3FCCA

Crystal structure of dlta protein in complex with atp and magnesium
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
504
structure length
500
Chain Sequence
MKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSGPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
publication title Crystal structure of Bacillus cereus D-alanyl carrier protein ligase (DltA) in complex with ATP.
pubmed doi rcsb
source organism Bacillus cereus
total genus 147
structure length 500
sequence length 504
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3fccA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fccA01
5BUSA 4D4IA 4W8OA 2D1SA 4EATA 2D1TA 3DAYA 1LCIA 1PG3A 4RLFA 5E7QA 3PBKA 3A9UA 2P20A 3TSYA 2V7BA 3LNVA 3E53A 3VNQA 2VSQA 5K8FA 4GR5A 4GXRA 4R0MA 3NI2A 3NYRA 1V25A 1ULTA 4RM2A 1BA3A 4LGCA 5BURA 4D4GA 4IR7A 5KYVA 4R1LA 4RMNA 4D57A 4WV3A 5BUQA 5KEIA 3CW9A 1PG4A 2P2FA 1T5HX 4DG8A 3WV4A 5BSMA 5BSWA 2Y4NA 1AMUA 3E7WA 5BSTA 5DWVA 1YJ7A 4RVNA 3ETCA 4RVOA 3VNSA 3T5BA 4ZJZA 3O84A 5BSUA 3R44A 1V26A 5GTDA 1MDBA 3O82A 3KXWA 3IVRA 3VNRA 4FUQA 4GS5A 3RG2A 3IPLA 2QW0X 4D56A 3EQ6A 2D1RA 3QYAA 4G36A 1T5DX 2P2BA 3G7SA 3L8CA 3NYQA 3LAXA 5KYTA 3RIXA 4PZPA 1MDFA 4ISBA 5DV9A 4IZ6A 5D6NA 4OYCA 4M46A 4FUTA 3A9VA 4GR4A 2Y27A 3DHVA 2QVXX 3U16A 3E7XA 3GPCA 4RM3A 4U5YD 4D4HA 3FCEA 1MD9A 3LGXA 3FCCA 2WD9A 2VZEA 2P2MA 5IFIA 3ITEA 3IESA 3IERA 5JRHA 2P2QA 3B7WA 3IEPA 2D1QA 4E5DA 2Y4OA 2P2JA 3T5CA 3O83A 5K85A 3WVNA 3U17A 2QVZX 5BSVA 3DLPX 3WV5A 2QVYX 4R1MA 4RLQA 3CW8X 3T5AA 5BSRA 1RY2A 3C5EA 4G37A 4OXIA 4GXQA 4DG9A
chains in the Genus database with same CATH superfamily
1RWXA 3LNOA 5JZSA 4YRQA 1Q57A 1L7PA 3B78A 1BYIA 3EGIA 3G0OA 1SBCA 1XQXA 3AM5A 3MBOA 4LHVA 3HYRA 1Y4ZA 4GE0A 1F12A 2OD9A 4MYSA 1XA4A 3ILYA 2WFLA 4H6VA 1ZXXA 3ILVA 3SQWA 2VJMB 4AN4A 4DV0B 1QH1A 5FORA 3F5SA 2OBVA 5FTKA 3ETNA 2V5AA 3QFSA 3IOMA 2GD0A 3W06A 1WJGA 3SKYA 1CWUA 2B4TO 3C3JA 4GPTA 3ZGLA 4ERXA 2JKYA 3FSJX 2AWOA 3WADA 1N0UA 3E9ZA 1UWLA 4DL9A 3AI1A 3JVEA 3F8SA 1YGPA 4QBHA 2WMYA 3L07A 2RK6A 1OOEA 4MVYA 1FCJA 5EHZA 5M5BA 4WSOA 2J3IA 2ZZKA 3UK6A 4HB4A 3TLKA 1YHYA 4KQIA 1XZHA 2I03A 2XTAA 4NARA 3O4GA 4EVSA 4J1NA 4UHJA 3PJDA 5K3BA 4NNPA 3ITDA 1AV6A 2I1WA 3Q7PA 2V97A 4OJMX 3JQAA 3IPXA 3KLMX 2VYQA 2CXSA 4I1VA 2XPCA 2CNWD 4IIVA 4WBSA 2W98A 4JYMA 2XHZA 4DZZA 1M66A 3TLAA 4EG0A 1FJXA 2Y6VA 5CIWA 4PGAA 3RYHB 4B74A 2ZTMA 1QO7A 1QLHA 4FOSA 4AI6A 4ZYZA 2IUSA 3ETJA 3PFGA 1J2RA 1V6AA 3BRQA 1DWUA 1F9EA 2GJAA 3GJYA 1Z5ZA 2EXXA 2VWQA 4RKWA 5F5LA 4YRZA 3GYGA 4JI7C 4CQMB 5ELLA 1EJ6A 3JYPA 1KAEA 2I1LA 4ZV4A 5HTOA 3I1IA 3AF6A 4MB2A 1IJKA 2OCXA 5MGBA 3GLRA 1JXQA 2D4AA 2D2IA 2D2VA 3KU1A 5C35A 3EXIA 3B2QA 4I19A 1OFIA 1RQ2A 2AWNA 4DBLC 3FUUA 3RAPR 5BXQC 1RMTA 2DR3A 1FFYA 4JXKA 2IX9A 3OM9A 4YJGB 4AIIA 1D4FA 3SQMA 1FMFA 4F56A 2DZDA 5GM1A 1I01A 2G1JA 3FDIA 3UWMA 2XBMA 3F7MA 2XGMA 1MO6A 4TRMA 1PUIA 3MF4A 4YK7A 1QIKA 2VP3A 1EIZA 1ZWLA 2BDEA 3D4IA 4XVRA 4G2TA 1DQZA 1MGOA 2Y9MB 1YBMA 3HVRA 4X6LA 1QYVA 1AUXA 3DAFA 1VL6A 4MPJA 1SJ9A 2F3SA 3GRUA 3LPNA 3RKUA 1I3NA 4H3HB 3AU9A 3ZVMA 4OKNA 5C7IO 3MJFA 1UFQA 2GF9A 4DA7A 4OXKA 2JPDA 4MUIA 1CKEA 1O94D 1W0KD 2F8TA 1XAGA 3NHJA 2RB5A 2YY5A 3NNSA 2DFKB 3Q5EA 2QX9A 3QWAA 3HHEA 2FX2A 3B3GA 5DN6A 5J1TB 4KGXA 3AHCA 2CLLB 4O6VA 5CPFA 3T94A 3ZV7A 4CL8A 5AW2A 1C9KA 1TQ2A 3FCSB 1TFRA 1YQXA 4CXMA 4DR7C 2YZ7A 4JJFA 1LD3A 5AJYA 4R9UC 3COJA 4HAWA 5JMWA 4MDFA 4JA0A 2UXBC 1QQ7A 2BLNA 4F5WA 2CBXA 3JQCA 4ZDIA 4NECA 1G42A 5LBIA 3W5CA 5CFLA 1T1JA 3L4EA 2HFKA 5A0FA 3UC5A 1G2PA 2E6UX 2FE1A 3DFIA 5KYXB 2OBYA 3AFMA 4Z6KA 5E4FA 2P4UA 1ZI8A 3FPFA 1KS2A 3QEKA 4R4JA 3CX4A 3EC1A 3TK1A 3VYUB 4KGDA 2W6CX 4N0MA 1YU6A 2RIPA 2GFIA 1SKUA 4M60A 2DERA 1NQUA 4I9NA 3HABA 2DBQA 4WDRA 3RHFA 2E5WA 4PN7A 2O54A 1DAHA 3GGJA 3I9NA 3W7AA 1NTOA 4PIMA 5CH8A 5IYZF 4C88A 1NNSA 1N6HA 1YR6A 3KPJA 4U7HA 2BFWA 3JYOA 2VKQA 5DOZA 2HF2A 2OBFA 4P7BA 1O97C 1U0HC 3C3PA 2JF0A 10MHA 2CMDA 1PGNA 4KTVE 2F1HA 3H83A 4QD3A 4I1YA 2JLUA 3TQRA 3G5LA 2FMUA 2I3GA 3OIGA 2H1WA 2WAMA 3EZYA 3AM3A 2HEGA 2IHTA 3KPYA 2OQVA 5MF6A 2BJVA 2ADOA 1UMDA 2I80A 1VCOA 1SVOA 2CFIA 5EXEA 2I76A 5DTJA 3WNVA 5BPHA 3ANNA 4QELA 3IQHX 5DGCA 5TNXA 3T3PB 5CCEA 1Q0TA 2EEPA 5CZXA 2SHKA 4LC0A 3RYHA 2C9CA 3T9AA 1ZNQO 2C8LA 2FOIA 1YAJA 4QU8A 4WLFA 5I5EA 4ZAYA 3S82A 1AKEA 1Y82A 3FZNA 4O4LA 3SE7A 1G3IA 3E05A 4HNTA 5TSDA 1C4KA 1Y89A 4OXRA 3U6KA 3TBHA 3FOCA 1BWQA 1H8EA 3UN1A 4EUSA 4RIGA 2B2CA 1PWHA 3BD7A 2PANA 4X63A 5CDYA 1U9YA 1IXSB 4YJGA 2IYFA 2AZXA 3LZCA 3QVSA 1A5SB 3BZWA 2E85A 1WUJS 3O84A 1LW6E 1BD3A 3JQBC 4RK0A 1M67A 2JHAA 5TDHA 1J42A 4JJZA 1APBA 3LNCA 2JCSA 1TLLA 4AJKA 4BE7B 3H17A 4DV4C 1VLZA 1CFZA 3M6AA 3C41J 1X1AA 5TE9A 5LYJB 2PZKA 2Y1XA 5JY6A 1GSIA 3R3ZA 3WYDA 4BNMA 1IHDA 4ND4A 5C18A 4CETA 1WXDA 3FKSD 4HXGA 4RMIA 3RWBA 2OSVA 4BGIA 1ZD8A 3QE0A 4MO2A 4URFA 1NR7A 4MR9B 2ENUA 2W43A 2WY2D 3GFSA 4ZDWA 3H1AA 4KXVA 2I8CA 4TRJA 5K6TA 3BE5A 3O8OA 3UAYA 1V16A 5G2OA 2UZ1B 4XQ0A 5DHUA 3BXFA 2IHVA 1QPBA 4G0XA 4RZSA 2XF8A 3N7AA 2EQBA 5DSTA 2A1TR 5ALIA 1WVMA 1R0XA 4WKPA 1IBMB 4JUFA 5F64A 2R68A 1TK3A 1ZG3A 3SHWA 5C7OO 4C04A 2QL6A 4BKOA 2B37A 2AH5A 2PWAA 4MQFB 5AT1A 3NJ8A 3SLKA 4P1ZA 3WYGA 2BTQB 3FB4A 4MINA 5IDXA 3D64A 3GLQA 2L42A 1UOOA 4CKCB 2WB2A 4X84A 3OZXA 4FYKA 3INGA 2FGKA 2CFOA 3NWPA 3OZ7A 2NZYA 3KFVA 4AULA 3LTNC 1CS4C 3KCQA 2ILTA 4IF6A 1EKXA 3KVOA 3CJQA 1CR6A 3P1JA 1OQAA 2JC3A 4L3VA 3ILXA 2FR1A 2GD1O 2RHGB 3WK4A 4YV1A 1B1AA 3ZNNA 3H2TA 3T7TA 3LHFA 4CCYA 2VJKA 3L49A 2O4UX 3AHJA 4JVOA 2GFHA 4Q6BA 5KTMA 3OSUA 3IJEB 1CP3A 2QQEA 2BCGY 3PPWA 1FVXA 2XYRA 1R5OA 4DR6C 2OV1A 4G2NA 4UAJA 1TF5A 3FRJA 2YWJA 4QEZA 1B14A 4QA9A 1NBME 3Q9LA 1RJDA 1SHTX 5DXAA 1EUCB 4DDVA 3B1YA 4YMVA 3E1GA 2V98A 3OKPA 5ALPA 2XODA 3CH5A 4ZV9A 2ZXFA 2MSDB 1A7KA 1OLUB 2O0KA 4B81A 2WWGA 3SYMA 3B60A 2O50A 3UVEA 1SD1A 5KJ6A 2YVQA 4KQMA 2CZQA 4PY2A 3K8ZA 5LKAA 4BVJA 4BKMA 5DM1A 3HA7A 4CL2A 3UZ0A 2HB6A 3HJAA 1OASA 5A06A 4IDPA 1DPFA 1T4GA 2BFBB 1RKVA 5LR6A 2QR5A 1SUDA 3FHLA 3GJ4A 1QK4A 1X9HA 3SC3A 1B26A 1YQ9A 1CUDA 3COSA 3KS9A 2IY9A 4LA4A 3T7SA 2FMHA 3DLTA 1YMVA 4Q48A 4E70A 2XWQA 2I3AA 4UAUA 4CTJA 1M2VA 5B3LA 4B79A 1H2RS 1KEZA 4PBTA 1NBMA 2MTBA 1WW2A 1JDUA 4BQFA 2F4VB 4MGEA 1E3TA 4FSHA 4PC6A 2BJWA 4RVOA 1XQ6A 1SNYA 1J2JA 3QVJA 4WA7A 5LZ2A 1AT1A 5GTDA 5DHSA 1NVBA 1YU9A 3H1BA 1NP6A 3H2SA 5JJ5A 3OFKA 1YCFA 1FMTA 4MWOA 2Q1UA 2UZ1A 4XJSA 5FLEX 4JQSA 5KAPA 1CYDA 1ZY2A 5BW8A 2PR2A 3ADOA 1DKNA 1ZSNA 3R6WA 3NHKA 4WCFC 4UZSA 1U1DA 5DPMA 1P73A 2X2FA 2QVGA 3C6KA 3Q8KA 3VDNB 3I62A 2WPDD 5G0VA 4MQFA 4DLAA 4UTNA 1HSOA 3WL5A 2YZ2A 3CBGA 4B4KA 4C03A 3UK1A 4NZZA 5JJCA 3BERA 2HIMA 4CKCA 1RFLA 3COPA 3DCIA 4PLTA 1E1DA 1KQOA 2UUBC 1C3OB 1CLEA 1MNAA 1V8DA 2BH1X 1Z5PA 2QY6A 2W2XA 4HB3A 4BBYA 4F8EA 3L1KA 4AIRA 2QTNA 1R6UA 5KOHA 5LMUB 4XIGS 1TAUA 4F6LA 4IDQA 2ZBQA 3OU6A 2N1BA 1CEYA 1RPNA 4QULA 5DCUA 1C1XA 2BMAA 1JWBB 4U9HS 5AQEA 1PZFA 4AJ4A 1R2QA 4ZI5A 3JVDA 4E5KA 1CPYA 5DSXA 4RLSA 1O0SA 4X1YB 3CG0A 3ICVA 5ICCA 3A2KA 5T4BA 4LMPA 3CNEA 3M5CA 4PSVA 4DJFC 5DGTA 1RC0A 5CDUA 4QDTA 4IGKA 1GUFA 1ATIA 4AO8A 2I3ZA 4Q4AA 5FWNA 4P54A 2GXQA 3MHTA 4LFBB 2ZYRA 2B8WA 4RHCA 5KNLA 3TVDA 1L5GB 3IC5A 3ENWA 4I36A 3RS4A 2H07A 3OMWA 2I6UA 3U3ZA 3Q7IA 1KDOA 1X87A 2DOKA 2H63A 4R8MA 3T9BA 2A78A 2H8KA 1S89A 2P4QA 1GUBA 3ETGA 3OEEA 4E5UA 3NBFA 4KXMA 3L1JA 2D62A 1EUCA 3QLVA 1E94E 3BFVA 4M9UA 4QU9A 5M2QA 5JZMA 2KLHA 1U0SY 3ZW9A 2V1UA 3BN3A 2QDXA 3RRMA 2V3CC 2O2DA 4LWZA 4PZUA 1SGWA 3PYLA 1RMQA 1OLUA 5HGJA 3R5KA 1BVYF 2YWHA 4HY3A 4E08A 5AW7A 5AHOA 1L4NA 2XXAA 1CR0A 1NFRA 2Q7XA 4P81A 1DIBA 4P82A 2BWJA 5EFOA 5KO2A 2Z08A 4UHBA 1V6CA 5IVPA 1U7PA 1CY2A 2JLQA 4QL3A 1G64A 5ALEA 4GF5A 3T8YA 1JFSA 2DLCX 3WIDA 4QHTA 3F47A 2BFBA 2ARKA 3KJNA 2E7ZA 2EFJA 4IWXA 4X3OA 4Y2JA 1C9MA 2BUAA 5H9UA 3TW6A 4L0MA 5EMLA 4DFDA 1H22A 2ZULA 2OCPA 1JALA 1NXWA 3BGSA 1BU5A 3C7DB 2D5AA 4U0KA 4U2GA 5EJ2A 4G8CA 3BWMA 2OD2A 1P4JA 4IUYA 2GZ2A 1FXSA 4V0OA 2B1RA 1XB2A 3PQ5A 4MW6A 3RHZA 3TAUA 3ZI7A 1QIDA 3QBVA 4YUZA 5SY4A 4QVIA 2W9XA 3KOOA 3L8HA 1W1WA 3PNMA 4YJFA 3D8HA 3R4CA 3VZBA 4KPYA 1P80A 1V47A 5HOQA 5JPCA 2RGRA 3KC2A 3WLPA 3EFOB 2QE7D 2GS9A 4GYWA 3RDPA 2WBLC 1DU4A 3HU2A 4ENVA 5BSMA 1WULS 2C2KA 3LXXA 1XTUA 3O93A 4A0QA 4CMAA 1U7TA 1YB7A 2ZRQA 3PSHA 1H65A 3THYB 2ID4A 3A37A 3VH4A 4CF3A 3WOHA 4B3JA 1HT3A 3ABOB 2DJ5A 2IKQA 1SZCA 3DVSX 2VYFA 3GRYA 4NMMA 1XRMA 1MVNA 2HK7A 3DO6A 4P34A 5EHXA 4ZTBA 3SJAA 2X76A 3E61A 3GARA 1CUVA 1CZRA 1M6WA 2PYZA 3IHTA 3O8LA 4LMAA 4QXAA 1OI7A 1EZZA 4DJ5X 1MDBA 2QI9C 4OQZA 3I30X 2CWWA 8ADHA 3FVRA 3HJHA 4JLMA 1MLDA 3KRTA 3SQLA 4RJTA 3DCNA 3IELA 5DTIA 3EQ6A 1W49A 4QAQA 3ZPXA 2WAAA 4JH0A 2LIPA 3UAZA 1Y7LA 4IIXA 3DF7A 1FUUA 3UPUA 1C9NA 5LXTB 2ZT6A 1OR8A 1WNTA 2J9ZB 1C3OA 4HTFA 1H2WA 3PSAA 4G65A 5KWSA 5NLLA 3QBEA 3V6MA 5L7WA 1KPGA 2DWCA 2H4XA 1EDDA 2IXFA 1CBUA 2QTLA 2YIDA 3FGNA 3OE4A 4R3NA 2IW3A 4U1RA 1I36A 1ICIA 1WZNA 2X13A 4FFBB 4FXOA 4MAFA 3ZWCA 5BR1A 4V2UA 3RYCB 3VU8A 3A6LA 2VHEA 3C3EA 3R24A 5BSKA 3I6ZA 4P3PA 5KSWB 5J1SB 3V3TA 3KUXA 1NNI1 2VTEA 5K0ZA 2UYQA 2ZWMA 1LRKA 1FL9A 2G9RA 5BUCA 3EW9A 5JADA 2IA5A 2BFNA 1F8UA 1KOJA 3QI2A 2CZCA 1R0ZA 4YRGA 1RBMA 1KY4A 4LK3A 4RULA 1QH8B 4HB0A 2WE8A 3E22B 4JLVA 3QNWA 4BPRA 1AN0A 2AFVA 2WSBA 4K6FA 4I3HA 4P0TA 3GR6A 4FTFA 3DMTA 1VE9A 2MSNA 2ZRFA 1GUAA 2VKTA 3DDWA 3VNUA 4NL4H 4RPIA 2XZPA 2EQ5A 1NLUA 4JSTA 4XE5A 3RSOA 2EZTA 2WJWA 2BFFB 3I08A 4FKBA 2QAJA 4HVTA 1QV9A 1LA2A 1RVV1 3ICCA 3FDZA 1GEEA 1PJZA 3OY2A 2P2DA 4FSXA 3VPSA 3BF7A 1IWPB 2I54A 1V60A 3C0KA 3BGOS 3FR7A 3GW8A 1QWOA 3KB8A 3GD5A 2V6JA 1XTVA 4OBXA 2A1UB 4U2BA 3NONA 4XUGB 2JRLA 3WXMA 2YWXA 5IHXA 2PT6A 4B84A 1FFSA 1O6BA 1Z0DA 2I2AA 1MW9X 1ZMBA 4KPFC 1WP9A 3RB8A 2EG9A 1UM9B 2JAWA 1L5ZA 3E2MA 3NTQA 4N3NA 2FPPB 3RKSA 1PFWA 3I9LA 4GUAA 3LNVA 1RQXA 2F43A 2X6TA 1PZGA 1U6IA 4WOPA 1E2PA 4H08A 2WB4A 3T95A 3EX7C 1I0IA 3U4AA 4OFZA 4BQSA 3M49A 5DX0A 3ELYA 4BAUA 3PDUA 5KX5B 3EFOA 3GMDA 2IK8A 2I7DA 2I4IA 4UVEA 5IT4A 1NL3A 4BMZA 4Z1MD 2ZUFA 3THYA 3BRSA 3BAFA 2Q7DA 4E1AA 2V7EA 4L7QA 4FIDA 3MT8A 2CNDA 4OCZA 1FTGA 1L1QA 4MVJG 4HGZA 4BNFA 1NXXA 3GK3A 4Z2YA 2D7DA 3PR1A 1BE0A 1DARA 1PJCA 1SUAA 5BSWA 3VHXA 1NV9A 2Z9BA 1QVRA 4WZZA 1WKCA 2QTRA 3M1YA 2R4UA 3SZOA 3WB0A 3W3AA 3JASA 2IPOA 4HQKA 4GPBA 1K7FB 3GCDA 4A5SA 3ZD9A 1F4PA 2FRDC 1AK1A 2ZJOA 3L06A 3L0SA 2HBYA 3V80A 3RYTC 2YQZA 2J9RA 1CUJA 4V0NA 4WL0A 5JECA 3GL9A 5LXTA 1SBTA 2C0PA 2Q5JA 2R7LA 3H0CA 4XGKA 1ADCA 1BWPA 4FFWA 2C7GA 621PA 4I14A 5A7GA 3H1PA 4YP6A 4FFBA 3D3NA 4A82A 2D1RA 3OE1A 4ZIRB 4L78A 4BO4A 3RYCA 1Z15A 1G2IA 1PEDA 3DUFB 3GBPA 1C30A 4N5DA 2YMLA 2VF7A 1CJSA 3SJZA 3I64A 2FPGB 1JEDA 4RNCA 2NYRA 3SDZA 2ZBFA 3SFVA 3L95X 1JG1A 3Q3VA 2AS0A 4IDEA 1HDYA 3E8MA 1DPGA 4B46A 4GECA 3UUWA 1LQ2A 4JL8A 4B4UA 1HTWA 1JT9A 3RUFA 4V1CI 1TUEA 4ZPJA 1LGYA 1SQ0A 2G1UA 4F3NA 2QVXX 2P1ZA 2DPGA 2XUQA 2SECE 1J9GA 4EY3A 3HG7A 4U5YD 3FOFC 4D3XA 4OATA 4KTTA 1OFVA 4PEVA 6YASA 4P80A 1EX1A 5LLSA 4ZT3A 3G8YA 5EJ8A 1L7XA 4GQBA 1X7ZA 2NZ2A 4UREA 5K20A 1N25A 2GEUA 2O20A 1AHNA 2NYUA 5KB3A 4QTYA 1ZU5A 2QTBA 2VK4A 4ZVLA 2VHCA 1VYUA 2RG1A 2VYND 4OUDA 2QMOA 1XELA 4QQ8A 1PJ8A 4TV8B 2YHIB 1GNQA 1G8PA 2BM9A 2H1OA 5CJPA 5JZBA 1JTEA 1XA3A 1QJ4A 2JAPA 4TRNA 1O03A 1FFWA 1K89A 1U1FA 2OLJA 1T4CB 2O8CB 2TSYB 1TC1A 2WWIA 1JJFA 2IOQA 2R8RA 3HCRA 3CVOA 2OWDA 1SUEA 3BZUA 3K9LA 4L1KA 2A1UA 1WWKA 2H0QA 4KYUA 4PICA 2Y1KA 4RA6B 3HDYA 4RH0A 4EJSB 4A36A 3IPRA 2A86A 4S1TA 3OZGA 2VJDA 1KC3A 1L7DA 4BTEA 1UM9A 1VPEA 4OPMA 3RGGA 4IJKA 1PIWA 1TIKA 2X7JA 3DD1A 5EXDA 2WHPB 1VP3A 1HR0B 4BMNA 5B6IA 5T57A 4BU0A 4EY5A 5ADHA 5HUHA 1MC5A 4H1VA 4G9GA 5IFLA 2C84A 1L4FA 1Z56C 3CWQA 2MCQA 2G0NA 3IE2A 2VP6A 5BW6B 3DE4X 4MICA 3ULKA 1G8FA 4HDSA 4YV0A 4YRKA 5K8FA 4LGVA 3UJ9A 3AGQA 3CJTA 1U98A 4GT1A 4MWDA 1H0SA 2C3PA 2WTNA 4C07A 5KOYA 1NDHA 5IFKA 2B78A 1U0TA 5I4IA 1ONSA 2P3LA 5HZKA 1U2TA 1ZH4A 2IS2A 4Y6SA 1BA3A 3ANXA 3HUDA 1IM2A 5HKOA 4LF4B 1ONBA 3F4BA 4HEA1 2QBYB 4RZIA 1RPTA 3VRHA 4LE2A 3SZMA 1E9FA 3JWGA 1NUAA 3A6JA 2Z57A 3ODPA 3EF3A 2I2XB 3NP7A 3T34A 1PSWA 4IINA 4BJ6A 2UVDA 3S28A 1N8KA 1QUFA 1O94C 1SZDA 1VIMA 1N77A 1QQAA 3SIRA 2XECA 1NW5A 5F9FA 4B8ZA 4DV7C 3DMYA 1KEKA 4N12A 1V2GA 4B6GA 3U4HA 3LXMA 3TXAA 3IX7A 2PL9A 3C45A 2ZAOA 2OLKA 2WA2A 4OGWA 4Q9NA 4XJVA 3TI9A 3W8DA 4F4JA 3RRNA 4HNAA 1QBKC 2I22A 1I30A 3RLFA 1RWWA 1N5JA 1JH9A 2WOOA 1I1HA 1IQ0A 2NIPA 3SEFA 5EYPB 1DSSG 4QX6A 2R7AA 5AVQA 1Z34A 2TECE 4Z49A 3IL2A 4G36A 2Y1LA 4P3YA 1CQIB 2AV6A 2HHLA 2J7PA 5EE3A 3VZSA 2AJLI 2VBCA 4GQAA 1AV7A 1U2DC 3PFKA 1JEQB 2J6BA 3LQFA 4I4CA 3AUFA 3F6CA 3VUEA 4FT2A 1K86A 2H1VA 1BU8A 3IEUA 4JJEA 1AGRA 4UFNA 2VPQA 4XWYA 3A9VA 4KLZA 4MEJA 1KAQA 3NT4A 2H1IA 3L8FA 3OAAD 4QECA 1DC6A 3NBUA 3DVQX 4TV8A 2OESA 3VKUA 4OYHA 4PLZA 5HMMA 4EKDA 4YBRA 1Y5LA 1UL1X 2XMCA 4FYHA 1C9EA 2V6FA 4EUHA 1Y4AE 1V5FA 3F5DA 3IXQA 3OLXA 4DTCA 4Y2UA 1T9GS 3IA7A 1A04A 4DR1C 4TUYB 4PS1A 1SBYA 2LV8A 2YFYA 1JDPA 1SKBA 3PNKA 2PAAA 2DPHA 2ZTUA 1FFHA 4HPJB 1QSGA 5LXTF 5B3KA 2VF5X 4EJSA 2WKWA 3G9XA 3JWEA 1WXXA 4IFTA 3I6QA 4IHAA 5FHRA 1V96A 4ANFA 1ZJ6A 2ATCA 1V41E 1EX6A 1LK0A 1OU0A 2EFHB 3V2HA 1NPTO 4YT2A 2IEAA 5DU2A 4FJ1A 3ZHQA 2QW1A 2JJ1D 3NHLA 2CL7X 3OX1A 1JW9B 1XT6A 1VZ3A 1MH1A 2AMVA 2JEYA 3LHDA 3IQWA 1TJ4A 2GJ4A 3Q7SA 4P36A 3T1OA 4HUJA 1WF3A 2WHEA 3AW8A 1MXFA 5ECWA 3TQCA 3ET5A 5TVKA 4UBIA 2IUTA 3EEQA 2WYHA 2QW8A 9LDBA 5K45A 1W8DA 3O90A 1OYYA 4K8OA 4KYIB 1Q17A 2PN1A 4IIUA 3UIEA 1RMYA 2JNVA 3P0FA 1RSZA 5FDFA 2ZJ3A 4DWJA 3O3NB 4QHSA 4EECA 3A0UA 2XA1A 3FHCB 4EWLA 3P2KA 3KJEA 1CJBA 1ZJZA 3A1SA 4WEOA 1USPB 4BDTA 3PFCA 4PN3A 5AW1A 2X6QA 2AQHA 1K98A 1Z07A 2REXB 2XUZA 2PSJA 1R88A 4XB2A 3T9FA 1E2KA 1XU9A 3UY4A 5LD2B 3EGOA 2NQTA 1L5MA 2IEZA 1ND6A 4ZYUA 3TUZC 2IQ5A 4NHOA 3LLCA 1KERA 4WN9A 3DOOA 1RXWA 4NK5A 2WWWA 5DP2A 2C7OA 4DT1B 4ACAA 2AXQA 2AQ8A 2CJFA 4J1SA 2RCNA 1NY6A 1EM8B 2O52A 1I2CA 3NB0A 4M8LA 3H6KA 5E9QA 2VT6A 2AMLA 2PK3A 1KK2A 3I92A 2OHHA 3PXGA 4UMFA 1IEVA 5JARA 1U8YA 2GHIA 4IG4A 4L8VA 1K66A 3YASA 5E38A 3UAWA 4A2QA 3Q0EA 1GFWA 3CRRA 4H4EA 4K0KB 3V8EA 3IDZA 1DDGA 3MTEA 5EYPA 5KX5F 4DVJA 3OSZA 3H9EO 3K71B 4FCVA 2A9PA 2XNDA 5JR3A 2PHZA 5TMBA 1MP0A 1JEQA 5EA2A 1GCUA 1Z6AA 4EIWA 4R41A 2ZJFA 4KQCA 3SYTA 4H4DA 3P9PA 2DWOA 1ZLXA 2YJGA 3L6RA 4KIUA 5EGSA 3PICA 5DYGA 4D56A 1NPDA 4HC4A 4V3BA 221PA 4H18A 3C14C 4R0NA 1KAGA 1N6RA 1X38A 2HWWA 5DWQA 1E96A 4BWYA 1TA4A 2JCVA 5ITZB 1W5FA 3E18A 3HDJA 3A10A 1GITA 1VKHA 3QEOA 3HDGA 5AKXA 4ZHQB 1Q1EA 4O8ZA 4ZP1A 3KD2A 3KHTA 4JBYA 5TIIA 3THSA 1WU8A 4Y0NA 1ZW6A 1Z7BA 3TDNA 3WAGA 3TR0A 1VL8A 1B8OA 4TUYA 4QUGA 3W5DA 3BWEA 2DQYA 3HVHA 1B74A 2R2AA 3JSAA 3K96A 1GN8A 2BN4A 2IY8A 1C8LA 2XE6A 3ZE9A 3THOA 3ZNQA 3G9UA 5FL7D 2VYCA 1MV5A 3EN0A 4B34A 5B57C 2PWBA 1SHKA 1PNOA 1YZLA 5EJAA 4HDNB 5K2OA 2FR0A 3UX2A 1F0NA 4J1TC 3EGXB 3JWJA 2XCRB 2FMKA 1G6Q1 1ES9A 3BIWA 1KQFA 3EXEB 2CCJA 2O2IA 4ID3A 3K92A 5ERGB 1ISSA 1GADO 1W2GA 1JAZA 3DF9A 5EN4A 3TRDA 1XNQC 1K27A 1HXHA 3ANLA 1H5NA 2QUKA 3OHSX 3PT5A 1VLAA 4RVUA 1JILA 3BILA 2F62A 1OVGA 2IPNA 3D8BA 1J20A 3PF9A 4OFWA 3RUPA 3IDAA 2WUDA 4IKPA 4NSNA 2FPSA 3IJPA 2JZNA 5AE3A 3MCUA 3FOBA 4JFAA 4MYDA 3ZX4A 4UPVA 3WISA 2F9LA 2GZAA 1E77A 5JCOA 2I7VA 4V0LA 2QRZA 2WIDA 2PXCA 1G6OA 3Q1KA 2FMTA 2FDCA 1G17A 1P3DA 2DTEA 4KQWA 3VOTA 3L82B 2G9ZA 4YCSA 1A8IA 1X13A 5I7HA 4DNQA 4ZAZA 2ZYIA 4HMOA 2FW9A 5HHTA 2F3RA 1R3DA 4UOZA 5AW5A 4TV8F 2RC5A 4LDPA 1RVDA 2C4UA 1VHWA 2HREA 3DAPA 3HADA 4ZO9A 1XU4A 3A70A 1LDBA 4WT7A 4BASA 1RXEA 4CTKA 1ZRHA 3E9NA 2Y93A 4EG5A 4TM7A 5KC9A 3U44B 3O4HA 3OX2A 4OOEA 5B55A 1WP4A 2IZ7A 5FUQA 3PHCA 1WDMA 4MUJA 4TZKA 4DT1A 4WNCA 4KVFA 5KVSA 4TWJA 2C2ZA 3C3XA 1MUUA 2X1HA 2W2OA 3UWKA 3VYSB 1JZSA 1AUOA 3WGUA 5BQXA 3HJFA 3BMXA 2JJ2D 5I5GA 1ZUD1 3VC3A 5KWVA 4R9NA 3DZFA 4AXBA 5JW6A 1WZUA 4TN1A 4B4DA 4DV6B 1G2QA 3TIXB 4KHPC 4UCXA 4F9FA 4FHZA 4RPHA 3RWOA 1HT1E 4YN3A 4Q7LA 1GYPA 1O3YA 4EP1A 4EHIA 2HN9A 2H1RA 2OHGA 2RCYA 5KIAA 2ZWIA 2H2HA 2PSDA 4FGZA 5GONA 3V6LA 3V4LA 2N47A 3ZNOA 4BC0A 1MENA 2OVBA 4D9JA 4LYFA 4KR7A 3U39A 5KVCA 2H06A 2ZGVA 1PU2A 3WGIA 1J5EC 1HKUA 3EVCA 3GPDG 3PFIA 5ICMA 1SXHA 2EAUA 4LRTB 5LU9A 3N6RA 3AHFA 4MGIR 3FPEA 5D1HA 1H2FA 1ZUWA 2ZR0A 4TXMA 4Y2QA 4O2BB 3H5NA 4ZHQA 2UXCB 5D1NA 5BWNA 1C9DB 4FFMA 3GNSA 4RZ3A 2O5VA 2C77A 4CCSA 4W5OA 1GL7A 1AGPA 4BBAA 3GRZA 2G63A 1LBEA 1JLLB 1LF0A 2EWWA 2Y1GA 3M6IA 2C2YA 3DR5A 2D59A 2E18A 5HS6A 4Z7JA 4Q93A 1KI1A 2A6PA 2F3QA 4GM0A 2QE6A 4PZPA 1O96A 3EVTA 3KQVA 3QA9A 5JC8A 1YRLA 1Z2NX 3SC6A 2BFDB 2G82A 1KK1A 4K81B 2PQMA 1XMQC 3EGXA 2Z51A 2XCOA 4E2XA 3DWEX 2YASA 5CK4A 3EXEA 4JT2A 5A04A 3OJEA 1YO6A 1HDXA 1HMYA 3A2MA 4ALNA 4YP1A 3KKEA 2UZAA 2OO3A 3EZFA 5LOVB 1H2EA 1XTJA 4P35A 3U5ZB 421PA 1TDJA 2E82A 4U2DA 4F45A 2WK1A 2GEKA 2X8BA 2E9SA 2L19A 2ONYA 3C5HA 5EINA 2RHOA 1UJBA 3GEIA 3EIOA 4ROSA 4OLJA 4UUOA 5F77A 3LRPA 3KQHA 1M33A 4ARAA 3SHTA 3PVCA 2GPTA 2WYUA 2AX4A 1I3OA 2D8AA 3FPBA 3NV9A 3SM3A 4XYMA 1SA0B 2B2XA 2FPIB 4NP6A 5DLEA 1QAMA 4DQLA 1G5TA 4IDOA 5KDLA 4V0QA 3SBXA 2I33A 2O9JA 3QJYA 2VDOB 3UHOA 2X4DA 3FLAA 4CGYA 4P3NA 3ZD6A 2QN9A 1U9ZA 2BTOA 1DO0A 1ZJWA 3S44A 2VPWA 4DLZA 4KAJA 4HMQA 3ZVLA 4MH4A 4BRUA 1KO4A 3FMOB 1N2JA 1EG2A 4GFDA 4CIVA 2V5VA 1P7WA 7MDHA 1Z4LA 3U44A 5IS2A 3DMGA 1J0CA 4TUYF 1GNPA 2R1ZA 3VR5D 1MA3A 2DH6A 3W5HA 4EFKA 3RODA 3HFJA 1IM8A 4EG1A 1M8FA 1Z06A 4K6KA 1BS9A 2BF4A 2ZTHA 1PS9A 1RRVA 1QFXA 3A31A 4JOSA 4L6IA 2QGZA 1W581 4FM9A 1HDRA 2VXOA 2XBLA 2D4HA 1YSCA 1ZVKA 2E1RA 4CM9A 1MVLA 3F1LA 3AUYA 2X7HA 2FW7A 2HT6A 2BGNA 2XVZA 5E7IA 1KOFA 3OKFA 5G1PA 1FSPA 3G2QA 3CRMA 5HTKA 1G7TA 2GN2A 5ALZA 2YXNA 3E53A 2PRSA 5FV4A 3O47A 2YV1A 3C3AA 2QKYA 1Y9AA 1G3MA 5TV2A 5JBNA 5F4ZA 2BL4A 3M89A 4RGBA 1J8FA 3DZDA 3OJLA 1E3JA 1QZUA 4KV9A 1RYEA 1T36B 2OM2A 3ROXA 3FZYA 1R6VA 4FOLA 4MRAA 3A4NA 1CB7A 1L1EA 4A8TA 1Y7HA 3ZDAA 4REQA 2AJDA 1TW3A 4PU0A 1EUDB 2BHSA 3MWDA 1O95C 2FRVA 1QK5A 3DXXA 1N2OA 4GGOA 5EWJB 1ODJA 3WLAA 1BRMA 1L8QA 1XZFA 2X0EA 1SWWA 3N39C 5CNKA 4OMUA 4QICA 1JDJA 1L7OA 1OY1A 3A06A 3GJTA 2WHYA 4R1TA 2JGEA 3WYFA 3WFZA 3GT0A 4QLOA 3HKCB 5CT9A 2XCIA 2B3DA 3NNNA 3EPPA 3QEMA 4ZO6A 1N0HA 1QORA 4A0RA 2FPXA 1HYGA 5CG2A 2YXEA 3FTPA 1VIVA 2EWMA 2P5YA 4GL4A 3T5BA 4JELA 4IMJB 2QRGA 4BVAA 4UKDA 2IUYA 3KTOA 1IY8A 3WGMA 5F2NA 4RZQA 2XRMA 4CBVA 1JLKA 1DADA 4FX5A 4LK2A 4MUKA 4Y7CA 3PE6A 2BFDA 1EFAA 2BGUA 4C7VA 2HD4A 1NVVQ 2XQFA 4Z4HA 3GLVA 4B2IA 1GSOA 1ZN7A 2YYAA 4G09A 1Z4OA 3QUAA 5E4YA 2QXYA 2E0IA 2EZ9A 4AJEA 5BW5A 1PSZA 4PPQA 1IJEA 2HWXA 4AYTA 3VC1A 2XTNA 1JLHA 1BMFA 4M3NA 5U1PA 5LOVA 3HSYA 4C0WA 1UFRA 1TRHA 1HE4A 2I4OA 4BQIA 1N34B 1JI3A 4K28A 4UOEA 4L4ZA 1KZGB 3EFHA 3PXUA 2JL1A 1ZB8A 1DLJA 1J8DA 3BWBA 1RXIA 1G20B 3NBAA 3WICA 1XMOB 4CNBA 2WSLA 2WF9A 1RAEA 1NP3A 1P4AA 1SA0A 1IB0A 4WECA 3S8MA 2OYSA 1AQUA 3PVZA 3VR6D 4I5EA 1R74A 5WRFA 4TLAA 4Y30A 4OXYA 1LPOA 2ID8A 3K8QA 4QRHA 5DGDA 1HNWB 3RGWS 1PS8A 3C97A 3MAAC 3QX7A 5DIZA 4CM8A 4CL0A 4ZHQF 3AETA 4IIHA 2NO0A 3OA2A 1IY2A 1Z0ZA 4A15A 2BUBA 5ESWA 1CNEA 2XEDA 1D6MA 3K1JA 5EHQA 3DZBA 2PZ8A 4W82A 5JSUA 4ZGGA 5LBTA 4Q01A 5EOVA 3O2SB 2BKUA 4E22A 4PSAA 4EGQA 4K6CA 5CH5A 3E4CA 2CBZA 1L1FA 2FOXA 4KLCA 1CC1S 1YQGA 4CMCA 3UATA 4C2BA 1X1CA 3C5EA 2AZ4A 3OJXA 5D00A 3HCCA 4HS4A 1NZDA 5IK2A 4KG7A 3GRVA 4YRPA 3AUUA 2D5BA 5EE1A 3TDMA 4CIWA 5T8TA 1TJPB 1VRVA 1RLMA 3R8CA 2P6UA 2D28C 3BQNB 3ZE2B 4CMBA 2WA1A 2PE5A 3AF5A 1UKAA 3QKRB 3P2MA 4GI2A 1IH8A 1SM4A 4F4UA 2NTEA 5LZ4A 1VG0B 2H8GA 3MINA 1TEXA 1T36A 4GI7A 5C1DA 1NATA 4WH0A 4WOKA 1XR3A 1VB5A 2KYRA 3RAFC 2PBFA 2PZGA 5IABA 4G0YA 3NDRA 1EUDA 3IRVA 4ZARA 3WKAA 2WFAA 1Y3FE 1EHCA 5JS8A 2R00A 3BMCB 1CIJA 1HPLA 2EKZA 2RHDA 4M8IA 1OXUA 1SCIA 4N54A 4J0IA 4YJDA 4B09A 4NBSA 5BYAA 5JI2E 2WABA 1L9XA 3M6XA 3WSWA 5KZMB 4LBYA 1S7GA 1Z5VA 4EYGA 3TZKA 2VNHA 5ENDA 1AXGA 4D02A 3RBZA 3SC4A 1WMSA 2VJPA 1N5IA 4HOYA 1J8MF 5CYGA 1M7HA 4K40A 3KSBC 5A3JA 3BH6A 1C81A 5FUMA 1UMBB 4LYEA 4QDKA 2SKCA 5EIXA 5DBGA 4NHEA 3VC2A 2BMJA 3LG2A 5IDWA 4NBTA 1FUKA 5EMJA 4ZOBA 1HM5A 4N5HX 4MWBA 5EXSA 4IL5A 4C87A 1ZVVA 4RKFA 7ADHA 4W5RA 1U6KA 2VXYA 4OHPA 1JAHA 4IJWA 1KMHA 2B82A 4IYRA 4B44A 3MJCA 2CU6A 3KOWA 4NG4A 3VDQA 4A1OA 4B2LA 3R0IA 2ZBPA 4BCDA 1DKRA 1KL7A 4TT8A 5K3FB 4IGEA 5JYDA 3AF0A 1RDFA 4JJ8A 3LP8A 3UBMA 1J39A 2ODWA 2AMJA 3P2IA 1LI7A 2DHQA 2XUDA 2YINC 3GFGA 4ZKEA 3DG9A 3RS0A 2YV2A 1ZU4A 5BNTA 1NAHA 5JOQA 3QX3A 4KKVA 1BJRE 3A8TA 3R3HA 4RIHA 4ZOLB 1G20A 2AOXA 2QJTA 1CFJA 2I6FA 1KDYA 5DK6A 4ISBA 4JSRA 2NUAA 3SOPA 4B5LA 4AZSA 1MOZA 3NFYA 5HKLA 2GN9A 1IWBB 4DV1C 2B21A 4V1CB 1X1SA 1KJJA 2MR5A 5T8KC 3VNAA 1QV7A 4D0RA 5BMOA 4P53A 3TRJA 1WS6A 1RHMA 3BXGA 4NZNA 2TYSB 1CJVC 1YD7A 4J7CA 4PYNA 4WPGA 1ZA2A 4HDQB 1E2MA 4LJ9A 4EEKA 2FY8A 1BHJA 2OUKA 3AZOA 1GGKA 3R41A 4NAUA 5SYNA 3FOAA 2IGTA 5L8VA 1WKBA 3OFJA 3GIDA 1FS4A 3QVWA 3T4EA 1N3LA 3AEUA 3DTVA 1A9XB 2C31A 2XMRA 3IBTA 3Q72A 1WCJA 5FI0B 2FWRA 1NHGA 4BFLA 1UC9A 3NVDA 4J6EA 1J0DA 3JZFA 4XUDA 1JKIA 3GLGE 1BW9B 4NCXA 2QJOA 2FN4A 4IHQA 3RS2A 3WBJA 3GDHA 2ROQA 3HPQA 3B2EA 1BVUA 4FBMA 1QHEA 3I37X 2AQIA 5JWOA 3KBOA 2XMPA 3HR7A 4H31A 1HMPA 3OUTA 5FL3A 3W2IA 1U6JA 3QKRA 5LOVF 3L4KA 2ZRHA 3D2LA 4TLDA 1MJFA 4UEJA 3IHLA 4L9WA 3B3JA 3A1NA 3VSAA 5DSZA 3RBVA 5AVYA 1FQJA 4KIFA 4WS9A 1QFZA 2QAIA 2G5TA 3PQ3A 4W1PA 3BTVA 3PG5A 1P4SA 1S0UA 2CF6A 3PR2B 1WH9A 3O4FA 4OYYA 4RQBA 4F2HA 1DVRA 5CDSA 1U94A 3BMCA 3I9JA 2FW6A 4AQYC 2JZCA 3ACCA 3LT4A 3QH4A 3UJ3X 4L8FA 1EZ4A 5ALOA 4BO0A 4MA5A 4IICA 1MJGA 1K06A 2J33A 3IP7A 3DW1X 3PQ8A 1ZHOA 4WJZA 1ZOSA 4QT0A 4ZVKA 2R4QA 1IC6A 1PSDA 1NGSA 4PAMA 3GR1A 1GXSB 2CJWA 3EYAA 3HVUA 3GLGA 2EL7A 2EW2A 2PRIA 4JP3A 4R01A 5HJEA 4PG8A 4JEIA 5J40A 5L4NA 3OTOC 4YAOA 3ANSA 3W77A 2IL1A 2NZWA 2DHCA 2B5VA 1Q84A 2GZ3A 1RABA 1BKDR 2VTDA 1Z83A 1ODFA 2HQBA 3K1YA 1P6XA 2JDIA 3KKNA 4S12A 3WDLA 1NMYA 4N18A 5A4KA 1D2GA 3EEYA 1QXSA 3ZHXA 5L95A 1M2OA 1YIDA 4OHFA 4K9DA 4PQEA 2XZLA 1OAKA 4QBGB 5A5DA 3Q9UA 4ARVA 3G2JA 3WWZA 1U1CA 3GP8A 1HE2A 1FS6A 1ZZGA 1VLVA 4B83A 1MC4A 1TFUA 1YHZA 4UNNA 1Y3IA 1A96A 1X3LA 2UUOA 4TLMB 5K3FA 2Y9PB 2ODEA 4PCUA 1NRXA 2BFMA 1GCOA 3B9PA 4KI0A 4F3KA 3EDYA 1ANKA 2CK3D 3LE8A 1GM5A 1FNSA 3MMXA 4NTZA 2VTVA 2FFJA 3SI7A 4YJ3B 1A2BA 3LWDA 4ZOLA 4PG7A 4S2UA 1GCAA 2VPTA 3G7NA 3WMWA 4DDMA 1KQNA 1YRHA 2E21A 3GUZA 4OI2A 3DO8A 4DDHA 4HT3B 3D7RA 3LY7A 1CYEA 2QW0X 3A4MA 1Q5PA 4V1CA 2XXBA 1DEKA 1W1IA 1I10A 3ETHA 4OK6A 3ROKA 5ADWA 1HK7A 4M9XA 4XTRA 4H59A 1PL7A 1MO4A 2HPAA 2DECA 4K0RA 4O2RA 4YRJA 2ZWVA 3QW4B 4R81A 2UYHA 1AQNA 4ID9A 4ZVSA 4NYMQ 2HXYA 2EGHA 4N76A 4RAQA 1F2TB 1PJSA 4BZZA 3REFA 2AC2A 1UBUS 2C4HA 3BB4A 3GRRA 4YCMA 2B4KA 1ECLA 3B1VA 4N01A 2AK3A 1ISIA 1NMXA 2QPTA 2RGDA 3PQEA 1K4MA 3M6WA 4JD5A 5HK8A 3QU5A 1USKA 2G09A 4GX5A 5H3HA 5LWQA 1T8YA 5A4IS 2O8BB 3ONDA 4E30A 4ON9A 3ZWQA 1YL6A 1Y8RB 2ZBVA 2P65A 3C1TA 2I1VB 4ND8A 4PAGA 1BHO1 2C2GA 2ISCA 4U7DA 2CFTA 3NHYA 1A8UA 1KI4A 1RZVA 4F38A 4KR0A 1KZYC 2GNPA 1XMIA 3L43A 4H7JA 5E6RA 3H5LA 3HWWA 4CEIB 3VSEA 4Z7OB 3GJRA 3VU1A 3ZBPA 2RIRA 5BQ5A 3T4PA 1VSBA 4Q3OA 1UBRS 3IKLA 3CZ5A 4UDNA 4M0KA 1Y37A 3AUKA 4TQGA 1G0OA 1XJQA 4IH4A 4OHMA 5LQSA 1OXXK 2QTFA 1LBIA 3FPLA 3RC9A 4EGCB 2NTNA 2ERCA 3KAJA 3SS8A 4EGAA 5GV7A 3MRTA 4FX2A 4CGZA 5TMEA 3QWIA 2R5WA 3COZA 3CV3A 4OLAA 1GXSA 1IVNA 4TZ6A 1QZZA 4BEJA 5FLYA 1DAEA 2Y0CA 4GXTA 3V32A 3ZZTA 4ARZB 7AT1A 2HNAA 2E4WA 2WJYA 5IJ0A 2JEOA 3EODA 1KBQA 5JE8A 1F6DA 1OFUX 2OZEA 3M1IA 4PZYA 3KYCB 3GDOA 5U4XA 5JNRA 1XJ5A 4YT4A 2V7BA 1VOTA 3SEQA 2PGLA 4H7FA 2J3HA 1Z39A 4OYRA 3RSLA 3SHVA 3UQYS 5HCUA 3SNHA 4D0GA 2H6EA 4EHJA 4H1TA 2R8OA 3HO1A 1Z16A 2FP3A 5LJIA 3QKUA 2XCQA 3BGDA 1MPTA 1COWD 1TECE 2C9DA 4KXQA 5ALMA 1Y1RA 2R44A 3DV2A 1CZNA 4CQLA 1P9OA 3K1ZA 4XSHA 5KVVA 5LPNA 4B9AA 4JYZA 3UXHA 2M6KA 4FW9A 2YTZA 3W6PA 4ZYVA 1ZI9A 3AUXA 4KLRA 4IDGA 2P78A 3CN7A 1D5WA 3D3EA 4RPJA 4X7BA 4FGSA 4GKBA 5F5XA 2IH5A 1CJTC 1CS0A 1WD7A 4EO4A 2ZB2A 1J22A 1JR3D 9MHTA 3DZKA 1KPHA 1XVLA 1AHHA 5G0UA 1QAQA 1MQ9A 1KH1A 2R6DA 4YRCA 1QF9A 1H85A 2FHPA 3GGCA 1GNVA 1PE0A 1XDBA 4YCBA 1O57A 2H54A 4FDAA 4URVR 2YFKA 5DWDA 3NFRA 4Q7MB 2Y66A 3I45A 1R8XA 2DT5A 5ENZA 4JI5B 1RYMA 4IUCS 1V3TA 3D2CA 1ZBQA 2ILVA 3EJ6A 5L45A 2BY4A 4BWFB 2JIOA 3UMYA 2WTEA 2ZI7A 4ONEA 1ZJ4A 4PX5A 2YWBA 1JIJA 4C0QC 4O4HB 1XLWA 1F2TA 5COQA 4LF8C 3AY3A 4JI2B 1IOWA 1VG8A 4FBGA 4HK4A 4HDKB 4MLZA 4RDIA 3HPRA 4ITUA 4C0JA 4D25A 4AD8A 3CRQA 1FZTA 4MPDA 3L6DA 2NSHA 3FTCA 4RE5A 1M2JA 1D6NA 2AG0A 3O03A 4H15A 1DMSA 1M83A 4I6JA 1BX3A 2DFTA 3GMIA 4OO3A 2ZIWB 4AWXA 4EW3A 1ETUA 3MVEA 2UVPA 1Y8RA 2FUG1 3RAEC 1CZLA 1IB6A 4INPA 4JBGA 4IIJA 4LOHA 1BWSA 4B3XA 3KR2A 4BL5A 1PWEA 1FJGC 2VS1A 3ENNA 4OA8A 5K3DA 5IUJC 3B12A 1LU9A 4B8WA 3GAAA 3AINA 3CF6R 1CY0A 3DL2A 3OQJA 4HLNA 1FLDA 1R8YA 4CEIA 2O1SA 2ZQZA 4U63A 3GLIE 2IS6A 4F8YA 4O2AB 2VDRB 3JQ9C 1J7JA 1MX9A 4ZOLF 1SC6A 4QXOA 1KYWA 4J0JA 4MARA 4WBNB 1TO2E 1E4EB 3T3IA 1MJGM 1S7CA 1VPVA 5AKEA 4F4FA 1KXJA 1RWBA 2C9OA 2P2JA 3AKDA 2AOWA 2Q45A 4YS6A 2QZ4A 4RADA 4NESA 3B7GA 4YJHA 2I4MA 4DUYB 2MJLA 3AX6A 4M4SA 3BXXA 1SU7A 4XM2A 1MB4A 2WJ3A 4WZBB 2DFDA 4ER3A 4FFOA 3ZDYB 4MHOA 4QSHA 2KBEA 4YIHA 2FN3A 1OC4A 3C3BA 4CNQA 1ZGBA 2NADA 2OQRA 3WMEA 3FRIA 1XDDA 2WHQA 3GLIA 3FHJA 4G26A 1F4LA 2JFGA 3EOZA 1NW8A 2Z0MA 4YR9A 2A7QA 3R9WA 1H23A 2HLDA 3W78A 4E1VA 3Q3HA 3R6DA 1NAIA 2WD7B 1KVQA 3ZK7A 3K5IA 3K0FA 4BV8A 4HVCA 1GSHA 4Q4DA 5HPYB 1UODA 2UAGA 2I6SA 1UJ2A 1MABA 1NC1A 4GOKA 4YH1A 3S5JA 4Q3BA 4TT3A 4TWRA 5IVHA 4Z4EA 4NZPA 4JQCA 2M9MA 1GGFA 3BTOA 5F5NA 1C9YA 1R0RE 1T2UA 5CM2Z 1L5OA 1F7UA 3PLAE 2YXPX 4WN3A 1J8VA 3PPVA 5BV1A 2F48A 1XXHE 1J0AA 3RUAA 1P74A 4YUAA 4DEYA 3ZGXA 1QS0B 1NIJA 1NSYA 3AQ4A 4JLOA 5SYMA 1U0LA 4JLJA 5F21A 3TLGA 2C5GA 4PZ9A 2JD1A 3PQCA 3Q6IA 1TKRA 3ORSA 1ZOLA 1XVAA 2FCAA 3VKHA 5K2MA 3BHIA 1CK4A 3U49A 4ALMA 3JQQA 3QKTA 1FP4B 3U4CA 2ISSD 5JZOA 4RVDA 3Q7QA 3NTRA 1GA1A 2GYWA 4TMXA 1JQEA 3TLXA 4CVNA 1DAFA 3ADKA 3QLEA 2FWBA 1JYSA 4O4HA 16PKA 2EDCA 2VUHB 3HGTA 2OPBA 3L4BC 1W4CA 3SCZA 4HDKA 2Q3JA 3P32A 3FY4A 4HEA6 5HF5A 3PL5A 5IH7A 3CJEA 4DXHA 2VP9A 3DOUA 1T3GA 3BH7A 1ZMXA 1W96A 1T9GR 3O82A 4L72A 1NFQA 4W6ZA 4TTQA 5DP1A 4BV2A 1E6KA 2OCBA 2PBZA 4PX2A 1VXOA 2F1OA 1KK0A 3PUIA 2QV7A 1FYXA 1PFQA 2OHVA 4L28A 4BNHA 2DETA 2AFHE 4BYMA 2IWRA 1I4WA 1A2QA 5K6AA 2OB2A 2QZPA 4QFMA 1FRVA 4D9KA 3U7QA 2XIJA 2Y1FA 4GUDA 3V1NA 1WR8A 3ZKAA 3O4IA 1U2GA 2WNSA 3FBGA 1EBBA 3VO2A 3ZE8A 4BZXA 2HCRA 3O1HB 3BT7A 5DCLA 4A8JB 4CRWB 1G4HA 2VH1A 2G76A 4JI1B 1ML3A 1RYBA 4HFMA 4BO9A 3WLHA 4UQPA 1HLPA 3KOXA 4PW0A 1I33A 1JG3A 2OE2A 2PJRA 4LBVA 1G3RA 2P30A 1E4EA 5FX2A 4Y2VA 5FBHA 1GL9B 2FPMA 3HXQA 2VQ6A 3K8YA 3WK6A 3GBVA 1NI3A 3UKOA 1HNXB 3TL6A 2QRQA 1ODKA 4EHNA 5AR1A 4KREA 2DR0A 3R7NA 4BX8A 1JR4A 1JDBC 1FP1D 2FFHA 3E3AA 2QD4A 3MERA 4WDQA 2YV5A 2D1QA 2RC6A 5CHEA 4E5DA 2NVWA 3LL4A 5AI4A 4GBMA 4YIKA 1ZH8A 4QOIA 4Q05A 1P19A 2PDAA 5JPDA 3RR2A 5ALFA 2VL7A 2O0LA 2AOUB 2ZWOA 2FQYA 3N0WA 3F97A 4O5OA 3UMGA 4FYJA 3KOUA 3UFBA 3P9XA 1PT7A 3CF2A 4NQZA 4YC7A 4HDRA 3AVVA 3AEXA 3TW4A 3T5TA 2RGXA 2AVNA 2B94A 4BVGA 4BNDB 2XDAA 4HAXA 4NCJA 5HQJA 4DBZA 3G82C 4O0MA 4LNUA 4CM3A 3Q5DA 4UZFA 1PWYE 2AJCA 2HM7A 4NATA 3M9LA 5D3KA 5J58A 3LH5A 2CT8A 3P0RA 1I9CA 3LKBA 1V1JA 3MOGA 3QP9A 4MS4B 1Z6XA 5IDQA 1E2UA 3H2HA 5EZYA 4D0SA 1N6NA 4GNRA 1GU0A 1SVNA 1SXIA 2WM3A 4GWLA 4CEJA 1QS0A 3SVTA 4EG7A 1KY3A 2AEJA 4CTMA 1I5RA 2C9ZA 3GOQA 4NC9A 1QLWA 1GT6A 2ETVA 5F2EA 4YRIA 4R1OA 3X1JA 1P4HA 2AEFA 1DUVG 3GUYA 4MI1A 4N0EA 1B43A 4DSZA 1SQ5A 3ZWXA 3TJMA 1YJQA 2XQKA 3KZOA 4BKUA 4ETIA 1R16A 1N36C 4HX9A 2BPOA 4HJRA 3HYCA 4R2IA 3LC2O 1JXMA 1THMA 2IDMA 1PYGA 3GX1A 1JYEA 1UXIA 2ZPTX 4IX1A 2H16A 3X1WA 2QSUA 1Z5WA 4OHYA 4Q9KA 4WKCA 4QTTB 4JLSA 3KV1A 2Q5FA 2E8FA 1L8OA 1EK5A 2JIDA 2VWPA 3D3KA 3FJ1A 4HPXB 4KU4A 2EATA 4WE3A 4RQAA 1P7VA 1RAAA 5HFNA 4XDZA 3CNQS 1C3XA 1B73A 2W70A 3I12A 5BV8A 5K0FA 2CV2A 1GQQA 3UV6A 3KHUA 1ZEMA 2WTXA 3E15A 1EEHA 5J5AA 1R0BA 3FOEC 1V26A 1TNDA 1WDWB 3H1TA 3LNTA 3ZNPA 4EL5A 3LP5A 1U2EA 1NT4A 2JJ8A 1DKOA 3N2KA 4LDZA 4YALA 4BVKA 5L3VA 3SZUA 1T2DA 1PWZA 2PRKA 4DLVA 1N92A 3CEAA 3SSNA 3ZZUA 1ESNA 4ZU3A 2ZT7A 2NZ8A 2LZ0A 3NAQA 3LQQA 4GICA 2JGDB 3O95A 5IMBA 1RIFA 3N58A 1MXAA 4GMXA 3UENA 3QU2A 3LK7A 1VDMA 4P93A 4OMDA 3WK5A 1H2AS 3DLAA 4YMTA 4H17A 4X7RA 3UOAB 1HH4A 1SQGA 2PTGA 4AZ0A 4ZT4A 4FUTA 5CB4B 1NW9B 4CWAA 3I2FA 3N8DA 1KRHA 2QROA 1BSVA 3D7SA 3EQ7A 3M6FA 3ANMA 3S6JA 5T4EA 5KTSA 1M7GA 2C59A 3FLMA 1MD9A 1LSSA 4KMRA 3TW8B 3B6IA 4D74A 3Q10A 4DCJA 4EUKA 1LPNA 4M1QA 4XIFA 1YH3A 1ZIYA 4O4HF 2P2MA 1SVSA 4QVGA 1LX6A 3T1YB 5KNDA 1AS0A 2XE7A 3EGDA 4KRYA 5F76A 4AS3A 3OCXA 2PJDA 4PAQA 1H9AA 1W34A 4MSUA 1YCGA 1P9RA 5LFAA 1GUYA 1LF5A 3SD7A 1MC1A 1OGIA 1JQAA 2G9UA 3MQ2A 3MIIA 6NULA 1XLTA 4BC1A 1M34E 2ZIFA 1CR4A 3STTA 4NXNB 1OYWA 2H92A 2V0GA 4D6XA 4OBBA 3EARA 1Y3BE 3QKSB 4G3XA 2BFCA 2QJWA 4LCJA 4EJ6A 3H1FA 4XWKA 5CNJA 4MS4A 2Q29A 5JISA 2ZZMA 4YMIA 4O2AF 4YY3C 1JUDA 1T26A 1KYQA 3KVVA 3AIKA 4LXQA 4UUMA 2B92A 3COYA 4Q18A 1Q7GA 4YV2A 3IP6A 1KVTA 1FUGA 3W79A 2VH2A 4G5FA 1V95A 3ISVA 3ONVA 1HQDA 4CV3A 2R5FA 2D0IA 2XYHA 5FTJA 4ZCRA 2QLJA 4MA4A 1T6ZA 4HVLA 5IEJA 3CX3A 3VR0A 3EUFA 5FFMA 4M1EA 3F3YA 1JDVA 2WSMA 2B7LA 1D2HA 4UD2A 4J90A 4B7AA 1R5NA 1BFKA 2EDAA 1XYGA 4J43A 2YHUA 4IGFA 1ZR2A 4R2LA 3NRCA 3UMMA 1M34A 1FY2A 2FP4A 3H97A 3QG1A 4HZUB 5K0NA 2G9QA 1KZHA 1L7NA 5KTNA 5COBA 4IQGA 3G5UA 4KH0A 3C2QA 4K9QA 1CR2A 3G1UA 3OF5A 1PCXA 4RGQA 4K5QA 4M8SA 4AICA 4KQFA 3C6BA 4UTRA 4QFDA 5EPOA 1CEQA 1G6KA 1VCMA 2ZB7A 5JNTA 3A6HA 8OHMA 3D8NA 1S2IA 2XUHA 4ZZ0A 3ZHSA 3HB7A 4NONA 1Q83A 3PNQA 4YP5A 4H6XA 1F8XA 4U2EA 4BWGA 2PLRA 1XRQA 2VLIA 5DNAA 1NKSA 1XHFA 1RQRA 1VL0A 3DEKA 4YRTA 5DTMA 3EIUA 4GD3Q 3UO8B 4F2DA 1BKYA 3LUKA 1A9OA 1YJ7A 1YDGA 4F3CA 1LTHR 2JGDA 3S8EA 3OEHA 1SXJD 4M1OA 3RU2A 5EZYF 1IRIA 4CMEA 2JCBA 3MSCA 1MQAA 1DT5A 1R0LA 2BR3A 1EZ1A 1UP7A 1P5JA 1WCYA 1YS2X 3K2QA 3B5EA 1OE0A 5KCZA 5CB4A 1ZIPA 3F7TA 3T9EA 4RTQA 2QRKA 2O8EA 5SZKB 2OA0A 3CFYA 2WP8J 3QEJA 3TNLA 3C6YA 1YS9A 3A58B 1IZYA 3FCXA 4S1VA 4BU1A 2D2FA 3W2EA 1U9IA 3HKEB 4REMA 2GPAA 2FUNB 2GF0A 3UCXA 5G4KB 4A6PA 5JDCA 3U09A 4MRSA 2C2BA 1X1TA 4RFVA 3S55A 5FOUA 3DDOA 3TW8A 3AIOA 3DB2A 4MW2A 4NFHA 1ZNYA 1Z47A 2A9JA 2AT1A 4FMPA 4XYLA 1DOZA 2CHVA 3KVYA 4QYIB 3DHVA 4CPDA 4XVUA 1OPRA 3G8BA 5IXSA 1XMSA 1JPVA 3SM9A 3CVVA 2WZBA 1PJRA 2C1XA 4N5IX 3GQBB 4ZOCA 1VMIA 1H8HD 1UWVA 4PX3A 1TRKA 3JALB 2RJ3A 3QBDA 5FLXA 2AN5A 1EPUA 3EMBA 3H4VA 4EKEA 4DDKA 2VFAA 2WUFA 4WFJA 4C05A 2MM9A 4YQZA 1N57A 4M54A 4ZCPA 5KTTA 1YACA 1ZM9A 4G63A 4HNUA 5CUQA 2ZLBA 4UU7A 1RWMA 3QKSA 2QSZA 3IP5A 1IZ9A 4LJRA 1Z8DA 4ZQBA 2GVNA 1XEXB 1I8TA 4D8VA 3I5XA 1EGAA 1TADA 1JG6A 1FMCA 1NVTA 2IDZA 2YZNA 3HEMA 4JKOA 5K85A 4M1ZA 1GKYA 4QYMA 5T4FA 2ECOA 5JC1A 3A11A 2WFZA 2FSVC 1HORA 3NWBA 4ZVNA 3SY8A 5JNUA 2CNNA 4EI7A 2XMSA 3LUGA 4DIMA 3L01A 1MJNA 2ANBA 3MT7A 4J0EA 3X1DA 1RQLA 2HQOA 2ODTX 3UC9A 3VISA 4BOYA 1NM5C 2BKXA 3GDGA 3PS9A 4HN4B 3UX3A 4XGIA 5DMXA 3GFPA 4I81A 5LCIA 4GVLA 1FXWA 4OXIA 4WESA 5E1MA 5E9JA 5IAGA 1F5NA 2IBSA 1E0DA 1RCTE 2XUOA 3JD3A 1BXRB 2B4AA 3IXLA 1DQPA 2Z95A 4UATA 2ZPUA 3ZU4A 2BI7A 4EATA 1HT0A 2I67A 3H5WA 3OZIA 3QWHA 3GPIA 4PSUA 1YUBA 3ZCRA 2GH1A 3CUKA 5JBQA 3LC0A 3AR3A 3BYZA 3IQZA 3GZNB 4ZI3A 1S3GA 3LWZA 3PC3A 2PKCA 4HSEA 1D9XA 2V4UA 4IJVA 5FPYA 2PX3A 1A8PA 4L9SA 2NAPA 2IJGX 3W8EA 2P2SA 3Q3JB 3UICA 3P7MA 4X65B 2PU5A 1B2LA 3AP2A 4M0UA 1J5XA 1H0HA 2C8JA 4PXYA 4ENQA 1WXHA 1Y63A 4YP7A 3KT3A 1D8AA 5A9SA 3T61A 4EGSA 5BVGB 2DCMA 4UUNA 3WWEA 1E79A 1GD1O 4MRNA 3FB1A 3EBLA 1PTJA 2QU8A 3I0MA 3QF4A 1RWQA 2ATIA 4BMXA 2ZUTA 4E5MA 4KR2A 1Z17A 4XDHA 5FWXA 1UQTA 2J5KA 2NUBA 3ED5A 1IUKA 4DPKA 1KZ6A 4A2CA 3A28A 4P33A 2GZMA 1U8CB 1NQVA 4G86A 4RORA 2ZRBA 1O54A 4OJQA 2ZJ8A 4X91A 4OL0A 3SYRA 2NV0A 4LJ6A 4JBXA 4Z7NB 2XCTB 3O94A 1MX5A 3ZU6A 3EIXA 2VA9A 1FYVA 1T8RA 2G4VA 1WSAA 5E0OA 2PRYA 5IXJA 3N5CA 3IUBA 4JR0A 5CVUA 4KXXA 3C5CA 5EKXA 3TZEA 5JCJD 5EJ9A 3KYIB 3RYIB 4C1BA 3KXPA 2XTJA 4P2BA 4AG3A 1PT6A 2LKDA 4MIKA 4JYAC 3A9RA 3K2IA 5G4KA 3IAM1 4EFMA 4ENSA 2OXCA 1PA4A 3ICWA 3U1VA 1KSJA 2R7NA 2V3VA 2JARA 4G41A 1R6TA 4P7FA 3K9GA 4RHEA 3SLGA 1K8YB 4BECA 1LC0A 1WW3A 4FUQA 5IDYA 5A7HA 3IV6A 4A2PA 2A4KA 6REQA 4DRYA 2JIPA 2CLMB 4G1MB 2OHFA 4K9SA 4YNBA 4JBWA 5JROA 3EC2A 2X4GA 1JL3A 5TMPA 3OPYI 4O0LA 2K87A 2BM8A 4C30A 4E51A 1VRCA 2H2DA 4CODB 4YRDA 3BBLA 3JALA 5DV9A 3KB6A 1P4EA 1U0RA 3L0DA 3D6JA 1QH0A 3WGHA 1IG0A 2DE0X 3W5SA 2XGSA 1P6UA 5KMGB 3N2GB 3TQIA 4K2AA 4TQ9A 3HFGA 2AN9A 2EGGA 4DANA 3E2PA 4NDNE 5KYWB 1IVSA 1P9WA 4ZAWA 2IEIA 2WUWE 1GZSA 3RAJA 1W5TA 4MTLA 2BMWA 2F7SA 5FF9A 1XEXA 3IVMA 4DIBA 3GWZA 3LD9A 1LPPA 1MAVA 2V0NA 3R0QA 4HUQA 4JOBA 4RESA 3BHMA 3H1EA 3HRHA 3H7AA 1V48A 2X7XA 5CLFA 2G36A 2FEMA 2CEKA 1A8SA 3DBLB 3R09A 4GOXA 2WP0C 3LRTA 4ZVTA 2XUKA 2IHKA 4CMGA 1J1IA 4NCIA 5CB4F 1GG8A 3RJMA 2WF5A 1EK1A 3T5CA 1RKBA 2CE7A 1PLLA 2REOA 2VN8A 4XWOA 1T4DA 1DBPA 5BYBA 5ARCA 1E2LA 1GZ4A 5JSZB 4MVWA 1XRJA 4KRGA 1BXRA 3TO5A 4G97A 4RENA 4D46A 3B52X 3G59A 3IT3A 1RTKA 2B8TA 1LK7A 5CDFE 1OLSA 3OZFA 2ZOSA 4NDNA 2Z2IA 4TMWA 4EENA 1I2BA 2PLAA 2MIIA 3L0CA 5UKDA 1FE8A 1DE0A 1UF9A 1JKJB 4EBFA 3ZV3A 4L15A 2EZUA 1G21E 4OGKA 4NS4A 2FRXA 3FCOA 3NYWA 3TDKA 3ABIA 3OKCA 5KHLB 2P90A 4IS3A 1RBZA 4RE6A 2V6IA 4OXXA 1HFJA 1U1EA 3MTQA 1S3IA 3NG1A 1CP2A 2RHJA 4H7HA 4RHYA 5FBLB 3ZEIA 3GELA 3MS4A 2B69A 2NO1A 4EO7A 2OQIA 2ZUDA 3AVTA 1QRRA 2VBFA 2X15A 2ZW9A 5EIOA 4BN4A 1KRWA 1Z8FA 2VQEB 1SH7A 3ZW7A 2IDKA 4FFDA 1UAYA 1U4SA 4UPDA 2Q9CA 1ND5A 1Y34E 3J81D 2CXXA 3S1LA 3TB6A 1T9AA 2FEPA 2C99A 2HCTA 3GUUA 3EZXA 5CDFA 3PDWA 2I4RA 4FHDA 4Y1RA 3EXHC 4NU5A 5AH0A 2HPZA 2AL7A 1RPAA 3TS1A 1SEPA 2D1FA 4KLNA 4BNKA 1KTIA 1P1IA 2FPRA 1WEKA 1UBMS 2C3UA 3KNZA 3O21A 1RJEA 1G21A 1Z4PX 2CHGA 1GQ2A 2PM8A 1OX5A 3AM4A 3LVRE 4N7BA 3GEDA 2ZI6A 1SHZA 4KXLA 1JDTA 1FXWF 4NXMC 3AEQB 5BW4A 2Y4NA 1NYRA 2UUAC 4FMCB 3CU5A 3EQZA 1J33A 5BO5A 4R6XA 1HUQA 5FJIA 3EEOA 2JLBA 2N0SA 5AJHA 3OZTA 1Q6ZA 2AOVA 3OTHA 1Y3AA 2HDWA 1OKKA 2OCGA 2R79A 2R97A 2I9PA 2V7XA 1LDNA 1RQ7A 1IEXA 2Q2WA 2W71A 2G25A 1Q0UA 4OL9A 1YVDA 2NSYA 2ZRJA 3F6YA 1OTYA 1HG0A 1HF3A 2Z1MA 3V1LA 5CW1A 1V11A 4WLUA 3RG2A 5JLAA 1ISMA 2P69A 1XQ1A 1PR0A 5KMGA 3J80A 5KKCA 3GJXC 1GNRA 3QYJA 4I9FA 2CFRA 2J87A 3P9KA 5KYWA 2H4FA 1LDYA 2J08A 5KTPA 1OH5A 5FD8A 4LVOA 3R74A 4W7SA 3UOGA 4OYCA 3D1JA 4QUIA 1QWIA 1JFFB 3IUMA 2G77B 5IJWA 3TVTA 4D80A 5FAXA 2OK7A 2YCLA 4AMGA 4LDRA 5IARA 1M1YB 2OYRA 5JZ9A 1GN9A 3N5KA 4MB0A 4EUNA 3PGMA 2GBFA 3EZ2A 3HH8A 1IXYA 1CQWA 3L05A 2GPYA 3NTUA 3QMMA 3T5PA 2JLYA 1TM3E 4QO7A 3RRBA 4ZOQI 3EZGA 1IBSA 4DN6A 5FWDA 1DWQA 5JSZA 4ZVMA 2H7VA 3DZIA 2AKAB 4PBRA 1PYDA 2IYSA 4BBJA 4LX0A 1EFPA 3GVCA 2VIIA 3GUHA 4IILA 1J07A 1EHYA 4CM7A 4LRQA 1DQYA 1EFRA 4ZYXA 2GCNA 2HMVA 4DR7B 1EXNA 1Q7TA 5TVGA 3S2EA 3T54A 3WMFA 2DHRA 2UXBB 3KQWA 1A8HA 4KWIA 3X44A 1Y6RA 1SU8A 1RRMA 5I8PA 4GKJC 2KPOA 3GZTB 5D51S 1MNQA 5BN3B 1G6HA 1RLUA 4O25A 5TQJA 3EWSA 3K70C 1QONA 2G7MC 3G9TA 3IBSA 1NX6A 5FOXA 5G0WA 4D3FA 3U3MA 1VE7A 3U7RA 3NKVA 3ZXSA 4CQMD 4TXLA 4IDHA 2CXTA 4J76A 3T0FA 5JUWA 4E5NA 4ZI7B 1E1CB 2B6HA 5DM4A 4B35A 3TTYA 2YN2A 5FOWA 1V1MA 4JA2A 1H8ED 1E2EA 3BWCA 3AI7A 2D1TA 3SXPA 1MJ5A 4MP8A 1LBQA 1Q0HA 1NVFA 4JV5B 1ORRA 5B2EA 1X19A 2AG8A 3PLRA 2EIXA 3VAZA 5KKAA 5C1BA 3VKVA 2F2TA 4ZV7A 2H1HA 1TW2A 1N2FA 4DBLE 1ULHA 2FKAA 3RTGA 1ISHA 1JKXA 2FJPA 4ZIRA 3ZLUA 3R0VA 2PVPA 2VDPB 2WUEA 4MVJP 1E1RD 1YXMA 1QYXA 1VB3A 2DTDA 5HR5A 4HAYA 2RKOA 1MC8A 1D1SA 2O6HA 2W2LD 1RHQA 4JOCA 4RELA 4TS4A 4AF6A 1T43A 3L1HA 3MK31 2A9OA 3JWHA 4PO9A 1CIPA 1Y3DE 1R64A 2Z83A 5JJBA 1KI6B 4NENA 4EUFA 5A4AA 2JK0A 3IP9A 3DBRA 5IMSA 2ZE6A 3QVKA 4ERNA 2P2FA 2DPYA 5IZCC 3SQXA 5HMLA 3UB4A 1LSOA 3NT2A 1J2TA 1RQNA 3LY9A 2Z9CA 1IPHA 4CDMA 1Y7TA 3T38A 1G2OA 1NBOA 2NTJA 5G40A 2IXGA 3NGMA 3R7SA 5AXBA 1HTTA 5EHGA 3U1BA 1WMFA 1L2FA 3P71T 6CHYA 1UUFA 2V7WA 3Q7RA 3STUA 4YI3A 4JLAA 3PJEA 5AUNB 1YZ3A 2IW1A 5CYFA 3E3NA 4RPKA 1U02A 2WWXA 1UEIA 2YRWA 1BZYA 3OIFA 3T6KA 3KZNA 3GA5A 4QVKA 3VNRA 2J3EA 4TTVA 2IX3A 2FG7C 4AJ1A 1JFFA 3MGGA 2HGSA 4JEHA 5AKYA 4QT4A 3D8UA 2P2BA 4O1MA 1EU1A 2ZUVA 4C0BA 1K6JA 1QQBA 4W5JA 4A0GA 4D3YA 5ALNA 5FNVB 1NXVA 1FYEA 2IYZA 1LW7A 3G5AA 4OQ4A 1YQWA 2BEUB 2EW8A 3D3WB 1XTQA 4MQMA 4INJA 3SMVA 1P2TA 1UDRA 3H11A 1KP2A 3V00A 3DC7A 1JU3A 4HRYA 3WB2A 5K0CA 4BC7A 2R85A 3GU3A 1G5HA 1ZMTA 3CGGA 4XRGA 4LN1A 5FPKA 3BEDA 4B3BA 4AJJA 1F38A 1QH9A 1Z2DA 2ZSFA 4Q0MA 5BN4B 2PLFA 1YVUA 3HJNA 2C7BA 4Z99A 4DQ0A 5M7EA 1X1BA 1O87A 3DFKA 4NJMA 4LZLA 3K73O 3WGZA 3WKCA 1QHHB 3ROGA 3HTXA 4YV7A 4BO6A 4C0HA 3W2TA 1HO3A 3F0TA 2AJTA 5C8DA 1YK1A 2ZYVX 3PFWO 2QM3A 2XH8A 121PA 4EG8A 1YS1X 3VU0A 1PGOA 4O33A 4IKEA 1CUSA 2Y4OA 1G5FA 1QE3A 3CXRA 4YMWA 2GKSA 3LVBA 3SZ3A 5AUPB 2PUWA 4Q4LA 3A04A 3ND9A 3PDJA 5CVTA 2V4MA 3MCWA 4ZI7A 1Q19A 1OROA 4N5LA 5EQJB 1EAYA 3ZWMA 5AM3A 1F20A 3K72B 1ZM4A 3RC1A 3LPMA 1TCBA 2IXAA 4BHTA 1XZBA 2AG1A 3JAKB 4FW8A 1GPAA 5K0LA 3RK0A 3KUDA 2XT9A 4Y2GA 4D26A 4KR9A 4MP6A 3WGLA 3EEBA 3L0ZA 3R0JA 3N1UA 5LJLA 4YI5A 1LSUA 1P7PA 2IHYA 5THXA 4UEQA 2J9XB 1RT9A 1JYFA 5JJKA 1JFRA 3ROFA 5IM4A 3IMEA 4I6EA 4K1LA 5KQGA 2HMAA 1DL5A 4P5PA 1JHQA 1OT5A 4MKXA 4ZQFA 4L4RA 4FEAA 2OHOA 3U13A 3U3JA 4DR6B 2Z56A 4MWSA 3IBGA 1CT9A 1PBTA 3CA8A 4XR9A 5I48A 2FN9A 2IYWA 2ONJA 2W48A 1VMKA 4HP8A 5JMPA 4N7JA 3T3HA 3ZE6A 4KIWA 4LHWA 4MMXB 4ZGBA 4ASUA 5EQFA 3PC6A 4IIBA 2Q6KA 1GPJA 2G6BA 2WG2A 3TOCA 2FSGA 4OAQA 3UMBA 5AE1A 3KIPA 4LQCA 3JD4A 2HDHA 1WV0A 4KFTA 2X9VA 1KFEB 4KFRA 1VYTA 3D3QA 3N9IA 3E9QA 3O3CA 1XZJA 4PNPA 3X2FA 4N3CA 1XQVA 5B1IA 3BFXA 821PA 5JXJA 4DLWA 1GTVA 4FLMA 1NN0A 1NLYA 5FA8A 2WWRA 3FFWA 2XCLA 3R3XA 4G1FA 5AKGA 1V9CA 2D7CA 2OAGA 4CE6A 2QQ5A 2WJHA 3OE7D 4JX8A 5IN5A 3WIUA 2BC9A 3JQBA 5ILOA 1C29B 1K5PA 4DZTA 2BKEA 1E1QA 1GILA 1JNXX 4UTZA 2IV2X 3IDSA 3H75A 1BXZA 1XWWA 3BB3A 4JBHA 2VNAA 3DXFA 5HF8A 4Y1GA 5L51A 3PJFA 3ADBA 5KOJB 4HXFB 4EQZA 1C4OA 1G8YA 1G7RA 2EX4A 3FSEA 1Z26A 4LFAC 2AZMA 1F8FA 1V2HE 4MEAA 4MGHA 4LY6A 2Z2JA 3IVRA 4B40A 3SJBA 1UINA 3CB4A 4J07A 2BEUA 3GGPA 3LFUA 3D3WA 3I32A 5G53C 2YXDA 3USZA 4B6QA 4J0KA 5IT0A 5TR9A 1L4LA 5KWEA 1XDGA 1YQUA 1RP7A 5A5EA 2EJWA 1SCUB 1XRRA 2QDKA 3A26A 3DGFC 5G02A 4FMCF 3BSSA 5BN4A 1KBZA 1JMVA 5ALXA 1XBTA 4M53A 2PUBA 4UHEA 4OTZA 5JLJA 4YPOA 1DFHA 1QFSA 4LJSA 3WRYC 3L1UA 1P5FA 1Z2CA 1ZRNA 1ZW1A 3LOUA 4PTYA 1XJWA 3S2UA 3QMPA 3V8NA 4R8LA 4UM9B 3BD6A 4HNQA 1LFDB 3LCRA 1TL7C 1DAIA 3L0OA 4KAFA 4CUKA 2ZIZA 4FYMA 2NU7B 4S1WA 3HBLA 4ZRMA 3TZBA 1J56A 3DW3X 2Q46A 2ZRIA 2ZJ4A 2RAUA 3I2HA 4XA8A 3ZHTA 1L7VC 1S2NA 1W4ZA 2RHRA 4DJTA 4Z54A 3PUXA 5KC8A 1FRZA 1KIFA 2NX2A 1T8PA 4Z8XA 4EHDA 4ESVA 1M2FA 2VDUE 4F5DA 3S2IA 4QJIA 5L3RA 1V1RB 3BG5A 1PT9A 3JAKA 2XB8A 1G63A 2IXEA 3GMSA 4D9BA 1TTPB 5K03A 2H4JA 4AYWA 5DDIP 1FUEA 4LJ7A 5EJEA 2A2ZA 2WYWA 4Q3AA 1WIWA 1EBFA 1X2BA 4JI6C 2VAPA 3HVKA 4EA8A 1E3LA 3UW3A 3RJ9A 4BFZA 5BNWA 3I2JA 3K6KA 1VSVA 5FPTA 3CLHA 2XGJA 5F4BA 4TV9A 2XAAA 3IIKA 3ABQB 3CKKA 5LIRA 3NPDA 2O8FB 5C8YA 3ADCA 1T2AA 5DI3A 1K8ZB 1XRSB 4YHHC 2E8EA 5BUSA 2B35A 4RY2A 5H3CA 3VSCA 2P5SA 2P11A 2VDMB 3CVYA 3T3NA 1SXJC 1KEEB 4FIZA 2NUPB 5FR1A 1OU4A 3PZRA 3FPGA 3WYBA 2B36A 1CE8A 2GO7A 3AWIA 4MQUA 3B3QA 3T7AA 3NKLA 4BRZA 5BNZA 2ZP1A 1VIYA 2BAGA 4FDMA 2YJ4A 4RFSB 3AJ8A 4D41A 4DCVA 1DIHA 3ZWNA 2OC9A 1QF7A 1E3MA 3BFKA 3AVQA 1TCCA 4JL5A 2CUNA 1Y1PA 5A1GA 2KQUA 2ZBRA 4YREA 2CHEA 4ND3A 5TARA 3GAMA 3OQBA 4GWKA 4U9IS 4NZMA 3R7DA 4MHTA 3ZHVA 3CSUA 4EF4A 1IAVA 3EZLA 4P9NA 4AZ3A 2ACKA 3A3PA 4ZI7F 3LUPA 5LNK6 2XITA 3AYXB 4WZAE 2WIFA 1VL1A 2GJSA 1Q0LA 1YI1A 3ZI0A 1F2VA 5AUOB 1EHIA 2QQGA 3OECA 4JX9A 1ZICA 2I2FA 2ZIGA 2EYQA 2ZRKA 4PG4A 5AM4A 1C1DB 2X8LA 2XSZD 2ZRMA 2VBIA 1KEWA 4BO5A 2FEAA 4ZC1A 5IM4F 1P2DA 3GBSA 3QEAZ 1E3QA 1RQPA 2C78A 2G0AA 3A05A 4QATA 3KSAC 4D96A 3JATB 1YE8A 1BTOA 1BXGB 4WLOA 4C4RA 5C4IA 4G5OA 1YRWA 3DLCA 4N5MA 1OI3A 1JIUA 3TRHA 2ZSBA 4KO8A 2QVLA 3L6BA 5EPEA 5IJAA 1UCFA 5EHNA 3SQOA 1E5DA 4WCFA 4KN9S 4BLWA 4V0KA 4YP9A 1ZDMA 4OQEA 4BATA 5A3QA 2REBA 5AOBA 4WZAA 3COWA 1AB6A 4DPLA 2ODPA 1GYQA 3LLMA 1ZUNB 4W8HA 5AW9A 4PYKA 2NU7A 3QELB 4AJHA 1H1DA 1NZJA 4M1WA 1MDFA 5CA1A 1TKAA 2R751 1FNDA 2YBDA 3O9ZA 1DINA 2PYDA 4M46A 5EZ5A 4CIBA 3DVLA 4GR4A 4WRRA 2B83A 3KD3A 4RBNA 1R1DA 3E7XA 2EGTA 5I8WA 1YZTA 3M70A 4JY7A 1KOLA 3O73A 4IJ6A 3ETOA 1Z0JA 4QBTA 1DCMA 3L79A 4HGRA 4C0AC 4JJAA 3ENQA 1J09A 3AHHA 3HB5X 1OBCA 3HRIA 2WD9A 3QE3A 4PLHA 5B64A 3R3WA 4QLBA 3TSAA 1DV2A 3RVLA 1X0XA 1YR2A 3O8NA 1AC5A 1Z5GA 3BF8A 3PUJA 4G0ZA 1UANA 1EGQA 4IV5A 4NFSA 2Q5OA 2EW1A 3HZOA 5L40A 3Q7EA 4OHKA 4II2A 2BZGA 2AFIB 2Z5FA 3GP3A 4KPEC 1N7JA 5GOTA 1Q0QA 1DGQA 1HSZA 1OPXA 2RAFA 3N3BC 5EJMA 1Q11A 4DIDA 1QP0A 5GJBA 1WG8A 5B6JA 1W52X 3KJHA 6Q21A 1RBQA 4NYJQ 1D1PA 4PRKA 5C8VA 1KDRA 5FBQB 1NBAA 4KMSA 4KE9A 1DIOB 1TH5A 5TXGA 3WYAA 4AX4A 1KEEA 2O8DA 3MAJA 1ULAA 5A2QD 4N1AA 1KI8A 3JQ8A 2IOHA 3M6MD 2CGEA 5D87A 1F1JA 5EAIA 1MVOA 2VJLA 3R0XA 4YJ2F 2QTWB 1M2GA 1GVNB 4AWBA 2Q2NA 5DLQC 3TTVA 4DLYA 1V39A 3VDXA 5FYDA 1TJNA 4HMPA 4BQEA 1Z4IA 2K4MA 5LA6A 4I1IA 4HEJA 4MGZR 4YTEA 4O4IA 3W3AD 3WLOA 2WI8A 3OU7A 1UFOA 4H35A 1OFHA 1JAIA 4E03A 3A6KA 1T0UA 1K4YA 2DG2A 4TLBA 1A9RA 2LDBA 4Q4HB 1RI5A 4NX2A 3LV8A 2VHUA 5KI6A 4FWIB 4QOHA 3B38A 5BSGA 2VSNA 2H4HA 4LSMA 4NJOA 5DK4A 5J2TB 3QLUC 2P4HX 4G5HA