 3A9WA 2VHWA 4JI8B 3QU2A 4NCNA 5CX1A 3AQIA 5BYBA 4I8DA 5LP6B 4OP3A 2FSFA 4R1OA 1O5OA 2AFIB 2PMCA 3UHJA 4ALLA 3W5BA 3IAS6 3LQ1A 1M5RA 5LQSA 4P34A 3CLTD 1TU3A 2VCYA 4CMIA 5FOSA 2L82A 5H7XA 3AEKB 5AP9A 1YTUA 2QY6A 4D0LB 2SCUB 3ZOZA 4MR7A 4QBGB 1KI6B 1E2BA 1EFPB 3HA5A 4WLNA 5JZOA 1Z7GA 3M5CA 4KQJA 1IEVA 2NZVG 3RASA 3HB7A 3CB4A 2FH5B 3MK31 5REQB 2PZMA 3F5MA 3HB0A 3IAHA 3IE0A 1DBSA 1VJ1A 4FFPA 1P2UA 4MGYR 4UPDA 3UYKA 3ZZUA 2IEYA 3TECE 4TM8A 5HE8A 2VJMA 1RM3A 4RWZA 4I9UA 3NIGB 2QW1A 3BA1A 4PYMA 5CJPA 3EUEA 1K7YA 1PV1A 3CSSA 2YJ6A 4KWIA 4QDXA 4PLFA 3RTEA 3RFCA 4DMMA 5BWBA 1TPZA 1CVLA 1V11A 1MX3A 1BYUA 2O0JA 3LNOA 3BORA 2K4MA 3KQUA 1UJBA 1EJBA 5LWQA 2Q28A 2HPHA 1FFXB 5A5DA 2P41A 3WK5A 3B1FA 1DIOB 1G8FA 1KR5A 2JVIA 1G8KA 2PBRA 3NWBA 3PFFA 3Q7PA 4MINA 5D86A 4FMBB 3KR1A 4C06A 1U0TA 2I7XA 3GAZA 4ZVVA 4AKIA 1R3UA 2BUBA 3VOSA 1YFZA 4DOMA 2A84A 3C3KA 4HLCA 1KWKA 3BEDA 5K8TA 3V8BA 2JIBA 3NTOA 2GMWA 3HADA 5J9FA 4CMEA 1KH2A 2HA6A 3QEOA 1QR6A 5BSMA 3NAZA 1Z88A 3D8TA 5FNVB 3VDNB 2Q50A 2ET6A 5E9QA 4AF7A 1NRXA 2O1EA 2ODAA 2D62A 2R6CA 1OILA 2E4YA 2GKGA 3FUTA 4FSXA 1TA4A 4JSRA 4S1PA 4BFTA 4R2HA 1UH5A 3ODPA 4GP6A 1F0KA 4K3UA 4OGFA 1IBKB 3VQTA 2PSFA 3FRJA 1P75A 4G65A 4WADA 5GJCA 3ZTTA 4NY1A 1VLHA 3U7QB 4PZDA 3AX6A 3J80D 1BAPA 2G25A 4ODJA 2I6TA 4JENA 2AKYA 4L16A 4HNVA 3KL2A 1HH2P 3OZIA 3RVPA 5K2OA 3CBQA 3CRZA 1M6XA 3R5XA 4AP5A 4XD2A 3MYRA 4EMUA 4IS2A 4KQCA 4B3IA 4DFDA 5ICGA 3RAGA 2FDCA 5F3DA 4JZYA 4CHGA 2A7QA 1YQUA 2F17A 3AF1A 3ODGA 1OGJA 3CZ5A 4ZDIA 2Q5HA 3I5MA 5K8CA 4BUZA 1Y81A 1ZN9A 1JHUA 3LWNA 4KI7A 4G4SO 3UIEA 4NDNA 1TVKB 1T8TA 4OBXA 1WBJB 3QWIA 3HV0A 3FCAA 3K6JA 3KFXA 3PNPA 5IMBA 2FZGA 1I6MA 5HZGA 4MYUA 1YRWA 2QRZA 3A6JA 5KVQA 1GTG1 4R9SA 3TXAA 9LDTA 4Z0PA 3UZUA 1WHSA 4HCJA 3LXUX 3A9VA 2IYUA 2X8JB 3ONVA 3R3YA 5FXMA 2PZKA 2CU6A 2XB6A 2ZCUA 5FTJA 1BGWA 2HJHA 4BC9A 1UWLA 4M22A 4W9NC 4LQDA 1ISFA 1XPJA 2YUTA 2IKQA 1MGOA 3CX7A 1NLYA 1ZGCA 5G0VA 4LYYA 3EH2A 3W8FA 2FPPA 3Q11A 2J5KA 2FZ4A 2O7VA 1QK4A 3GMTA 4KVGA 4L8VA 2PSSA 4MW0A 2VDJA 1ABFA 4L8YA 5GJWC 1F6WA 3KQOA 3RV4A 1QIHA 3LW7A 3CA8A 3VZPA 4U8GA 2ZULA 3W79A 2PT7G 4TTJA 4K9KA 1SK8A 5KYNA 4OHBA 3SNHA 1S8NA 3T5CA 2YWBA 1HDEA 1XQWA 4OGKA 4KPEC 1DG3A 1IRIA 2C4NA 3B1WA 3ZXXA 1U8XX 1JSRA 1DXYA 1T0PA 3CO5A 3DP7A 2PL3A 4O3MA 2Z6AA 3ABRB 2HBYA 5FO0A 1E4EA 3NOQA 3O38A 4GL4A 3OM8A 3V6LA 2AVDA 2GAAA 4GIBA 1YOVA 1LBHA 4UDYX 4D26A 4MVCA 3GL9A 1Y7PA 4Q19A 2QVXX 4RIIA 3S2UA 4ENUA 3V2GA 4YIHA 1A9YA 4V03A 1PEAA 3KQSA 3KQHA 3V33A 1ZU5A 2XLBA 3KTAA 1CRWG 4FJ0A 2QJFA 2O4UX 4RZHA 1ZR2A 4IMPA 4PFJA 4QXOA 4K9SA 5C8VA 1KRWA 4ZQHA 5AW6A 1WDTA 2VSQA 3E4CA 4MAMA 3BGWA 2YNMC 2FYTA 2VP0A 4BFZA 5LJIA 2WDPA 3AF6A 4NMXB 4KQFA 3ZJ4A 3S8EA 3FYTA 3MJCA 1FSGA 3CX3A 3TE6A 3RSGA 3KWJA 2Z1NA 2XDWA 3DVQX 1XD2A 4LFAB 4WOKA 4KV7A 3QE9Y 3OWHA 4MRSA 4PSVA 4JSTA 4N47A 4D81A 2WYIA 4R3NA 4HUQA 4WLOA 2JAWA 3ZV3A 1P1IA 1HEYA 1G4AE 1MXFA 2IJGX 2ZRPA 3B51X 4RK7A 4B74A 1HNZC 3TFQA 4EMBA 4FFDA 1EDOA 1HYHA 2ZYUX 3N39C 5TJ9A 3LUDA 3A3YA 4C3ZA 4JNCA 3RTCA 5BQXA 1L4EA 1DP4A 4LV5B 2ZEJA 3RVQA 1RAEA 4RD4A 1I10A 1CE8B 1QK5A 2HO5A 3NO4A 4W8OA 3KD2A 4X91A 5EL0A 3N70A 5ERGB 3MC1A 4M8IA 3WZLA 1KJNA 3ML1A 1I32A 1X7WA 1Z6YA 2ZJ4A 3QX8A 4HN4B 5JARA 2A1IA 2GN9A 5JBNA 3TTXA 5FTNA 1Q7CA 4LJSA 5KOYA 2QR5A 2OYRA 2A5DA 4QUIA 3T1QA 3A2LA 2P9GA 1RHQA 2DQSA 3VDQA 3BB4A 5AM1A 2H1RA 2H1IA 3ZK8A 4RVSA 3IC5A 2H31A 5ES4B 3E23A 2JDIA 4EELA 1J8YF 1ISIA 1AV7A 1C81A 2W0MA 5CT5A 1FYFA 3HCPA 2WY2D 5IULC 2DHMA 4JODA 2CFRA 4LFBC 2QSJA 1W2WB 4X8OA 2P91A 2C0CA 2PVPA 3NGXA 3OZBA 3OTIA 2X0EA 4QDUA 1NW9B 1N5DA 4ZRNA 3MS2A 4I5DA 2RB5A 4PXYA 2ZQ5A 4HEA6 3RUIA 6YASA 2JG3A 3GXOA 1M72A 5CFQA 2JJ1A 1C1DB 1SBQA 4L2ZA 1D6SA 1UP6A 2D5LA 2ZJBA 1A4UA 5J63A 1M1NA 4DSAA 5KJCA 4RCZA 3SJ7A 4O29A 3KUKA 3G2HA 4TLMB 4QPCA 3I6QA 2PLAA 1F0YA 3ROKA 3T9DA 4DSZA 1VGRA 2B5VA 1SZDA 1XA3A 1YASA 2FW6A 2AOTB 3KR0A 4R3WA 1E2UA 5F1OA 2XA9A 1T9GS 1TYAE 1D7OA 3JW8A 2EKLA 3U3DA 4QG3A 1MX5A 4CIWA 1SQ0A 2UZAA 3SD7A 3DW1X 4KFTA 1SCJA 5DI9A 3JRNA 2OP1A 3LT1A 1FSSA 3VHXA 1EGQA 1QC5A 3ZW8A 4RTSA 2NP7A 1W4BA 4CDGA 2IZ6A 2X0KA 1VLJA 2G0NA 3H2KA 2XUAA 3H5IA 2FFJA 1G21A 1O77A 3R8FA 4MOWA 5AUPB 8LDHA 1ZLYA 1QH9A 3V2IA 5I7FA 5JTUA 1KDYA 1U2ZA 4RTNA 3HDJA 2RB4A 3V42A 2YIDA 4XD7D 3AB8A 5JS7A 3DFMA 3EDRA 2QROA 1H8EA 2C57A 4A7PA 5F7XA 3UOWA 1NQXA 5AJHA 2AA3A 3PJEA 4HV4A 1QAMA 2CFOA 3K6RA 1DAGA 5KNCH 1M67A 3A37A 4W7HA 4HFNA 3A2KA 1CERA 1P74A 2RGNA 3JD4A 1ST2A 2GESA 2R8RA 1R5BA 2VH5R 2HUNA 2AUTA 2IYAA 2H9IA 2ZZKA 4R2LA 5F3RA 3RVDA 4GZ6A 5C9ZA 3OJWA 4MRRA 1J21A 4NDZA 2Z9BA 2I87A 3GPIA 2JZNA 3GEIA 1C8LA 3AHIA 5B2EA 4YEDA 1QCZA 4QASA 3RC7A 2OHXA 1FW8A 3PWSA 1ZH8A 5IK2D 3TL2A 3CUWA 1GPDG 1UMBA 2OORC 3PQCA 4JN6B 4C2AA 2R48A 1Z7YA 4NFSA 1FUUA 2FLWA 2CF6A 4LS3A 4UQLA 2IS2A 1E2QA 1ODKA 3I34X 2NM0A 2YFQA 3P20A 3C4JA 1CB0A 2HU8A 3GDGA 3ZD7A 3RC8A 3UV7A 4F4JA 1B0ZA 3G1WA 1M7HA 4RZ2A 5HRUA 1Z2NX 1ZZGA 3JASA 1ZHFA 3L0YA 4LY6A 2RHCA 1T10A 3UJ8A 3EWSA 1Y5RA 3WYEA 3AJAA 1IN4A 1L4HA 1CULC 1Z35A 4KX3A 4CU5A 1G2PA 5D00A 5B7QA 1LX7A 2GYVA 3B20A 5EKTA 3WQHA 3AY3A 1PW7A 1C1HA 3KKPA 2COEA 3AR5A 3H2ZA 3SKYA 1NL3A 4PZYA 5JYCA 4PX3A 1GILA 2P4QA 1V9LA 1PJAA 2JJ8A 2ZI7A 4IKOA 4IYJA 4A2WA 5LQNA 2YQZA 1VHDA 3QU9A 2O7RA 4IRXA 5H68A 3WHLA 2H00A 3U40A 4IGKA 1UKCA 1IIBA 1EG2A 2P6OA 3VMFA 5KTNA 4RY0A 1R12A 3TO5A 5CIYA 1XMQC 3ZCTA 4OO3A 4HOYA 4YBZA 4BE7B 3LCCA 2FPSA 4ON9A 5HCNA 2ZDHA 4LGCA 4BNKA 1U1FA 2FHSA 2HBZA 5F5XA 1U11A 2OBVA 1IUKA 1CV2A 5JASA 4RIGA 5SZKB 2DPHA 2ZYDA 1CJSA 3PJFA 3ECAA 1Q19A 1SRQA 2Q21A 1NT4A 5LZ7A 1DOAA 4G0WA 3E35A 2WJ6A 3A9CA 5HILA 2BKLA 2CXNA 2X6RA 3EFOB 4GKVA 4H7EA 5AWFC 4BFCA 3O8RA 4I1PA 2PGLA 3TQOA 4G41A 4I55A 5JAUA 2WLSA 1J2UA 3K9BA 1X1SA 3GW8A 2PRJA 2QN9A 1Q57A 2XGOA 3KLPX 4BJ1A 4C5AA 4JLMA 2FEXA 2XYRA 4UTRA 5BSEA 1EK0A 5JY6A 2HHHB 4AECA 1Q21A 5FBQB 1TJPB 3I64A 5CB4A 3A4LA 5CIWA 1E7RA 2ZSKA 5G02A 5JAHA 2E8EA 1GKYA 5BN4A 3U0BA 1E0AA 1FFWA 5D5QA 4WCVA 5HGJA 3D6FA 3NHRA 4HX9A 5H3LA 5B1EA 3KFLA 1OX6A 1T0BA 1VHLA 1FTWA 1KKUA 1VC2A 4FDUA 1WW2A 3L41A 2E8FA 3FPCA 3W4IA 1XRNA 1Z6XA 4U1RA 4BIIA 1BJRE 1QTQA 1ZD8A 4NPCA 1D2NA 2ZB7A 5ARCA 4O4LF 3H9CA 1IZ8A 2NUTB 1GTSA 1O9TA 4DUZB 5B30A 4FOLA 1P1HA 3FHJA 4LVOA 3VNUA 4A26A 2E37A 4LTMA 5DSXA 3COWA 2OCIA 2JPDA 2YR0A 1KEVA 3OQNA 1JZTA 3LMKA 1C14A 2X3UA 1TYEB 1W6RA 3I9MA 1DQSA 4QJIA 4BGIA 3OQIA 4D82A 5K9ZA 2XWPA 2YC2C 4WAUA 4FILA 4MWSA 1MHPA 4FC6A 1Z16A 5FI1B 3HI6A 5BN3B 3JATB 5KCZA 1BOFA 4TXLA 3WMEA 3RROA 3ZLVA 1ORHA 4CDNA 4IFIA 3A6GA 4GSYA 5LNK6 3SY8A 5CHEA 2H8GA 1IVYA 1KTIA 3PYXA 5E38A 2QSZA 3P2KA 3RKSA 4KVAA 3PPXA 4RSHA 1W59A 3CWQA 4PRYA 3O8DA 2VBCA 2ERXA 2VK1A 3A70A 1H1LB 1VG8A 1WCXA 3FN4A 4KK3A 1J9EA 5E6SA 1D04A 3ABZA 3MTBA 5AE2A 3TINA 3R09A 3BD8A 2DLDA 3DFKA 3LCMA 4EGCB 2YRXA 1ZEJA 1LPAB 3RS2A 1JE0A 2ZJ6A 2OFPA 3K09C 4RZ3A 3MCVA 1NYEA 3A3PA 4KFCA 4MR7B 3SC6A 1V8ZA 2IXTA 3BCRA 2FVYA 1UMCB 4HY3A 5CLHA 5A9RA 1PFQA 1N75A 4JEUA 4RF4A 5CW2A 1DDIA 2Y9MB 3PTLA 3WL7A 3PQ5A 2O48X 5A62A 2BZ0A 3OM9A 4KP7A 3BS4A 2H4HA 1ZDMA 4FDLA 1OR8A 3DEHA 2XNKA 5L3RA 2FLVA 2GCOA 3F3SA 4EY3A 4UNNA 1L5ZA 1RHJA 2JGJA 2QB5A 4ECEA 4LFCC 3II6X 4GOLD 1Z6AA 1O9BA 2G07A 2EW1A 3T4PA 4CCSA 1X8KA 2PSJA 2ZRGA 3MWJA 4G25A 3T15A 4CV3A 5JNRA 5AVTA 1OI3A 5L8VA 1XNRB 3EIQA 2ZXEA 3K0KA 1NE2A 1NFRA 1X7YB 1I1OA 1ZL2A 3C6MA 3PHLA 4UAUA 1A76A 5MF6A 2BE9A 5AO9A 2X0FA 1HY3A 1KZGB 1EX9A 3PRKE 3S2FA 3G1UA 2GPNA 4FEYA 4G0ZA 4CCYB 3UMYA 4JUAA 4L3WA 2F4NA 4FYXA 1GVHA 3M3DA 2Q4EA 1AG9A 5ICMA 2P4EA 3R3WA 4D46A 2PPVA 1FBNA 5BUZA 2OCDA 2GA8A 5ILOA 3A06A 3K4QA 1NX6A 1NHGA 4O4JF 1C2YA 2D59A 4C3OB 4P35A 1E6EA 4ENSA 4Z4EA 3VU1A 1YS7A 2R8BA 3LC0A 1KVSA 3OX4A 3QITA 2ZUUA 3L8YA 5GV7A 3ESZA 4EH1A 1HGXA 1NONA 2NVUA 3ZGZA 1HETA 4OQDA 5HSGA 2HNBA 1V43A 1BXZA 3AHCA 1ZYUA 1XYYA 2BR5A 4M0PA 5ALRA 2ZWAA 3TCXB 3CLSC 3AKEA 1ESMA 2Z2ZA 1XTBA 3G2JA 5AVJA 4BN4A 1QPBA 4H4CA 1VJ5A 2XODA 3DYVA 4HNGA 4J1TC 3LBYA 2RHMA 1PJ8A 3OJOA 1HFEL 1V5GA 2V4MA 4RJJA 2Q2NA 3ZBUA 4CMGA 1EXVA 4EI2A 4RZXA 3UG7A 4AJEA 5HKBA 2PUBA 2XSZD 4RANA 4XOIA 5BSGA 4R8LA 1TECE 3EBPA 4HGZA 2X76A 3UXHA 5AI6A 2BLLA 5F35A 4EB0A 2MR5A 4F6LA 3SQMA 1NLZA 2O2YA 3M81A 3T3HA 3BQNB 5FUMA 4L74A 3P5SA 1ZOSA 4LXIA 1JR3A 3WFZA 4K9NA 5AIBA 1OX5A 5BV1A 3MCZA 1QCYA 2QN2A 1JEEA 2BEUB 3GD5A 4LRQA 5I9BA 5TGTA 4F9FA 4L76A 2WD7B 5DEIA 5JMOA 3AEUA 4PGMA 2PT7A 3HXLA 1FRVA 2GFQA 3UY4A 1RQ7A 3GRCA 1G60A 3SEZA 1YVDA 1T15A 4C89A 1ECCA 3LP8A 5EKSA 4BQOA 3U4AA 3CKYA 1V1RA 3CVVA 2J7KA 4WX2B 4C4SA 1UEIA 4UBNA 5FL3A 5DP2A 1YF3A 3X2SA 4H9GA 2XDQA 2Z2JA 3NHYA 2WU1A 3WWDA 2A4KA 4BNIA 3FTEA 5LOVA 2O3SA 3F6SA 2C5FA 5J2UF 1NMEA 4GD3Q 4R9UC 3T3NA 3VVLA 3PROC 4WFQA 5DGXA 3G13A 3TRIA 4DN6A 4JJKA 4KDFA 4MTCA 2VUUA 1C3OA 3BFXA 3IIEA 4U39A 4F2HA 1MVOA 4BNWA 4JC4A 1NV9A 1S7GA 1MC8A 1PQWA 4HGYA 4DA7A 1GRCA 4RL6A 3R5FA 1MAVA 4YRSA 1XRQA 1F8YA 4H16A 1D8TA 2I8CA 2HHHC 1ISSA 1GU7A 3LLCA 1AB5A 3B82A 4Q66C 1NXOA 4WOCA 2UZIR 3Q7IA 5TGZA 2CWDA 4UU7A 3E3OA 3ET4A 2Q2WA 1Q14A 4XW2A 3NWEA 2R1ZA 4HP8A 4OOFA 2IZZA 1DCMA 3MJTA 4QTXA 2D2VA 4LE5A 1VMAA 1EFLA 1MC1A 3O93A 2UUCC 3TMYA 3SMVA 3CRW1 3NHUA 5LLDA 3Q8LA 3C98A 4KX5A 1M1NB 2L19A 2P40A 3BN3A 4H7IA 4LCBA 1GJRA 5F4BA 2O2CA 1ZH4A 2P27A 4UU0A 5C5EA 4MUGA 5A2QA 1DTEA 1NKVA 5KPDA 3ESAA 1RKVA 1E1NA 5IAJA 4HYEA 4FJ2A 1BHO1 2CJWB 1BWSA 1EGHA 5KNBH 1GARA 5HS6A 1RQLA 4KGDA 1JLLB 2W8BA 1B8OA 4Q34A 5B6PA 4CWAA 2HQRA 2VRCA 1E3MA 3E3LA 4UHEA 3VGPA 5K4GA 2AH5A 2WTBA 4YRPA 2E4VA 3RWMB 3JQFC 3DHEA 2TECE 3TD9A 1IL0A 4IIDA 4M0FA 3TGPA 5DNAA 1SC9A 1GFWA 1P4AA 1QZZA 5EHGA 1R66A 4D4MA 1BDHA 2ODWA 3V8EA 4N8SA 5DE3A 3EQ9A 3JVDA 1D4ZA 1P77A 1X7HA 3A4NA 1RHMA 2GZHA 2HPAA 4IJ5A 4CMKA 1C8BA 4PPNA 2JIMA 4LYGA 5IXJA 4JB3A 4F8EA 1GDDA 3FUUA 2NLOA 1OJLA 1EBBA 2VWHA 3K0FA 4ID9A 1V6CA 4O6VA 2ONYA 1NSYA 4PGGA 3V8NA 1D2CA 1DAEA 5BSRA 1R1DA 2EJVA 4B7ZA 2ORED 3DQZA 3PHJA 2TRSB 1XNRC 1JZQA 1GXSB 3AUJB 2FPIA 3DOHA 3QJ5A 5IT0A 2ENUA 4WBSA 3IAAA 3KOWA 4P98A 5IAEA 4I8XA 1WZIA 2WWRA 3UEOA 4U7TB 3T34A 4B6RA 4O2AF 2O57A 4OAPA 3JQFA 3GC6A 4K46A 3KSDO 3NUGA 2Q7DA 3SGLA 3TOCA 5CDHA 2XWJI 5JJ5A 3KSBC 3RT1A 3K70B 4K6GA 4WQMA 1N2HA 3LBNA 1DKRA 5C51B 4GMKA 4YAKA 4CFZA 5I3CA 1X74A 3KSUA 1FPQA 3IILA 3P2OA 1PZMA 2JGDA 2W6JA 4C7XA 1YZKA 1U1IA 1Q1GA 1PIWA 3H0CA 1IQUA 2J31A 1AQLA 1TUIA 3Q3GE 1P1CA 4PZEA 4K05A 4YMWA 3FFWA 1GY8A 1GAQA 5JNUA 1WMFA 4AO8A 3BBLA 4XYMA 4ZA2A 5E9WA 5DNUA 1OH7A 1XZBA 1NR5A 3GFSA 1CLEA 1PQUA 2WP0C 4Q37A 5CVJA 4BOYA 2O3TA 3REQA 1M33A 2Z6QA 3EZGA 3FBGA 3D59A 1YAJA 4CYMA 1KSHA 4Y30A 3V6MA 4BWFB 1M2GA 2K2WA 1LBSA 4HWGA 3RC3A 2W2XA 3FNBA 4MV0A 5IBRA 3JWGA 3JYHA 1RXCA 4FXPA 3W2IA 1P9LA 2CE7A 4LSWA 4CV0A 4PCAA 3W5DA 1BU5A 3AL3A 4R2MA 4TYPA 3LZ6A 4K87A 1SM4A 4DQUA 1EX6A 2A0FA 3DC2A 5ITZB 2AGVA 4J4TA 1I9CA 2YJGA 1W4CA 2IVFA 1VI6A 1TMKA 1LK7A 1KERA 1JG4A 4ZLPA 1WCIA 1QTNA 2HFKA 3OIDA 4FCCA 3BG5A 4GW3A 4INPA 4RKEA 4ZD6A 3WIUA 4DJFC 4AS2A 1EIWA 1H8HA 4PZPA 3I6BA 2DHQA 2ODBA 4HDSB 1OHHA 4OJNA 3Q0TA 1BVYF 5K8UA 1C7RA 5JVDA 2PKRA 1KC1A 3H1BA 4XXHA 2QNBA 3DDUA 3BL8A 4I3HA 2XCQA 2QVBA 3O75A 4EJFA 1WB9A 4LOHA 1ZINA 2PZGA 3PHBE 3ZD6A 1ZGAA 2DGDA 1RPAA 1J70A 2I9PA 1CRLA 1GG2A 2C9DA 3OZ7A 4JLPA 1DG9A 3SFTA 2C4MA 3L7BA 2C8VA 3THOA 3U9SA 2YZGA 5FPYA 1M2EA 1MC4A 3THYA 2GZDA 3GLFB 3HYCA 3NZEA 2LE0A 3OFJA 3FRHA 1U7XA 1Z45A 4PO1A 1OREA 4JROA 4TZTA 2W42A 4IJUA 2VJBA 5AKJA 1R4NA 1XAIA 1MB0A 1VHQA 2J09A 2H5JA 2CUTA 4XYBA 2Z6UA 1KQOA 4L4YA 3LCRA 1XMJA 5JXWA