3FCCA

Crystal structure of dlta protein in complex with atp and magnesium
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
504
structure length
500
Chain Sequence
MKLLEQIEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFLGCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRIVSEDNLKDIFFTHKGNTPNPEHAVKGDENFYIIYTSGPKGVQITYNCLVSFTKWAVEDFNLQTGQVFLNQAPFSFDLSVMDIYPSLVTGGTLWAIDKDMIARPKDLFASLEQSDIQVWTSTPSFAEMCLMEASFSESMLPNMKTFLFCGEVLPNEVARKLIERFPKATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGYCKSDCRLLIMKEDGTIAPDGEKGEIVIVGPSVSVGYLGSPELTEKAFTMIDGERAYKTGDAGYVENGLLFYNGRLDFQIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKKELNERLPNYMIPRKFMYQSSIPMTPNGKVDRKKLLSEVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-alanine--poly(phosphoribitol) ligase subunit 1
publication title Crystal structure of Bacillus cereus D-alanyl carrier protein ligase (DltA) in complex with ATP.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Ligase
total genus 147
structure length 500
sequence length 504
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00501 AMP-binding AMP-binding enzyme
A PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3fccA02
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fccA01
3PBKA 5BSRA 3E7XA 4M46A 4R1LA 1V26A 3EQ6A 4ISBA 4ZJZA 4E5DA 1AMUA 1YJ7A 2QVYX 3VNRA 3U16A 2D1RA 3O84A 4FUTA 1T5HX 3LAXA 4FUQA 3QYAA 2P20A 3FCEA 3B7WA 4RM2A 3IERA 3T5BA 3O83A 2P2BA 3T5CA 3TSYA 4DG9A 3ETCA 4IR7A 3DAYA 2VSQA 4G36A 4W8OA 2D1QA 2P2QA 4GR4A 4DG8A 3DLPX 5IFIA 3IVRA 3CW8X 3ITEA 3C5EA 5BUQA 3WV4A 5DWVA 2WD9A 2P2JA 1PG3A 3LGXA 1LCIA 4D57A 4OXIA 5KEIA 3GPCA 2Y4OA 3WV5A 4RLFA 4WV3A 2QW0X 5BSUA 3O82A 4GXRA 5BSVA 3RIXA 3U17A 4RM3A 3LNVA 3CW9A 3IPLA 4IZ6A 4PZPA 3IEPA 3IESA 1RY2A 3FCCA 4RMNA 3VNQA 1PG4A 4RVOA 1BA3A 3E7WA 4D4IA 5K8FA 5BSMA 2P2MA 1MD9A 1V25A 5BSTA 5BURA 3VNSA 4D4HA 1MDBA 3NYRA 2QVZX 3WVNA 5K85A 3A9VA 5BUSA 3L8CA 1ULTA 3KXWA 5KYTA 1T5DX 2D1TA 3DHVA 3RG2A 5DV9A 4R0MA 3A9UA 4LGCA 4GS5A 3NI2A 4U5YD 4G37A 2Y4NA 4RLQA 4R1MA 4EATA 5KYVA 3T5AA 5JRHA 3NYQA 2Y27A 5BSWA 4OYCA 3G7SA 2VZEA 4D56A 1MDFA 2P2FA 4GXQA 4GR5A 5E7QA 4D4GA 5GTDA 5D6NA 2D1SA 4RVNA 3E53A 2QVXX 2V7BA 3R44A
chains in the Genus database with same CATH superfamily
3CH5A 2IYWA 1OGIA 1M8KA 4B74A 2RGRA 1MC5A 2XQVA 2Z5VA 4U7PB 5E9AA 1BEUB 3E4CA 3JAKA 4KE9A 4CIYA 1T5IA 4N3GA 1WTCA 1VA4A 2HF9A 3GH1A 2VO1A 4WN9A 3DQQA 1YS2X 2BFPA 3CPHA 2Z5GA 2IRWA 3S7ZA 3PA8A 5FTMA 2BSQA 1POXA 3NBUA 2R6HA 4ESEA 3C3AA 2Y0PA 2I4OA 4LHVA 2CJWA 2O52A 4IVPA 1EIWA 1FTSA 3DM5A 3I5YA 4TYPA 1J8YF 5LA6B 1P18A 3GG9A 4XGNA 4DPLA 1A98A 2VDQB 1TADA 4RZ3A 1T8TA 3H1AA 4FZJA 3NEYA 3WIBA 3VR5A 3CNOA 3AH8A 1AG9A 4BMDA 3HBAA 4IILA 4P7JA 3A7DA 3GOQA 5ES4B 2V3WA 4YUVA 3E9NA 2W8BB 1RLIA 4O4HF 1FFDA 2A5DA 2P5SA 2DT8A 3H2TA 3OKCA 5EJ4A 1D1PA 4CLRA 3TJMA 1XHJA 1PZEA 1NMQA 2AQ8A 3EC2A 2MWMA 4PSCA 3IJPA 1MB0A 2CY1A 4OMFG 5TS2A 4RGQA 4DZTA 4RABA 2VRWA 4WS9A 1B4DA 3TKLA 3U31A 4YWJA 1VJDA 1O0CA 4HPVA 2ZRQA 1M5TA 4U5QA 2H63A 3BZUA 5E3JA 1Q1BA 1SUCA 1BVRA 1ONSA 3MG9A 1GPMA 2MTBA 5LZ7A 3TXXA 3U6BA 3I4LA 1LPMA 1UJ6A 3DXYA 1Q1EA 4ODIA 3ZZNA 4ZN6A 5LQKA 2EL9A 1GKIA 1G7TA 4WCFB 4HH0A 3VO2A 3OF5A 3FX2A 4J2TA 2CLDX 3GI1A 4G1FA 4X3CA 5EMNA 4CG3A 1QXSA 3IPLA 2IYSA 2ZJ3A 4HO1X 3AEYA 2BP7A 1VPWA 2R97A 4NAUA 5AXCA 1Y42X 2KPOA 3FVRA 1T9BA 3MCVA 2C2XA 1YFZA 5BV0A 1QQTA 1WV0A 1LQ2A 2GZ2A 3LDUA 1QH0A 1U4SA 2NOAA 3RFCA 3AR4A 2ZIVB 4CV3A 1HFKA 2WSBA 4ZHQF 1U28A 4BLQA 2FR1A 3QX8A 2F62A 1Y4DE 2I33A 4PPQA 1OFVA 4ZV9A 4EFMA 1FUGA 2VBFA 5AOBA 3ND9A 1HQKA 2JLSA 4X63A 2PDAA 3EMVA 4ZU3A 3HFGA 4YO7A 4QARA 3UMRA 3DBLA 5AW0A 2W0SA 3G2MA 1X7DA 5LP1A 4X62C 4O4LF 1NQWA 3OKAA 1OI3A 4KXLA 1MXCA 1DLJA 1GR0A 1O5OA 1X7YB 2R8PA 4GBMA 4WFIA 4G1BA 4L4RA 3WB1A 3PXUA 2PZLA 4JV5B 2QTLA 4QU5A 5CZVA 1UMBA 1JWAB 1YI1A 4JH0A 3CQ1A 4MUEA 2YNMC 5FORA 1GTG1 3ZCRA 3VPAA 5IHPA 2CF5A 3DXXA 3B3AA 3CH6A 3EBPA 4O4JA 1GNSA 3MC1A 3QV2A 2X5OA 5DWQA 3UTCA 3WR5A 1E4YA 5H82A 3EXG2 3RS3A 3L4EA 2Q4EA 1VIDA 2HA5A 1TAGA 4K6MA 3L7YA 3SBEA 3F8SA 2H5IA 2O20A 1A96A 4FYMA 3TVYA 5K03A 3EPLA 4PBTA 5I6DA 5AICA 4OQYA 1B8PA 4I5FA 2D5CA 1DO2A 2NV2B 2ZJ5A 4OBEA 2LGJA 3U7EB 5A0TA 1FSPA 2B25A 2EKZA 3TVTA 2DUMA 2JAOA 3ZCTA 3ANLA 4OXKA 3TOZA 1JIQA 4M1EA 3TIIA 3AIKA 3MQ2A 4K5QA 1VG1A 1WG8A 1W87A 1SKBA 1A9YA 3NKVA 4J4HA 1LF0A 1O87A 5AJVB 5HRUA 1KMNA 3MUEA 4TM8A 1TC1A 1GR1A 4FIZA 4H17A 4TMZA 3WAGA 2XB2A 2IIPA 2FMFA 1UZMA 4H7EA 4F46A 3TGPA 4JZKA 4ISBA 5AM2A 1E5XA 1ONNA 3F7NA 3I76A 3ELWA 4OQNA 1PBTA 2CK3D 3GFQA 4F06A 1MA3A 5IASA 1FYVA 1S1CA 2PL9A 2CUNA 1Q74A 2BTOA 2NXJA 3H2YA 3L7JA 4XX0A 3UWSA 3SJCA 4BKOA 1P9RA 2IE8A 4TUYB 3RK0A 1JU4A 3ZXSA 1T3SA 4BUZA 4IOLA 4CMIB 4YRCA 1FW6A 4GH5A 4HX5A 1L5FA 3O21A 3ESZA 2BFCA 2PIDA 1XTVA 3GT0A 2Q9UA 3D7RA 1U8FO 2C04A 2WPDA 3K5WA 4LDPA 4OQLA 4BU0A 4S12A 4XPIB 3LNCA 2GEFA 1Y1RA 3T5TA 2DETA 4WLEA 1H3FA 1POWA 4NYMQ 4QDKA 3M6FA 4F5ZA 2P2QA 4N0EA 2F9FA 5ALOA 3A4TA 4A6PA 5EVJA 4B5KA 1S3SA 2EF1A 2G0AA 3C5CA 3AUKA 1SG6A 1H85A 3F3KA 3H7IA 5AVSA 4BKRA 1PZNA 3A05A 4EEZA 4EG7A 3B1ZA 1Q1QA 2VTEA 1HYHA 4ZRMA 3N0TA 3TLGB 3W9BA 1H3EA 3R8FA 1GUZA 4PSAA 4CEJA 1PZXA 3QWHA 3MK31 4GQBA 4R81A 3HXKA 2IZ1A 3PWTA 1DC6A 1RHUA 1RWOA 2IK8A 3GRZA 2ISCA 5CVEA 2ZJ2A 5GINE 4MO9A 2SKEA 1P2DA 2HXGA 1UWCA 2JASA 3B78A 3I92A 3E18A 4XIYA 3JQGA 4DV1C 2FEOA 3P4XA 3KPWA 1XLTA 2AH5A 4QYWA 3ANXA 3UXMA 4IGAA 3W6PA 1XD8A 5HQ3A 1SC1A 3VR3A 4KFUA 3TW8A 5C7OO 2I7TA 3AF6A 2AI3A 3NH6A 5AI4A 5K3DA 4R8MA 2HH9A 2GM9A 1VPEA 2X2OA 3FCAA 3HNOA 2JIOA 3Q1KA 5IJ0B 1C3LA 1XMJA 3N58A 1XVUA 1H3NA 3RARA 1ESEA 1PEAA 4ETMA 4N47A 1TA0A 2VRNA 3EFOB 1EVKA 4EELA 5JH7A 1Y8QB 4HX2A 4RE6A 3H9JA 4E70A 5SZJA 4CKBB 2PPVA 2ODPA 4ZAVA 4JVLA 3IR5A 4MWGA 5I5EA 1XFDA 2I6QA 1A2OA 2LKCA 2QP3A 5A5VA 2A9QA 2YHIB 4HBZA 2HRQA 1QSGA 1QIKA 3IA2A 4HJRA 2TYSB 2JK1A 2O50A 2QG6A 4MEJA 5AOCA 1MJNA 4DBZA 2W4MA 3GP8A 1IZYA 2GDZA 4QFMA 4DXDA 2IV2X 3HRHA 5CT6A 1DTSA 2QSZA 3B82A 4L9SA 4QT4A 3QLVC 4Y6RA 3CE6A 3OPXA 1U9CA 2YXDA 1CUHA 2AMVA 1TEZA 1TTPB 1NXWA 5THKA 3GYBA 3RUCA 3RASA 3RYHA 4BO9A 1G291 5AKLA 5DO9A 1YJCA 2GKOA 1OHHA 4LWQA 1P0CA 2P2ZA 2P2FA 3C6XA 3R7WB 3ZY2A 3SYKA 4RZUA 1E6CA 1AZSC 1J23A 1FRNA 4GKVA 4JC8A 4CIBA 2B8NA 5EIXA 2B1RA 1MNAA 1W19A 2EX1A 3GRVA 4FYXA 2V7BA 4O0LA 4A3SA 1IVNA 4TMFA 5LA6A 1PJRA 1A9XB 3ZHVA 2NPFA 3PNPA 2OSVA 3NM6B 3RS7A 4CM9D 4X6UA 4MIKA 2O1SA 1NR1A 3GJ0A 1C3EA 1VI2A 1D04A 2Y3IA 4P3XA 3NAGA 2W8BA 3OSUA 1OASA 4UVEA 1XJCA 2IOHA 1C9KA 1L5KA 1ES9A 2ZYAA 3W6OA 3I9MA 1NWHA 2OXCA 2ANBA 3R0JA 4C0KA 1WU8A 2QUIA 1BOOA 2HREA 2VHUA 3HACA 5CW1A 2SBTA 4YGYA 4IIVA 2EATA 3DEYX 5EMLA 1OXVA 1KDYA 4QUGA 5B58C 4FGJA 1YAJA 1CJMA 1F6WA 1PT8A 3GU3A 3JAMA 4FD2A 2GPBA 1VSVA 2JDIA 1V8BA 1FFHA 1PR9A 2YMMA 2HUNA 4ZVKA 4EHNA 1FDTA 3S2EA 2QR3A 4NAHA 4ZD6A 1Z4PX 1WDTA 3PPYA 3KUUA 2RIRA 2G09A 4WCFA 4XB2A 4HVLA 4G65A 2BM9A 4TV8F 1WWKA 4NMXB 3E7DA 3D6TB 3EZ2A 2WJZB 3KL4A 4ND6A 5B58T 5JY1A 2BFDB 2C0QA 3DOUA 3PFNA 4X6YA 3PXBA 3T5MA 1CF2O 2W6OA 1SHJA 2O5VA 2F1JA 4BX3A 2WSSA 4LTMA 1QTNA 3E9RA 5CTAA 1YJ8A 1M6XA 2PKEA 3H3JA 3VR2D 4DIMA 4HQKA 2XA9A 4ZIRA 2QGZA 2ZT7A 1CS0B 2MOKA 2R66A 2PD4A 4B35A 1B43A 1D0VA 2XUQA 3JQQA 2W70A 3N8DA 4BIMA 4RTSA 2VF4X 4PHTA 2GA8A 3OZUA 3FTNA 3BULA 1U6JA 3PUWA 1R00A 2DULA 2FW8A 1JJFA 3QPDA 4G0OA 3V2UA 1X7YA 1W96A 4JUAA 3OJ0A 4N7RA 3QLTA 1Y9JA 1SUIA 3BS4A 3H1BA 4JIGA 2QTVB 1U31A 5ALLA 1R8JA 1RAEA 4JGIA 2ZUWA 2NPIA 1C7RA 1XZKA 1F12A 1V6SA 1OFTA 3CNHA 3DHEA 3NHSA 4WL0A 2RAVA 2QRPA 4UATA 5IJAA 4DWWA 4Q7QA 4R2WA 5EZ6B 2UUAB 3CU5A 4P3PA 1LB1B 1J1ZA 4IGKA 5ALTA 5K6AA 1BXKA 1G3UA 1Z47A 5K85A 3HRKA 4KE6A 4PBRA 1EGVB 2BLNA 1I3CA 1QG2A 1X7WB 3H5OA 1RJFA 1MT3A 1O94A 3F6CA 1JDVA 3LWZA 4IZIA 2RCYA 3SAJA 4MQMA 2HA0A 4P4LA 4HAXA 4XE5A 3MN1A 4OIFA 3EE6A 1P3DA 2XA1A 4CLDA 2ZVJA 3LA8A 3K70C 2IF2A 1JA0A 2OR3A 3ILVA 2B8WA 2D7DA 4X1IB 3TF5A 2M1ZA 2F3QA 2J41A 3JQ7B 4P36A 2FP3A 4EATA 4XJVA 4X94A 5J5AA 3TZKA 3E2IA 4C21A 4WW0A 2QJFA 2C92A 2O0LA 4RGYA 4Q82A 4OB8A 1KYQA 2HQBA 2X0IA 4GYKA 1Q57A 3JALB 2NU8A 3ZUGA 2JJYA 1DRJA 4FTWA 2ZBQA 1AZLA 1AK1A 4TUYA 4CMIA 1NJFA 1NYLA 2VP3A 3CNLA 3HXPA 1NE2A 4MKIA 4AVYA 5IWCA 1K4KA 2PNFA 5I9NA 3FI0A 3T12A 1F1JA 1WRBA 2REOA 2D1YA 3HA2A 5ADVA 4KL8S 3PGA1 5IFKA 2PMFA 2MSEB 4XPIA 4JLDA 3G23A 1HOXA 3RUIA 5FH9A 4Q37A 2JCBA 3RNOA 4Q05A 4HWRA 1K92A 2OFOA 2IHBA 1UT6A 4M4SA 1XPOA 5AOAA 1GFWA 2MSDB 3QMWA 4CCSA 5JSUA 2XXAB 2WFZA 1OA1A 1P8JA 3QSYA 2F1HA 5DNDA 1HSZA 4Y9SA 3SQXA 2DY1A 1PNVA 1JVBA 3N2KB 5L6MB 4R9VA 5CA1B 3TLGA 1BMFD 4OP1A 1P4SA 5JV5A 3ZC3A 1SEPA 3WGIA 1B16A 1NC1A 3ON5A 1J2TA 3MTIA 1N6KA 1LI7A 2OAP1 4LRYA 4QX6A 3CLTD 3H05A 3HB5X 4AWAA 1EKXA 1KNQA 2YIJA 5I8PA 1ZKMA 3H9UA 1WBBA 3GGJA 3Q72A 3WNCA 3VR4A 4TMXA 5BR8B 2GCIA 3ROQA 3WDSA 1T2AA 1JR3E 4ALNA 3BSWA 1N2ZA 1MV8A 4ZT6A 2I7VA 1V5EA 3RTGA 3IE2A 3GRKA 3ED1A 2AYXA 1NONA 4KC0A 1ZOLA 4WACA 3W9YA 4BYMA 5P8WA 2EKPA 4BO2A 1OBFO 4D9FA 1L3CA 5IJ0A 3MINB 2QRJA 1AVTA 1LK0A 3KJZA 4HAUA 4HAWA 1R1DA 1QJ4A 2Q62A 7REQB 3LTNC 1F0YA 4TV9B 3I1FA 1P0PA 1VJ1A 3RU2A 2PRYA 1TB4A 1Y8QA 1DC4A 4FNOA 2F9LA 4ZVOA 4CKBA 3BC1A 1XTSA 1G6OA 4OLAA 1HYBA 2PT6A 3D3JA 2YHIA 3IP8A 2AK3A 4RF3A 4MW6A 5EJ6A 1TMKA 4MOWA 1KBQA 2CDNA 1T1SA 1GAWA 1VSQA 3K5PA 3NEAA 2P6UA 1LI4A 3K0FB 1JAZA 1O9BA 3GRPA 2CFSA 2C9BA 2YR0A 2P2MA 3PICA 2MMAB 2PMKA 2GNPA 3H65A 4LOIA 1Z8NA 3FHOA 4M7OA 1LU9A 2W5UA 1ADYA 3M89A 3EVGA 5ESWA 1RQLA 4W5OA 3IE1A 1TIPA 2AT1A 4OH7A 1U98A 4JLNA 3KWFA 4M9CA 2ETVA 5ESRA 4CKZA 4AMVA 4U8HA 4C0WA 2A2ZA 7MHTA 1O93A 1XROA 3A0UA 1NV8A 4QATA 1LPAB 2PKXA 1ZX1A 5IX8A 4DV5B 4PC1A 2J3LA 3E03A 2H08A 4JLWA 5IULC 2GPAA 1FBTA 4II3A 5LIRA 4AQDA 5T67A 3H2HA 1A9XA 5KMGB 3ZHTA 4E3WA 2QUKA 4I6GA 3IIMA 4DA0A 1JG6A 2NQ8A 4P6VF 1EFLA 4B3CA 3S68A 2Y76A 4O0MA 3KRTA 4RSHA 1GPLA 2XWJI 1VP3A 1W2GA 1E99A 1CJSA 1C3VA 2X5KO 4Z0HO 2P5TB 1ODJA 1PT9A 3E2PA 3GJRA 2A33A 2I6SA 4C0AC 5LJIA 2OGSA 3QE9Y 4B5LA 1YONA 3C8MA 3OWOA 3VQTA 4IZHA 4MQ5A 4II7A 1Y5MA 2PSFA 2HV9A 3WGOA 3KETA 2VPXA 3E9MA 1LJLA 4HZUB 4MKZA 2RGYA 1SOWA 1KHTA 4BEWA 4GE0A 1I7NA 5FA5A 3TFWA 3HY6A 3RRZA 2H4JA 4EB8A 4B6QA 5EINA 5IJZA 5TPZA 1Q7EA 3FB1A 3OPNA 3IEKA 4JB8A 2E5WA 1YJ7A 2ZUBA 2DWOA 3GFTA 1D03A 2EDCA 1JR3A 3LX4A 5JYBA 4M8LA 5KTSA 4OLJA 1X14A 1JEAA 2NO9A 1H9BA 2H7YA 1J09A 2PHZA 4FUQA 2J1LA 2HDNB 1V4VA 3GLUA 1IBLC 2YVKA 4Z9YA 3G9TA 3BWVA 1VGVA 3RVKA 1J8VA 5MFZA 4BO8A 2BCEA 3LBHA 4UBMA 1XO1A 3TSYA 1UOEA 3O95A 2YXLA 1CS0A 5GGXA 1ADCA 1D1QA 3UGTA 1EX1A 2L82A 5AVQA 1NDQA 2PZAA 1HUQA 4FOPA 1OUMA 5D7BA 1O89A 4GT1A 1XN1A 1NN3A 1NBHA 3KUCA 3N59A 2X4DA 4GMHA 1DJMA 1NR7A 4NMMA 5CEEA 2JVIA 4EBFA 1L5SA 1CPYA 5H16A 2IH4A 2QTVA 4YS6A 2QHXA 3FYCA 4QVIA 5ICFA 2ZWMA 2GRJA 3OEHA 1D1SA 2BEKA 2PUBA 3O3MB 3PGJA 2WWIA 3E9DA 3NB0A 4F5EA 3JQAB 1Y9AA 4DQLA 4M3NA 1FYXA 2R7KA 3WJ7A 2ATXA 2GRAA 3C7TA 3DE6X 1ZUIA 2PV7A 3DOIA 3KX2A 3WYEA 2E1RA 1BVUA 2EWMA 2QP9X 2XF8A 4QPPA 1LBTA 5REQB 3W7BA 2AOTB 1ISPA 1OFHA 4NF2A 3RUDA 3I83A 2F00A 3N5KA 3WRVA 8LDHA 1X7WA 2JFWA 3R5KA 3RBVA 3TLZA 4LFBB 1EP3B 1XQ6A 1V41E 5CGZA 1HV8A 5DGIA 1UBJS 5EFZA 4ITRC 3RRYA 4BL5A 4EW3A 1Z82A 3KZMA 1C1YA 2HNAA 3F7TA 4ZOBA 5BYBA 3UICA 1SCDA 1WTAA 1M6VB 3ELUA 4QFBA 2F8TA 1R8QA 2D2EA 1X8XA 4ZZ1A 3JYHA 4X1IA 3JQ7A 3D8UA 1IYZA 2R11A 3ENQA 1HMPA 2IKSA 5EHXA 3TQIA 2BKVA 1A1SA 1PNRA 4GWGA 4XIFA 2X0FA 1AS0A 4H4EA 5TX7A 4O59O 4B3MB 2DFKB 3IVGA 4NIMA 2YS6A 3LPCA 4FHZA 3JALA 4W6ZA 5CH5A 1BFDA 2PRSA 1KSGA 3BDVA 5A03A 1QFXA 3LO5A 3V6LA 1P3Y1 1X1AA 1SQGA 3BQ9A 3DOCA 1WNTA 3GGDA 2GTPA 4IINA 3V2HA 1QDLB 1B6GA 2ZRMA 4NHEA 1KZ6A 2EKBA 5E2IA 5HK8A 2BISA 5BT9A 4BQPA 1EJ0A 1U8TA 2CUKA 2FPWA 3M2TA 1B8VA 1OCEA 1XP8A 2VHCA 3KO8A 4EH1A 3GARA 5HOQA 5HSGA 1YGYA 3N6RA 1OB2A 4B4WA 2CMFA 4Q7JB 2QI9F 4NJEB 4MLCA 1XNQB 4XD7D 2XXAA 4IX9A 2BUCA 4GYWA 1XTRA 2QM0A 4AJ1A 5CB8A 3O0DA 5A0FA 4MUYA 4Y3UA 3O4JA 3O1LA 5HCIA 2OYCA 2IXDA 3N2KA 2FSVA 2DCUA 2FUKA 3D4BA 3HV0A 5CA1A 3CM0A 3S8EA 1ZIXA 2EGHA 4RESA 3K7EA 2FPXA 2IWRA 1OV4A 2C1EA 4JEHA 3G68A 2PJUA 4PANA 1AV6A 3P2IA 4ZGWA 1K8QA 2QOEA 5F3WB 2BDTA 1E1YA 1U3TA 5F4BA 4F11A 4MLPA 2WIKA 5C35A 1VHQA 2PUWA 5KYXB 4NCIA 5CIYA 4BUJA 2OWEA 5L7YA 1N2BA 1KR2A 2TSYB 3PLNA 4AMUA 4GLOA 4TKUB 4BX2A 1IBCA 4L9WA 1ZLXA 4F2DA 2HA6A 3M5CA 5L3SB 3EQZA 2Y92A 1YA6A 2NMVA 3QKUA 4U8GA 4Q0MA 3QYPA 4P31A 3ZGNA 1KZ4A 2VYVD 5JDCC 3ZU3A 4E7PA 4QICA 3IJ5A 2ZJ7A 4LRWA 3MINA 4M36A 4ASUD 4G0MA 1GA4A 2CVHA 4QXMA 3S5JA 2B99A 1G42A 3SIXA 7REQA 4L5IA 4TV9A 1AJEA 3ZKWB 2H2HA 5EE3A 1BHQ1 1IIRA 4G1VA 3EFEA 2XIQA 5D1NA 2EJVA 4IHAA 5DYWA 2ERXA 3RFFA 2GEBA 5KHOC 5E8RA 4YUZA 1GCIA 1QK4A 2GMWA 3PRKE 2FG5A 4MCIA 4QYMA 1R8SA 3P9ZA 5T57A 4OXIA 1DWUA 1PUJA 4QEKA 3T4PA 4UMEA 4C0HA 1KEKA 1P1HA 2ZWVA 3K0FA 3L01A 1Q6YA 1M67A 3KOXA 2PS3A 5IC4A 1E3SA 1J56A 1F8GA 2YZ7A 4DV7C 3WYFA 4EPTA 2JI8A 3V5NA 4TTSA 2V65A 5AKGA 1MT0A 1I8TA 1P7PA 2VWQA 1Z4NA 3AWIA 2QLTA 4KR2A 5A2GA 2R48A 3QVVA 1Z4QA 4LHSA 1KO1A 4IXDA 4KPUB 2WJWA 3TQRA 4OLHA 2PMCA 3DBIA 3EXIB 2KE5A 4QUJA 2OAQ1 1N1DA 1YQGA 5LP6B 4QC2A 4DHWA 1EYZA 2HSZA 3D1VA 3TIVA 3K92A 1S3IA 4J3JA 5KMGA 4Z7NB 5FOTA 2ZS9A 5T8KA 3AWDA 5DK4A 2Q7DA 3I61A 1GSHA 4GDMA 5KVCA 3VPHA 4RTNA 2IU0A 1GLGA 6ABPA 3MD9A 1CUEA 4BV8A 1Q6ZA 2QRNA 4PG8A 3W5SA 4HWSA 4BX8A 4P4UA 5JHHB 1VG0B 3VHQA 1GAQA 4LJKA 2H4XA 5DHQA 5DWDA 1HNXB 2VTBB 3DR3A 3AZPA 4IQFA 3RS8A 1WSAA 1VRVA 2Q5EA 4OI4A 1ML4A 5FD8A 4H1TA 1AQ6A 3RG2A 3HCAA 4YHBA 4BFCA 1ZD5A 1VE9A 3FYSA 5HW0A 2M32A 4HZUA 3A28A 4JI7C 2QN7A 2Q6KA 3DLAA 3DUWA 5DMXA 3T34A 4AO8A 3UVEA 2OZPA 2G08A 4YDRA 5B1HA 3U48A 4BBYA 1U1CA 4ZO6A 3K3PA 1C5KA 3DA8A 1DCMA 3FGNA 3PDWA 3VTKA 4XR9A 1MRZA 4DAOA 1IBMC 3PFBA 3AIOA 4PWZA 2WQZA 1Z28A 1L9KA 3KT3A 1PJZA 1RRKA 4JLOA 1B15A 1Y1TA 1HXHA 3W0LB 4AP5A 3RS4A 8ATCA 5JIBA 3A1CA 5DCYA 2MT9A 5JSYA 3UN1A 4GZ5A 3ER9A 4ZVVA 4DLNA 3I2HA 4Z86A 3VYSB 3UUEA 1YO6A 3GUZA 2DPXA 2WJPA 2H52A 3Q7QA 3AHHA 4W9MC 1J25A 3CV3A 4LFCC 2A9PA 3KOYA 2Q5QA 3TM4A 3CKKA 4GYJA 3DO5A 3FGPA 1SQFA 3JVDA 4DM7A 2JIMA 1N3IA 1GT6A 4L22A 1XDUA 2CXCA 2C59A 2VWPA 1ZK1A 3NZEA 3EASA 3P2KA 4ROTA 1Z56C 2JBAB 4L2IB 2C4KA 3F9CA 3PGXA 3YASA 3K35A 5ELMA 4PROC 4DS3A 1WSWA 4EUSA 3ACCA 2H2DA 3VZQA 3QPCA 4I1RA 2IEIA 1BQ4A 2WG2A 4DGQA 1V4BA 4PIVA 1BGXT 1PQWA 3BWMA 3MJEA 2O2CA 2YC4C 1CY8A 4B45A 3UG6A 1TKCA 1AM4D 1EFUA 3IXQA 3QVKA 4U2CA 4UUNA 5KYYB 3A31A 3AYXB 2Y05A 4TXLA 2FRVA 2JJMA 4P81A 5IAGA 5JCOA 3WKDA 5KNDH 2Z83A 2OM2A 3JQAA 5EP2A 1P1JA 1XKXA 1XHFA 3NHUA 3WP0A 4CCYB 4FGWA 2PZKA 5EMJA 4R84A 5JO9A 4P4TA 2NZXA 5CJJA 1L4GA 3CH4B 3QU5A 4HFJA 4RSGA 5REQA 3TZHA 1HT3A 2AOTA 2FY8A 4RVFA 2DTXA 3KSBC 2JFNA 5ILOA 3EK2A 1E5TA 3D4OA 5M29A 4M60A 1PFUA 2CUZA 1M0SA 3OOSA 4MROA 1FUYB 3FNHA 5EZSA 3KWJA 4G5QA 3FDIA 1I9CA 3B3QA 3A25A 3IOYA 4C9BA 5K8IA 1A72A 1LV7A 1V96A 2H00A 3KJGA 3RRMA 1KRHA 1ZPDA 1CYEA 1RYDA 4EG3A 4LSWA 1KRXA 1ECLA 2VXYA 4GWKA 1II0A 4ZEXA 1F9AA 5PNTA 2FU5C 5JS1A 1REQB 3LLVA 2IHNA 2AN1A 1X1RA 1NAHA 3AM5A 3VDNB 4IIBA 1RJ9B 4BO7A 4AY6A 2XGGA 1A71A 4R16A 3T7JA 5JCXA 1NKVA 1TYEB 3NHFA 3M6WA 4LV8B 1MAAA 4TMWA 5HKBA 2GAJA 4IFIA 1U11A 2FEWB 3F97A 4H4DA 2FWAA 4RE5A 5EIFA 2H48A 1V25A 2I3AA 4A8JB 2KM1A 2J0QA 1KIMA 3C7AA 5FTKA 2GESA 1BXZA 4HX9A 3MCAA 4ZMSA 4EOGA 2ONKA 4Y2HA 5D7NA 3HJGA 1JR4A 4D1YA 4BB9A 2ZSIA 4NJEA 1OF1A 3W5IA 1K9SA 3L8CA 2RHHA 3DVQX 5IMBA 3CF2A 3RBAA 1PD0A 5BQOA 3BBPA 3O3CA 1J2YA 5C1DA 2GPJA 4RZHA 4D4MA 2MM9A 2GWRA 5IUJC 1Z0FA 2V7EA 1QVWA 4P80A 2OCIA 1BWQA 3EVNA 1W4AA 2HJWA 3IQFA 1R8XA 1RHKA 1JI0A 2EHJA 3I23A 2WJGA 5C5CA 2Q5IA 3A6GA 2OXTA 4NEHB 5B2FA 4UTXA 5BT8A 5KJFA 1A5BB 2P75A 2Q41A 5EZYB 3EGDB 3C3BA 3L4BA 1NSFA 2FUNB 3AR2A 3OETA 2DBQA 3ZEAA 1S9HA 1UWLA 1TE2A 3AVXA 1SVWA 5KYXA 1OTYA 4YY3B 3DF7A 4RXTA 3I07A 1P2BA 2BUBA 5CDUA 3OIFA 2RKBA 4JMLA 2GBLC 4TKUA 4HQLA 3R7SA 5FDFA 3ZOKA 3JQFA 4G56A 1FVOA 5JNTA 5L3SA 3EIWA 3AUTA 3JY6A 1FP4B 4XVQA 4I8DA 2DPGA 5H9VA 3FHJA 4Y1RB 4RIFA 5H8WA 1ID1A 1SXHA 3WLHA 1BVHA 1C1DB 4UVHA 2P2CA 4GOXA 5DXJA 1G2QA 4YWHA 1DT3A 3OICA 5I3CA 4Y2XA 3CC8A 2RGEA 3CZPA 3ZKWA 3U16A 4YRTA 4L9RA 2A30A 3HA3A 4RHCA 1EUZA 1GLVA 2AN5A 3AKYA 4DCSA 2R87A 3AZQA 3EZYA 3NJ8A 4ND7A 1JDSA 3W1WA 4C0BA 3OUTA 2UKDA 1YK0A 4UEKA 1AIPA 4BC9A 4QXAA 4YUYA 4RULA 4PR0A 3DL0A 1AQIA 1ZN7A 4BN4A 1PD1A 3C3PA 1W49A 4PNPA 2WHEA 3FNGA 3OSZA 4UDXX 2QZ9A 4ZZIA 4M1ZA 4MJXA 5BNWA 4RTJA 5EXXA 2P9CA 3FNRA 1TW2A 4W8OA 3ZDZB 4A4DA 1FMFA 2CDCA 3D7SA 2GK4A 1PW7A 3NBQA 3BE5A 4OHPA 1ZW6A 2RB5A 3PE6A 4Z7OB 4IS3A 4INZA 4M7WA 2KI5A 3FMPB 2YOGA 1L7MA 3GLIB 2P4UA 3H04A 3G8BA 4PUIA 4KPUA 5C18A 3P0FA 1TAQA 4LDAA 4NHOA 4P0QB 3EXIA 5KU7A 5LP6A 5TS3A 2WJVA 4WBSA 4EYSA 3QOFA 4R2KA 4IDDA 1ENPA 4ZDWA 3Q98A 3KXKA 3OZSA 4RJLA 1T4MA 4GNKA 2UYCA 2QV0A 3ER8A 2R6JA 2WAXA 1MA0A 3I1IA 2J6IA 4OFXA 5JS6A 1O92A 5BR4A 3EDYA 2X4IA 1Y1QA 3ZWCA 3KQTA 4PQFA 1X2BA 1XCBA 2P6PA 1X1BA 1C4OA 3NC1C 5E8JA 4MV5A 1N92A 2GJSA 3ADKA 3IAAA 1NPDA 4KN9S 5A4AA 2BHSA 3A3OA 3S1AA 1KR5A 1VKZA 2F1OA 2QJWA 5C1BA 4CNBA 3KYDB 2VTBA 4DR7C 5DI9A 4LDNA 4XAQA 3PQ2A 2QU7A 3RUEA 4HYTA 1XZFA 4XZ3A 2QX9A 1JEDA 4X9XA 1XJWA 3VSEA 1IWBB 4B7ZA 4TTAA 3I4FA 1YD7A 5A6VA 3HO1A 5L3RA 4C0LA 3EN0A 4MPTA 4YJDA 1NVWQ 1ZU4A 3S44A 1W4ZA 4AECA 1T9GR 2FUEA 2BHTA 5IC6A 2CUTA 3UCXA 4KXQA 4RTQA 1TYBE 2IXTA 4YV2A 1I4TD 1UK6A 1EI9A 2OV2A 4KHPB 3MGCA 3TQSA 1BS9A 4PLZA 5DCLA 4BP9A 4WJLA 3GAFA 1PGNA 4CM1A 1ZN9A 5ALSA 5LXTF 1O6ZA 2GZ1A 1IJFA 4WZZA 1MXHA 1IB0A 2FFQA 1CY2A 2Y67A 2JVJA 3LW8A 3OH8A 4P35A 4QRIA 2C9ZA 4H3KB 4OTZA 4Q9AA 2OFWA 3ZVRA 2XGJA 1CETA 3C97A 1QHSA 2Q6LA 1PV4A 1RW4A 3CX3A 4JP1A 2FW6A 3DE1X 1G9TA 1Q83A 1DCTA 2QRKA 2OSBA 4XTCS 3EIEA 1SQ0A 2VP5A 4JLSA 4QNNA 4X41A 2Q07A 5C34B 2JANA 3EXHB 4A1FA 4C30A 3MJFA 4X60A 2JBAA 1WZIA 2M2IA 1L4BA 4OLBA 2WTBA 5HXAA 4DZRA 1BAPA 4B4KA 2G88A 3HO8A 5BW4A 1ARZA 1W88B 1YR1A 2P5YA 2UUPA 1IOVA 2IS1A 4UASA 4G8DA 1DZIA 3LL7A 1XR3A 4GKBA 5KYYA 2XHZA 3JPYA 1FUEA 3U13A 1KYZA 4NH4A 1XEWX 4L8GA 1KQPA 2XDYA 2YBDA 2ZIGA 5DX0A 4CCYA 1ZNQO 5CIWA 3CWZA 3OIGA 4K6OA 2QZPA 1ZD4A 1F4VA 1DWOA 1KZ9A 2GX6A 3CX6A 3IQIX 4W99A 3QA3E 2W6CX 5I01A 2BD0A 2ORED 5CFZA 1T5HX 121PA 3FCEA 3H19A 4RO0A 3I30X 4D8YA 4BIIA 3VU1A 4IYJA 2P2BA 4HTFB 1JH8A 5E9JA 3SZ3A 1OT3A 3N7UA 1DEXA 2Q7XA 5C0OE 4O3MA 2JAWA 4BBAA 2GBIA 5JAZA 6YASA 3NTRA 4C0JA 4BCAA 3BK1A 4GC5A 1CG6A 3T4UA 4KQ1A 3VPFA 1IJKA 1L7RA 1K27A 2ON6A 1NURA 3MTJA 4DJJA 5A2QA 1YQWA 5J4YA 2FI1A 1U80A 5G53C 5TQ0B 1REQA 2GPTA 3BXXA 4JN6B 1RZRA 2Q7OE 3GLIE 1OI2A 1PDVA 2R7NA 5DBGA 3S2UA 3CR8A 2YV2A 5ECWA 4CG2A 3THYB 2VPIA 1RJ9A 3DM9B 4E94A 3L82B 1W7AA 3FYUB 4BQRA 4EBBA 4Z0TA 5G0WA 2VNJA 5JDIA 1U0NA 1KO7A 1FE8A 1JB1A 2IX9A 4PPNA 5EXPA 1DKMA 4Q1CA 4MQLA 1E1RA 4A8JA 2G82A 4L57A 4AY4A 3MLEA 4MVJH 4I7EA 5D6OA 2QQEA 1E2IA 4LOLA 3NC4A 1MVOA 3C8UA 4EJSC 4IXWA 3KXPA 3U9TA 4MVJG 3WK7A 3ZY6A 1VKNA 2GFHA 1MX9A 4HLDA 3OG9A 1MFPA 2LR0A 3G3EA 1H65A 4IS2A 1AQNA 1LTQA 3KKMA 2JS7A 4DPMA 2IOFA 4YXWD 3B2QA 2I80A 1B26A 2WU4A 3IHWA 5JU6A 4J6FA 2JH8A 4YXFA 3FA2A 4RD4A 2IYAA 3PNBA 2ZANA 1U8XX 2CLKB 2EIHA 4ODJA 5BNFA 3ESXA 3GUYA 3HCWA 4BXOA 3KB1A 1MENA 2O0HA 1L8OA 4K1LA 4TS1A 4F56A 3KLBA 3DPUA 4LPSA 5EZYA 3EGDA 2XJ4A 4KVZA 4OOEA 5HF6A 1W25A 3HFRA 4TXHA 3R20A 3S5UA 5D84A 1ZIOA 3DFKA 5BUSA 4DMGA 2R751 1BDBA 1I24A 4LEIA 4I3GA 3P52A 2HK8A 3LIIA 1QYCA 3EXHC 2P91A 3C1OA 1FP4A 4TWRA 4J7CA 1D2HA 4JQSA 1CDDA 1O57A 2D3WA 2IPAB 2YX1A 2IZ6A 1GP2A 3LWNA 5SY9A 2W2LA 1J90A 3IRVA 3PRHA 4Y1RA 3TRJA 3FPKA 1R0LA 1VLHA 4OI0A 1C1DA 1PQ4A 4JUFA 3W1VA 2HMUA 4ZPXA 3WKCA 1QR2A 5AQ1A 3QVOA 1Q1AA 3DT6A 3FZGA 1WXIA 1NBEA 1PYOA 3E61A 3TSAA 1FPMA 3D6NB 4BNIA 1PBNA 5L3QB 1KPIA 3IDZA 1JPNA 4Q4AB 4UAVA 2QZSA 1L2TA 5GTDA 1YZQA 2BM8A 4G9BA 1R88A 4E5VA 4I0WB 5JC1A 3DE3X 1PCXA 3LECA 4IOMA 4PC7A 5TPWA 4ZGBA 4LF7C 4R0NA 4R1OA 3DOFA 4DR2B 3DULA 3OE7A 3OT4A 3DHWC 5DGXA 2XDAA 2G06A 2MINB 2XE4A 3V1LA 3T5GA 3K9FC 1LS1A 3RWBA 3DC2A 1YB5A 2OBXA 4FR2A 4M87A 1H4VB 2GNOA 4MW2A 1JR6A 3CA8A 4HDNB 5KYUB 1OPRA 4RNCA 4JK3A 1PNQA 2JFVA 3FWYA 5IK2D 4JKYA 5K0LA 5DE3A 5DHAA 5COAA 1N34B 3COSA 4XJTA 1RXCA 4JLJA 5AE2A 4D74A 1RXEA 2V45A 2XNHA 5K05A 5DIFA 3GLIA 5AR1A 5JAMA 4TYYA 4Z9FA 4F97A 1O1YA 2ZS8A 4J0IA 1E98A 1FNMA 1M1UA 3ILXA 4LZNA 4RBNA 4BE4A 1Z4MA 4D9IA 2HPVA 2PU5A 4LWOA 5L51A 1C0IA 1T5LA 2OEPA 1R3DA 4L5AA 1RWVA 2VK2A 5K45A 5LNK1 2FKNA 2XYPA 4EI7A 2AA3A 3FYUC 3DXZA 1YIDA 2BE9A 1KMQA 3IVRA 2V96A 3CUEF 1RM0A 4RZXA 2PU7A 4CODB 3L79A 1NNI1 2ACEA 1K98A 1M54A 5JSFA 1UL1X 2QE6A 1ESDA 1I6KA 1OVGA 2CNNA 1CVRA 2UVDA 2WT9A 3LDAA 3KB6A 4NYJR 1AU9A 4DR3C 2HMWA 3WRYC 1U63A 3T3GA 2JKYA 2WD9A 4QM6A 3KYDA 3PG5A 1NVBA 4BFLA 1C41A 3DWIA 3I42A 1Z17A 4OREX 4DLKA 4KE7A 1AHHA 4GVLA 4RENA 3C98A 1L7BA 1PR0A 4KIFA 2YVAA 1MX5A 3OPMA 4KXWA 1G5HA 4ZVRA 3PIDA 3TK1A 3KFXA 1VZ2A 2A0WA 4JB0A 4Y0VA 3WLAA 4EAAA 3CW9A 4WGGA 3Q3JB 4HDKB 1W5AA 2Z3ZA 2GVZC 3AFMA 4JT4A 1ZYUA 2WHPB 3N54B 1MH1A 4QU0A 2HIAA 1MJFA 5LLTA 1CJVC 1VPLA 3RJ9A 2CJXA 1MLDA 1MVLA 2PRJA 1JXOA 3MBOA 4K9MA 4XX1A 3WB0A 4GZ6A 4AKGA 1GQRA 3E6AA 3BMNB 4MVYA 1NNEA 4GP7A 3GDFA 3ZCSA 1DKRA 4HLNA 4CCWA 3DQPA 4X1OA 2CYAA 1TKBA 1IY1A 1QPZA 1PL0A 2X22A 5T5QA 3U2QA 4ZYWA 1PS0A 2Y68A 3A2NA 4CF3A 2VZ0A 2H6EA 1DIOB 3ZNNA 2WYUA 1H0RA 2GN8A 1X0XA 3FSGD 5ELLA 3BRQA 4R7GA 4FGLA 2JJ1D 1RTTA 1QHHB 4J0CA 4EZIA 4NFYA 1Z5UA 4CRWB 2ECPA 2DUNA 4RH1A 7ABPA 5JT1A 1LPSA 1BTOA 2NG1A 4B47A 3GEGA 5DVZA 1W88A 2IBMA 1NQ5A 1U1EA 4L1KA 4LN1A 2FF7A 4FE4A 1XV5A 1SXJC 4COKA 2VHYA 1M10A 3QLUA 1HBJA 2ZTLA 3V00A 4ZALA 4DR2C 2H3EA 1DDIA 3CXRA 2OORA 4BVEA 3GGPA 4IGIA 4DNQA 2PT5A 2C7OA 2HO5A 4J0EA 4UZSA 2VQSA 1MB4A 1YRQA 3DH0A 4DVJA 1KDOA 2JLRA 4FD3A 4Y6GB 3TTWA 4AZWA 4W9NA 1JEJA 4CKWA 3I01M 2HADA 1YRHA 1NM5A 1DXHA 1QO7A 2FFJA 3CNEA 3TB4A 2M98A 1LZLA 1T4GA 3OCCA 3KR9A 1SCKA 1ZS9A 1NUPA 2HQOA 3BSYA 2YFQA 3LHKA 4WASA 4WNCA 3IMEA 4HTFA 1MPXA 2NO5A 4R1LA 1G3MA 3I5MA 2WY2D 5CNKA 4RTRA 4JI8B 2IYPA 1E2NA 1PSWA 4FCVA 5M7EA 1N0WA 4Q9HA 4BYGA 1PW5A 5DYYA 3DB2A 3EG5A 4O3FA 3W34A 3QW4B 5LQAA 4LAFA 5KB3A 2ZIAA 1GZDA 1RE0A 1HE2A 4C43A 4GM1A 4ZK2A 5IU6A 3AO0B 5TQ0A 3BK7A 2FX5A 4GP6A 4KWCA 4UE3S 1YZVA 3EPPA 2Q0QA 4C4XA 5BSEA 4FWBA 1HE8B 3E1GA 5G4KB 2HPHA 1P7LA 2IZZA 1BKYA 1NJ2A 2XA2A 4Q6WA 4KRYA 2A6PA 2Z8ZA 1EJ2A 2PJDA 4XSHA 1EHCA 1F4LA 1NI5A 3O2SB 5FBLB 3RAJA 2BAGA 4NCNA 3RSFA 3VXKA 4JZYA 1MX1A 1EVYA 4PSUA 3DVAB 2F1IA 2O2JA 3VHRA 4L7IA 3KSUA 1NSYA 1RYBA 3O8CA 4KJXA 4ES6A 1ZFNA 4QBHA 3U3RA 4E5UA 2JD2A 1R0SA 3CKMA 1EPUA 3DMRA 4G0XA 3RNLA 3HBJA 2M6LA 1ABBA 4A0FA 2Q3BA 1NW5A 3E48A 4WZAE 3AXSA 1JSLA 1X2EA 3RK4A 1A4RA 1E3JA 1FS5A 1RKVA 4HF7A 2ZXUA 5DX8A 2IGBA 3H16A 4G2NA 1BC5A 1Z12A 1KJ8A 3N2GB 4B75A 4G5XA 1GGFA 3A4LA 4WIAA 2GBGA 5BW5A 2XB9A 4JA0A 1XTQA 1YMUA 4LG1A 2CD9A 2OTCA 4EARA 4O4JF 2HY7A 4RFSB 3WHPA 3X1WA 1XHLA 2O3RA 4PYQA 3M4ZA 4QPZA 4RK0A 3TX6A 1U1GA 3WS7A 1XDWA 1ST2A 1QLWA 5AKKA 3CBQA 4EG5A 3RS2A 3JAWA 2KS6A 4FZ5A 2NVUB 1XZCA 3V34A 2QTBA 4UOEA 2BHLA 4BMVA 4RV4A 1T26A 1PX0A 1HDCA 5CX4A 5A5GA 2PEYA 3RHSA 4AG6A 2CU6A 2ZRAA 1RWPA 3EBOA 5E6SB 3T95A 2FZEA 3VHLB 2V74B 3KZVA 5FOSA 4CDRA 2R85A 3WWPA 4TYWA 1FFEA 4P3NA 1S9DA 3ORRA 5H3HA 2AWNA 1V47A 5BRAA 1RHMA 1KIAA 2IFTA 1NW6A 1BDHA 2IBSA 2RGNA 3HWSA 2NZVG 3ZCXA 1ZICA 4KI0A 4EG1A 1TRHA 4ZVTA 3O8BA 4Q4AA 5KQMA 3A11A 2JPDA 3EZLA 4YPOA 3OJLA 1HT2E 2G1PA 1OWLA 4UBLA 4CGYA 4LKOA 4DJTA 4KDRA 1PJSA 3D54D 4URZR 1GU7A 2B1JA 4K9QA 1COWD 1T9CA 1G5IA 4G8JA 3BJRA 5DMHA 2F4VB 1TM1E 1QANA 3QEBZ 4R2MA 2R4TA 1CY7A 4HDNA 2BVNA 1MIOB 2VDVE 3E7PA 1D0IA 5FCDA 1ILEA 4HDQB 2EVWX 1F3OA 4E51A 5A4DA 4NCBA 1BGVA 2V6FA 1UWKA 2FW1A 2W2QA 3NT4A 3OZ7A 4FWIB 2IS4A 1R9GA 4TMTA 1CVIA 4ZLPA 5AJYA 4BFTA 1J5XA 2FHSA 2G1AA 5CW2A 1LFAA 4RPIA 3V4SA 2BPOA 3BD6A 3ET4A 2ZE7A 3BRSA 1Y9ZA 4Y2GA 3ZWOA 1Z4IA 3GMDA 3GUCA 1AZTA 2ERCA 3H5LA 4HNUA 4DSZA 1IL0A 1ZI8A 1ZOPA 3LHFA 4K7JA 4N0DA 5E6RB 4MQBA 3B53X 3B8HA 1PHPA 4CT4B 2WVJA 2PUHA 2UUCB 4GMGA 1BU5A 1PSDA 2HMYB 2WTUA 1CB0A 2B4TO 5D00A 2POCA 1U0SY 4X95A 3O2EA 4MDFA 4YB8A 2P30A 4K1XA 4UDNA 1JLMA 2QD5A 1IWOA 5EEHA 4J16C 5NLLA 4L8LA 1CZOA 2LWIA 3BF7A 3GJ3A 4DLBA 3TSZA 3KU4A 1DTEA 1SIBE 2OLJA 5AJXA 5JAQA 3WRXA 2O8FB 3TAHA 4DY4A 3ZDEA 5BSHA 1SA0B 1G38A 1K5PA 3DLIA 3ESBA 4E1BA 3CTPA 2B6HA 4FFMA 1D8AA 2GHQA 3LW7A 4HDKA 2HAEA 3IBCA 4XQEA 1AN0A 2J7PA 2NADA 3HV2A 2WHPA 3JRWA 2JG3A 3AJ9A 2W2XA 4DUGD 5BY2A 2C5HA 3NAZA 1NBMD 2YL2A 3F1LA 3PNQA 1GKYA 5JH7F 5M04A 4X66B 4D9JA 4PQYA 1NUAA 2HXSA 1T9GS 3LX6A 1WDKA 1J22A 4UM7A 3BMNA 2Q5FA 4H7PA 4OYRA 1PAUA 4MR8A 1M83A 4QXOA 3VDXA 4EG0A 5E4JA 3WGHA 4E5PA 2AN4A 2FMXA 3SXUB 1SVUA 1H8ED 1USIA 2II6A 1J0XO 2FSUA 2JJ8A 3QBDA 4JC5A 4KJZA 2SHKA 4FNAA 3WZLA 1CHNA 4PZPA 3RYTC 4EYQA 2HOQA 4ZEMA 3H1EA 4Z53A 3LC0A 4GOKA 3L1KA 5C7IO 4DIFA 1M2EA 4RGVA 3RANA 4ZP1A 1HT1E 3I53A 3F5QA 4NCJA 4D98A 4QXQA 1D8TA 1Q2UA 2FN9A 3OF3A 1RS0A 2FK7A 4GUAA 4EECA 5CLJA 4YRKA 4JCOA 4OK3A 1A5TA 1USUA 5AKEA 2WZQA 5LMUC 3BXEA 3KJFA 1F2TB 3LQKA 4URWR 3R6TA 4LY3A 1RDFA 3D6AA 1CRQA 1F1BA 1ULSA 1V43A 2X5XA 5AKIA 1NQAO 3OPYI 5ERXA 4YUAA 2B30A 4I1OA 3KNZA 2SCUB 1E3IA 2JFUA 2XOXA 3ZQUA 3GAZA 4YPFA 5LA6F 3ZWKA 1U7DA 4MTCA 4Z54A 3EQ2A 4G1CA 1G5PA 3SC4A 2LCFA 4IG9A 1E6UA 1KA9H 2WJHA 2XCSB 5CPFA 1JKJB 3ESAA 1PJ4A 4MITA 2QAGC 5DLEA 1THMA 1K6JA 2ZB3A 3DJFA 4NDNE 4LF9C 4WJKB 3ZCQA 3GGCA 1T2DA 4Q4HB 4ER3A 1WZEA 5AUNB 2JNVA 2ZAIA 5GJVC 3HR8A 1J8QA 1X15A 2AHOA 4XWYA 1GAXA 4NR0A 2C00A 2P62A 3MA0A 4LRQA 1YRYE 2AQKA 5DFAA 2XUPA 1XDBA 2G5TA 1WZNA 1UKBA 3IQDB 5CDFE 4KU4A 3QOXA 2GZAA 3HJBA 1BE6A 1XZ8A 3NIWA 3N2IA 3OHPA 4UPVA 3KKOA 3TNLA 4REQB 5A5FA 4QD3A 3U5TA 1PWZA 3BXPA 3UH0A 5G4KA 3JR7A 3FUVA 4CTOA 4ZI2A 2O07A 1SC9A 4OXXA 2X8BA 5BSRA 2HBYA 2PZFA 1TM5E 1TLTA 3AVQA 4NKRA 3Q3VA 2UU9B 1N6HA 1VE1A 2M1XA 3ID6C 2CYCA 2JFPA 2AW5A 2W58A 5HEKA 1XAJA 4MWDA 3RS9A 3DVAA 1QGZA 5FLEX 1IIBA 4ETIA 3UJ9A 1P74A 2NN3C 5FOWA 1K0FA 3HMKA 2LCQA 4CTJA 4ID3A 4EF4A 1R5BA 5LLDA 5C8XA 4HGYA 3K72B 3L0DA 3EX7C 5JQWA 2DFNA 2QMYA 3LF2A 1DQNA 2FRDC 4HRVA 1XTBA 5FUYA 4EY4A 2I66A 1KPGA 1IRIA 1LFDB 3SYMA 1DS6A 1IHYA 1PJ2A 3N2GA 5FTJA 3FWZA 5CA0B 2BDEA 5AUQA 4A0QA 3J80A 4YV1A 2X13A 1I3OA 2P4QA 2AE1A 1HQCA 3ITEA 3HSSA 2IYVA 4RFSA 1S2NA 1WX1A 4JROA 4K6FA 1Z0KA 2OHIA 3L6OO 3TJZA 3ZJ4A 2D28C 3SJUA 1LBHA 1FJXA 1E1DA 1Z2OX 1L7DA 3ZTTA 1U8UA 2NVUA 2RGBA 3HB1A 3LOQA 2VDPB 2IYYA 1VA5A 4RETA 1I51A 1QIGA 3BN3A 1E3LA 3EZ7A 3OF2A 3UK6A 3RDPA 5E6SA 1JQJC 4OAOA 1Q0RA 1V3VA 2ZR0A 3ABSB 3ENKA 4HEHA 4YPVA 5C4IA 4KFCA 1R15A 4IDEA 4Z5XA 3BXOA 1YDWA 3O4FA 1E7MA 4FDVA 1GGEA 2QN2A 4HDRB 4FB5A 1YVPA 1S5PA 4MYRA 1JU9A 2D59A 1O8BA 3V8BA 1B7GO 1Z25A 5EWMA 2CXPA 3HU2A 3Q7RA 1L3BA 1XOIA 4V24A 3VZRA 2Q2QA 1JFVA 4NDNA 3H9GA 3QZUA 3NOXA 5ULLA 3IELA 3H0EA 4YRPA 3K71B 3VMMA 3K9CA 4JJKA 4BVKA 1OC2A 3URKA 1A9RA 4TUYF 3WISA 1CR0A 1VB3A 3BWBA 4EB0A 3O6VA 3ZCPA 2ZJ1A 1JP7A 3L40A 1MIOA 3OZGA 2QN9A 4ZQHA 4Y2SA 3SFTA 4Q7LA 4R05A 1R10A 4UFPA 3TH5A 5CDFA 3ZIUA 3GUUA 3VX3A 2VPQA 1MHPA 2L19A 3SF8B 4C5BA 2NSLA 4CLXA 3IT0A 2CYBA 1VQ1A 2WAAA 1WY7A 5LOVB 1M0EA 2GM4A 1K3TA 1H9AA 3DHVA 4BLSA 1TH5A 1IB6A 5KNCD 3KE9A 1TJ5A 1XMVA 3DEAA 3FPLA 4MS1B 3PK0A 3LXUX 5CVDA 2CXRA 3FB4A 4F2GA 1Y1PA 2OB1A 1WW2A 2Q1SA 2VDNB 3ENZA 1E7QA 2Q2VA 4FCWA 5CYGA 5E6RA 1TO2E 3OEED 1DX4A 1NMEA 1PGQA 3ACBA 3FRIA 5GONB 1EM6A 1A88A 1IMOA 1ZUWA 2PUDA 1QR6A 2ZJAA 4I5EA 3VR5D 5HMLA 3AI2A 2R1VB 4LGMA 3RB8A 2GEJA 3A06A 3RJMA 3ZD7A 1H2XA 2MJLA 1NZDA 3I12A 2J87A 2P41A 1K88A 5EL0A 3FZQA 3KOMA 1X0VA 1FFCA 1NQUA 1IQRA 3TJRA 1YR2A 4TKZA 5ESDA 5A9SB 1K5GA 4H18A 5K0BA 3UPTA 3T38A 2VHEA 5IABA 4WBNB 1AZWA 4YHHC 1SA0A 5BUZA 2ZUUA 1CZLA 4YRMA 5JASA 1K0UA 2ILVA 2VYNA 3AG6A 3QPWA 4LX8A 1C4XA 4ZK6A 2H7XA 4JITA 1SCJA 3JYOA 4BO3A 4BQOA 3SHTA 2YRXA 2WJJA 3DLTA 5EE0A 5FV4A 1KAGA 5JJLA 1YDMA 2P2LA 1IHXA 3AESA 2UZ4A 4OLFA 1FDOA 1QOZA 1ZVJA 3JD2A 1I7QB 3K31A 3A6KA 2I8LA 3RAEC 1OKKA 1XZLA 4IHKA 3T6KA 5CCEA 2XWQA 1XQWA 4HLUC 1OV6A 3A1VA 2GPYA 2HU7A 3FHCB 1AUQA 1P5RA 3OOYA 2C0PA 2BR5A 5EGNA 3SXUA 3OLWA 5F21A 4CM7A 2HRCA 4X54A 2HQRA 1T3GA 1Q3HA 3PP8A 1K7EB 3RLIA 2YYZA 4R4JA 5JTUA 2DBYA 2P68A 2ZDQA 4X65C 1OC4A 3FTCA 1KORA 3FZNA 4P83A 1YJAA 4YN3A 3UWDA 2CXTA 4DILA 2PUVA 4BPBA 2Y4OA 1RIIA 2WYOA 1E89A 3Q7TA 1TJ4A 4H59A 2QNBA 4KKXB 3U4QB 1F2TA 2QW0X 3ZGOA 4AURA 4JI6B 3TEMA 8GPBA 1WETA 4PFJA 1LSSA 4RM3A 2WSIA 3GKUA 1R27A 2SCUA 3RFTA 4BZZA 3Q8MA 1X3SA 5C1OA 3CRW1 1VI5A 2PAAA 2WJYA 1RQ2A 2EU8A 1XXLA 2NQTA 3NT2A 4PXAA 3UWPA 1NI3A 4BU1A 1I3NA 4EFNA 2DFVA 1P2TA 2QMHA 3TZEA 4CMEC 3V8PA 4U0KA 1JKJA 3E1KA 1QK3A 1U3WA 2RHMA 3E7WA 1TQDA 3QFSA 4MQ4A 1ONBA 5D87A 4C05A 3CVWA 3NHBA 3VM6A 4Q4HA 2H1LA 4YRDA 3IILA 3RT1A 4EW6A 5JADA 2JJQA 5F35A 3BIJA 1O97C 4DWOA 5DKFA 1MV5A 3C3JA 1U7UA 4MWTA 1KQOA 3AY7A 1G5TA 2FMTA 3E8XA 1EGMB 3FVVA 3LBYA 4PFSA 2ZJ6A 2WB2A 5EJ7A 5TVKA 4GPD1 4HS4A 5IJXA 3NBAA 2BSXA 2P0AA 3W8RA 5K1ZA 3EB9A 2DHCA 2JA2A 3Q7IA 5DBIA 3T1OA 3GJ4A 3JTEA 5HS6A 1Z16A 5TMBA 1NSTA 4KDEA 4YDSA 2ORYA 2YJ5A 1GFZA 4QPDA 1M2NA 3UJ6A 4FHEA 4ALLA 3SZRA 5SZKB 4BRUA 3V4VB 4RTPA 2C7GA 3HC7A 4CKXA 1UBTS 2P9YA 1GO2A 4LFAC 1M33A 4KR7A 4KBFA 3MFQA 3BHMA 4ALKA 4ZHSA 1VKHA 3DZKA 4OB7A 3RVRA 3OTOB 4DEVA 4LHZA 4XEHA 1DIGA 2G7ZA 2QTRA 1MBZA 1JB9A 2FPUA 1CHDA 2VS1A 1GZ5A 2AG6A 2ZI9A 4PO9A 5HCUA 5KQPA 4AYWA 3U9SA 2UXBC 2H7CA 3W5HA 1XZHA 2JHCA 1FPQA 3IUQA 3H4VA 4L02A 5IBRA 4ENUA 1T8SA 1U8YA 4QXPA 3MBIA 3WYGA 5JS7A 3NW9A 4XQ9A 2OPLB 4B81A 3CH7A 1MQAA 3I2KA 5CA0A 3RUAA 1QGUB 2ZVQX 1ZBQA 3S40A 5D3MB 5I48A 5JPDA 2QX8A 1LV8A 4JXJA 3GMTA 1OU4A 3O26A 4ZGGA 4EL5A 4N9WA 1Z6PA 1RI1A 1ZMTA 2JZCA 2WE7A 3DYVA 4Q47A 2BWJA 4EENA 4TYMA 2GERA 2AV6A 1P62B 1MJHA 3DCNA 1BS1A 1FLNA 4PQGA 2GLTA 4NMHA 4C4PA 2G5GX 3NTOA 1DAGA 2VKTA 1L7AA 3CVXA 3U4CA 1SRRA 5DJ5A 3G2OA 1G18A 3NGMA 3OPVA 3EFHA 1G6HA 1RAHA 3PC8A 2ADMA 1TJPB 1PU2A 4YAEA 1D1TA 3IEUA 3JASB 5KHAA 1E18A 2FSGA 2X0NA 4KB5A 4E31A 2XUOA 4X64C 3GCXA 3VVMA 2I65A 4LGVA 4BVGA 4HDRA 1CZRA 2VJNA 4KIGA 4TMYA 5FBKA 2JARA 1A5SB 1ENYA 4Q3NA 2P2NA 4AF8A 3LUPA 4YRJA 2JJ2D 5CNIA 5ITZB 1BHJA 1XA0A 4OPMA 1RXYA 3KV1A 1XCMA 2PZBA 2XD4A 4V02A 1FFSA 1SCQA 2QN3A 3PCRB 1S96A 1EWVA 2ZKLA 4JBLA 1G7RA 3VYVA 1WMDA 2YNMD 3PQ5A 3U17A 1V3TA 2B4AA 1G2PA 4H15A 2GZSA 2VBGA 1ZJWA 1SN7A 3ZWVA 2VRCD 2VQEC 1K63A 2A0XA 2PKCA 1DO8A 3A04A 4NESA 4F4HA 4QTUB 4BP8A 3SLRA 3R9KA 1IHUA 1LDMA 5FBWB 3NNDA 4F3TA 1UP4A 1H0KA 1W1WA 3SF8A 2RJNA 1CP2A 3WSWA 4B3FX 4BKPA 5LOVA 4YT8A 1XDZA 2W43A 4NQZA 1QO0D 5BMVB 4JGGA 1ORHA 5EZ5A 4KP7A 1F2UB 3KKNA 1KK3A 2VJKA 3N0XA 2C31A 4Z49A 1IBKB 4LY9A 1AKRA 1U0GA 4MS1A 2Q1YA 3CCCA 1U5AA 2G28A 5FI0B 1V16B 1N9GA 1Z5NA 2CNWD 1TPZA 5CYOA 5LU8A 1JLSA 4LBZA 5CA1F 2YJZA 3A1SA 5IP5A 2GJ8A 1H8HD 1HDXA 2C5GA 1YZFA 2E85A 4OHMA 3AUYA 2VT3A 3N8HA 5GONA 1ECGA 2WHXA 1T91A 1JHUA 3ZWBA 5ALKA 5GZ1A 1Z07A 3G59A 3M2PA 3O8QB 1MKYA 3I2GA 3R5XA 4J9VA 5HKOA 2BTQB 2R1VA 1DC8A 3RT7A 3S8MA 3IMCA 3I4CA 2PGJA 5JWRA 4B73A 4G37A 4R8KA 2ZEJA 5A02A 3KKKA 5A9SA 3WXMA 3GMSA 2IEBA 4UUQA 3DO6A 1U7HA 2AJLI 1KOJA 3EVTA 3F8WA 1JHZA 4E2ZA 2WA2A 4WBNA 2OHOA 4PVCA 1JBEA 3OJCA 4P08A 2IYZA 5EPOA 1V3UA 1USGA 4PG5A 4YP7A 3VSBA 1JEOA 1NFRA 1A5AB 3PR2B 4CMHA 1YU6A 3PQEA 1H2FA 4MYHA 1GV1A 4TV9F 4MPRA 1R4MB 1ZOSA 1INLA 2GBFA 4FEAA 4DV2C 1N2SA 2CK3A 1QQBA 2CLCX 3MTGA 1NVAA 5H7XA 2EL7A 3D8RA 2YVLA 1UWVA 3TLBA 1L6IA 4QU8A 1S8AA 1SB8A 2YXBA 3SD7A 4L6IA 3SF0A 4OM8A 4MV9A 1E4VA 2K4MA 4B3SB 3NEPX 1SULA 3P71T 4MQEB 4LDZA 3JQBC 2P20A 4JSYA 2I4LA 2OC4A 4JJAA 5FYDA 4DEXA 4NH0A 3GFVA 1EFKA 3R8XA 1ECPA 2P1DA 4I50B 1VMIA 2V9CA 2I4IA 3BUSA 1U0EA 2CNBA 4U1RA 4BQNA 3LPDA 4WRRA 7MDHA 1BNCA 4RNDB 2DBVO 4FFOA 1SBHA 1L8LA 3NDBB 1G7CA 2EW1A 4B87A 4FP9A 3CUYA 3L43A 1OYYA 2BMVA 2PR7A 4LC0A 3UMJA 4RV9A 4UTPA 1QS0B 2OB2A 2B5OA 2Z8YM 3E8MA 4YO8A 2GFQA 3EEYA 4S04A 4GI5A 2B34A 1F2VA 4R5HA 2RGUA 1M2VB 1MB2A 3D6FA 1J70A 1NXSA 3V1KA 2WJ6A 3C1UA 1LJ8A 3AZOA 1WNFA 2EIXA 4H9GA 4HS9A 1N5OX 3SU8A 2EERA 4F4IA 2VC2B 3NBYC 5E3IA 1Z6XA 3U3KA 3Q8KA 3QFCA 2CLMB 3UAOA 3OU2A 1T8RA 2H29A 2X0JA 1XCGB 3S28A 3WOVA 3ZZMA 4IZ6A 4IDNA 2OT3B 3BE4A 1LQTA 3I05A 3VPSA 2Z3WA 2XB4A 4NYJQ 1J1UA 2LRHA 5CFNA 3F4BA 3FF1A 3BJIC 4OX9C 2OPBA 3THXB 1EE2A 4LJ7A 1G8SA 2WWTA 3GR1A 5T64A 3UC5A 4N5IX 4BSZA 1NLZA 3ZHRA 1DOHA 1TMOA 3AR3A 1W4BA 2IIVA 2Q0XA 4GIBA 3TPCA 4AN4A 3MMSA 5IH7A 5A3VA 1KKGA 2FV8A 4MX8A 1IN4A 1LF5A 3TRDA 4L5YA 2FZ4A 3PJGA 2C20A 3ROTA 3X1YA 5G41A 1JBKA 3P9YA 4OG2A 2E5LC 4GR9A 3QTBA 5JXHA 2WFMA 1ISGA 1GPWB 2E3JA 2GBCA 1IM8A 2Q3CA 4GOMD 3RD5A 3UT5B 3RYIA 2CLHB 1Z0IA 3EOBI 1XQ1A 4NG5A 5CEFA 2D5AA 3UCEA 4GLJA 2WKQA 4L85A 1ZDMA 1WPRA 3IVCA 4NMWA 3FSJX 4TRMA 5EMKA 3HHEA 3WY9A 4AG5A 1AF7A 2GHRA 5EOVA 1RMYA 1A8PA 1YRWA 1E2QA 4EUHA 3C0KA 2OPLA 1OWPA 1YDEA 4UW9A 4LF4B 3GZTB 3C41J 1QGUA 4HDCA 1VE6A 2PMDA 4WOJA 2AD5A 5D3MA 3GR6A 3QX7A 4G1EB 4HH4A 1SG9A 4IG4A 5DHFA 3AEXA 3TRKA 3HN2A 4GP9A 4AL4A 1RP7A 1GL7A 2QL5A 9ABPA 1L7EA 3OURA 1I9GA 3ZW7A 5CT4A 4IL5A 3OQBA 4CM9A 5F23A 2FXIA 4YAGA 1BW9B 1S2OA 1KAOA 3CJEA 2GD2A 4P86A 5K9ZA 2JIRA 1FDVA 2OAEA 3CJTA 4OQZA 3QMPA 2FSFA 4XW2A 4GQAA 2OGWA 1NBWB 4GU5A 1G1MA 2C4HA 3WIUA 4LZPA 2FFBA 2G9ZA 1FNSA 2Y6VA 4QKQA 3H9BA 1KI2A 1PJ8A 3JASA 2G0TA 4AS3A 3DL7A 2WUEA 5D1HA 1RIFA 3OFJA 4OV6B 1E6KA 2JMPA 2PWAA 3PPVA 5E0KB 1L5NA 2R1ZA 2QRMA 3HRIA 3M5WA 2VJOA 1H42A 3PUYA 2ZCUA 4J0DA 4ZZ2A 4B6OA 2XMDA 3P9QA 4RIEA 3KTAA 3DW1X 4CMJA 3B3JA 1BRTA 3BMOB 3FBTA 5LZ8A 1M9NA 1HDZA 1XTUA 2NSJA 4I66A 3RHZA 1I4DD 2XITA 3RLFA 4D3YA 5ITZA 4XCVA 3L8HA 5DASA 1Q15A 1HE1C 4N0QA 4ZOCA 3QY0A 5JANA 2PJRA 5JD6A 3BGSA 5G3YA 2ONJA 3QE4A 4IW3B 5ADZA 4KEAA 3JRXA 4ZYVA 1JW9B 2MIIA 1M76A 2VPTA 2CWWA 4IDAA 4JOQA 3S2IA 1MZVA 3KJNA 4JODA 4L51A 2F59A 3TBFA 3VKVA 4ZV4A 3DLHA 4E1VA 3ITKA 3G2QA 1KS2A 4X1YB 2Y1KA 5G1OA 3EUAA 2BMDA 3VR2A 1U8ZA 4Q7MB 3AG5A 1R6UA 5BWCA 5BMVA 2YY5A 3WXBA 4E5MA 1F2UA 1XLWA 3QU7A 2OG1A 2WZCA 2IZ5A 4ZIRB 1HTBA 3PGMA 5CFRA 2OCDA 2P4SA 5ABPA 1V16A 3PI6A 3WX0A 1ZOOA 2HMVA 3O9ZA 4EKYA 5B53A 3WC4A 3K70D 2QUAA 4P54A 3ROGA 2PKYX 5KJ1A 1YB2A 1ZISA 1UOQA 1FSZA 4HNQA 1ISFA 1FFXB 2HF8A 3KG2A 4Q3EA 2XB8A 3WMXA 1RYMA 2IP1A 4JI0C 3ORHA 3OZIA 3WLIA 3O8QA 3DDSA 4GRIA 3LU1A 4O6VA 3TZ6A 4C3UA 1UJBA 2BTQA 7AT1A 5LDHA 2IDJA 3K9BA 3ST7A 5G0SA 3QU9A 4LY0A 1IE3A 1I5RA 4Z0PA 3PEVA 2R60A 4R8RA 4BMXA 4P4NA 2BJWA 2VI5A 1P6XA 2MSWA 3CO0S 4YRAA 2LKDA 3WLNA 1GYQA 1YDGA 1UAYA 3GJ8A 4E6PA 5EJ8A 5G0UA 5SV2A 3DDWA 2RC6A 5EJIA 4LF4C 1FK8A 5EXDA 1AGYA 4P0TA 3C6MA 2LPMA 3EY4A 1CEYA 2E37A 2RHGB 4KZPA 4WK6A 3EGIA 3EYAA 3T54A 1EINA 4OFBA 2V5UA 3M33A 3TNDA 3NOVA 5ADUS 3IUYA 2NSDA 1WUTA 1UPUA 2R5FA 3K0HA 1V8ZA 4URYR 1SK8A 2VEDA 5BSWA 5IUNC 1U3VA 2ISQA 4HCJA 1HMYA 3G9XA 3WIDA 3W90A 3KR2A 3K32A 4HFRA 2OLEA 4P32A 1PK9A 2JCXA 4FOTA 3ZLUA 5JZOA 4FNGA 4KCGA 4O2AB 4MQEA 3CWCA 3IAXA 3NUGA 2ZJZA 4QOEA 2Z9DA 4G63A 3NWPA 1WPQA 4A03A 4E5KA 1DAMA 3E7XA 4CM6A 4I50A 4BEBA 5KS2A 4NXNC 5A7GA 3D2AA 2JAHA 1YZGA 2PH5A 3AIIA 3L6DA 3SS9X 5LQMA 5J3JA 2WF9A 1EBUA 4MV4A 4ER7A 5LP6F 4P53A 5B1YA 1FJ2A 1NLMA 3NT5A 1OY1A 1BMFA 4JBWA 1S8FA 4FUTA 5KJEA 4MSUA 4D9BA 1QS0A 1L4KA 2HCTA 4URVR 2G72A 4H6WA 5ENDA 1ODTC 2MYTA 3TE7A 1GPH1 4A8TA 5CNJA 3OQPA 4AS1A 1M2VA 3I28A 2WYWA 1N9KA 4GQIA 3F7OA 3AKCA 4AF6A 2ZT5A 3QEAZ 1EIZA 1KZ7B 3BH0A 1A27A 3MPUA 1CUIA 1K4YA 2D1QA 3ONVA 3UA4A 4M21A 3LT1A 4AO7A 3EIUA 4HNAB 1ZM3A 3T0FA 5HIAA 3OLXA 4KGVA 2VT6A 2ZUDA 3OJFA 3RU9A 4L2ZA 1E59A 1GTL1 2GF0A 2QXYA 4FZ3A 4QNRA 2IQIA 5DWVA 1SU4A 2WFAA 5EMMA 5FEMA 2WTNA 3GFBA 4K0RA 4D43A 1A7JA 2BR3A 4PGHA 5C4MA 4ICIA 4RXMA 3C3DA 5EY5B 3WO1A 4ENPA 2JL1A 3THXA 3JVIA 2FEMA 4AK9A 2VQ3A 1XL1A 2ES4A 1Y63A 2REBA 4XDYA 1KSJA 3A27A 4IIFA 1VCOA 3PXXA 4FSXA 1RQNA 3AM4A 3KJXA 3O31A 3UJAA 3ZE9A 4UNRA 2F3TA 3B85A 1E3TA 2DTEA 1HM5A 3ETGA 1UBRS 3MW8A 2OXRA 1DAOA 1SM4A 2QLJA 4LJ5A 5IT9D 1OZAA 4JI1C 1AD2A 1U2DC 4FB4A 1TZKA 3V1TC 4B3IA 4B44A 2EDAA 2FPSA 3HDTA 4ZICA 2PWBA 3O7MA 2FCAA 3B2EA 2RHOA 3C4JA 2YMPA 2DQKA 4G2TA 1JHAA 4KYTA 3C6KA 4QUAA 4ETWA 5A4JA 1SNYA 3NIFB 4GKJB 4BN0A 4IUYA 2ZRNA 3KOZA 4G84A 1A8IA 3HXMA 2YFHA 1Y6RA 1G16A 4AC9A 1HEYA 4DCPA 1KFJB 1CUUA 2PCLA 3GEIA 1XZIA 2XGMA 3AQIA 2I1VB 3BHIA 1CR6A 1JHMA 3OM0A 5H3LA 3WIEA 1H66A 4CCAA 3DVRX 4LXXA 3GLKA 3T3NA 4HNRA 3FNBA 4LTNA 3OC0A 1EFRD 1TQ2A 1W0JD 4QUHA 1J0BA 1L5RA 1U1DA 4M0FA 4DLYA 4DY6A 1ADBA 2Q5LA 4NCXA 4OJKA 1KQNA 1YJXA 2MDTA 4Z4FA 1WCWA 2DMRA 8AT1A 4G9GA 4J91A 1ZB9A 3B12A 4PZZA 3GH3A 5HFAA 1BW9A 1MTOA 3AM1A 4JOBA 4A82A 4QDJA 4LSZA 3P5SA 3B6ZA 3QBJA 1RPTA 4QU9A 3WLKX 1WCJA 3AUSA 1W2WB 4HBGA 4QJBA 5EHNA 1X1QA 1YI0A 4GZ3A 1J5EC 1SHLA 1ZW1A 4CL8A 2CHEA 4Y2PA 2FG6C 1WOYA 1QHNA 1TD9A 1SG0A 1JFLA 3FJOA 3LUDA 2IEAA 4WNAB 2DQSA 3JWHA 4K2AA 3AILA 1R6AA 4NU0A 3SLKA 2OZLA 1RMQA 5DSZA 4GLLA 2DPHA 4B4OA 2ZYVX 2EQBA 3IVXA 3BMOA 3RODA 5M5BA 2ZOSA 4Q1AA 5H80A 3PHIA 3PSAA 4FMPA 4X8OA 5GOTA 1OBOA 3VH1A 3DWFA 4RHTA 2YWEA 4RCZA 3SXJA 2KZ0A 1P7VA 5AJZA 4MVCA 4UNSA 1E9FA 4WWHA 4KTTE 1VL0A 2AF3C 3GNSA 5B55A 1JDTA 1L7XA 4MKRA 5ALGA 5U1PA 4WKCA 2C7RA 3SOZA 1UJCA 1DJPA 4RY0A 2DT5A 1BDJA 4QHYA 4KWHA 3R9IA 4ZDJA 4X1YA 1TK3A 3MHTA 3KQWA 1PL8A 4WKNA 1ZL0A 2ZU0C 2ACKA 5E7MA 4H2DA 1FBNA 2YQZA 4EY6A 3TQFA 4YUXA 1Z3CA 1M1NB 4PNZA 2K2QB 3HABA 4R1PA 2WM2A 1HNWB 1X7XB 1JLRA 3HU3A 1UBOS 5ISMA 1OLXB 3EAGA 1NX6A 3SO4A 1HKUA 1XTTA 1Y8AA 2HWXA 5LN1A 4DV4B 1B73A 2RONA 1OH5A 4PFQA 3DV0B 1BE8A 4GXTA 4WE3A 1YJQA 3UJ7A 3BFKA 3UMBA 1TGVA 2XKKA 4J49A 2A5LA 2YV5A 3Q7SA 5C4GB 4LYEA 1FFXA 4S35A 3SMVA 2DH6A 1P77A 1Z08A 5ER9A 5FRDA 5EZYF 1Y34E 4KGZA 3W9SA 2XTJA 2XUKA 4OMUA 1O2DA 2F8MA 3JVUA 3L3BA 2FPIB 2GAOA 1XRMA 2VH5R 4EUNA 1UC8A 3G2KA 3O82A 4NOLA 4KR3A 4OHYA 2IHTA 2J6HA 1CY6A 4JJ6A 1F48A 3D6UA 4NE7A 2H1WA 3FCYA 4U3JB 3HSYA 4Y9UA 5K0NA 5ALYA 4Q02A 3TSCA 3IMFA 3G02A 3RTCA 3L4KA 2BRUC 2V4MA 2K6GA 3D8HA 3W7VA 1UAAA 2A88A 2WFLB 5CHYA 3SZUA 1BE0A 1GQ2A 1TZMA 1A9SA 1X8JA 3RS0A 1MHTA 4K9LA 3RE1A 4WADA 2R86A 2GYUA 3ACDA 3KVVA 2DWUA 4C4AA 1AKWA 2QR5A 4FX2A 3OQNA 4D9EA 4CBVA 4BJ1A 3H1FA 3UXHA 1XRAA 3I72A 4QYTA 2EBWA 1Z33A 2EOAA 3AL2A 1PLKA 3IH5A 4LHWA 3EUWA 2A4KA 1Z74A 2G36A 1KI8A 3E3AA 4BCBA 3CCFA 5LZ2A 2HHJA 1D3AA 1CQPA 1ITZA 1AN9A 2A59A 4YJFB 5E0OA 2C95A 2Y1LA 3SZOA 2FR8C 4JLUA 2DFLA 3H75A 5HFJA 5ICSA 3F6BX 3C5HA 2N47A 3LK6A 1VTKA 4O2AA 4DDMA 1H5NA 3E3MA 4Q3BA 4IMJB 5GJWC 4AB1A 3VJMA 2EZTA 3C24A 4DSNA 1NN0A 1YQ9A 4LGCA 4LXHA 2OXIA 4AKEA 1OIVA 4ZJPA 4WI1A 3ZWMA 3HJAA 3IV7A 3QWIA 4F6CA 3QKWA 2BKLA 3G9UA 2XTAA 1RWKA 2VP0A 1CW2B 4FGUA 3I09A 3X44A 5BWBA 2VUTA 1JDBB 3AGQA 4XD7A 2VQ6A 4ARUA 5CG1A 2J5RA 4D56A 5CZXA 2B1GA 4KTTA 4JELA 3SFVA 5BO5A 1D2RA 3HFJA 2FQYA 2W2KB 1NT2A 2A0KA 2P9JA 1N2JA 2F3SA 2DYJA 3K6KA 4U2EA 4ENVA 3ROEA 1PLLA 3IEIA 3UFXB 5KOYA 3KHUA 4E33A 4LF8B 3QE0A 1JQ3A 1FL9A 2KHZA 2PY6A 3L9XA 4TQGA 2CV0A 3IUPA 3PUXA 3AOEA 1Q3KA 1GPJA 2FWBA 1RRPA 1GZSA 3BCUA 2O0KA 1TT7A 2QRZA 4JKIA 2ZDHA 1QYRA 2CDBA 4FQ8A 4N82A 4PY2A 4B4DA 3VSAA 1ZP6A 1ZNWA 1QG6A 3IGFA 1U65A 1T9KA 3PVSA 1YDFA 3QFFA 2DX7A 4L16A 1Y6JA 2D7CA 5I4IA 1UPXA 4FFDA 4E5NA 3DE0X 4PYJA 3W8NA 1XAHA 2RK6A 1F8XA 1S2GA 4KWEA 4U02A 4DSAA 3MJDA 3MNFA 4ZI5A 1P6UA 2HRDA 2DKOA 3FIUA 3II6X 4Q3KA 1HG0A 3GPLA 4CW7A 2OFXA 3OOWA 3SGLA 2AG5A 2VYVA 3THRA 3AIMA 1JYFA 3CUSA 3FZYA 3VAAA 4PW0A 2NW6A 3CLUC 4JYCA 1GVHA 4ASUA 5LU9A 3I62A 4N65A 5D86A 1AKYA 4GNRA 2JIBA 1I3KA 1FZQA 4BNTA 1EDBA 5JNUA 3OMWA 1EG2A 3NR2A 6CHYA 1PQUA 2HA7A 4GO1A 2WP8J 3I52A 2AN9A 5BYJA 4KH0A 4CQLB 4JOSA 1JIUA 1MAWA 3EWIA 4PQRA 4UVDA 5ADHA 3HR4A 4CF4A 3I0ZA 2EP7A 4MUGA 5DGDA 4JXKA 3ZX4A 1T25A 1AT1A 2HIHA 1AUXA 5HE8A 4Z4CA 1I2MA 3DMYA 5I7FA 4Q7KA 2YW9A 5HPYB 3U09A 4FMBB 3ZLJA 2HGSA 1RU3A 1OE0A 4OL0A 4KVFA 4CJXA 2WIAA 3UZUA 3TDEA 1Z8HA 4WV3A 2V4UA 4YJHB 4R7ZA 5JSKA 4F84A 5EUQB 3IYLW 1TEHA 3DCYA 1YZYA 1X13A 4ZDKA 1JF8A 4JJGA 2QSYA 4PAGA 5JRDS 3BMCB 2JH3A 2IXEA 3GEHA 1STOA 2B2CA 4BAUA 4QQKA 5IKXA 1S2DA 5HHTA 4DVGA 1SY7A 2G8LA 3TLCA 2H1VA 3O94A 3PYLA 4C2AA 3QVUA 5J9FA 1M2HA 1YU9A 2AWOA 4HLCA 4KXXA 1HO3A 4Q12A 4QTXA 1DNPA 3UT0A 4EUEA 3PTAA 1D9XA 1JG2A 3JTMA 4OAQA 4PYOA 3L18A 1MU0A 1JDZA 3IB3A 3W5JA 5CFMA 3F2VA 5A4KA 2QBYB 5CEJA 2IYQA 5I7VA 4NLLA 1UEIA 1QZXA 3E5RA 4H31A 2AUNA 3K1TA 3GCGA 1I4OA 2V7XA 1YVDA 3A3NA 3HCEA 5FWNA 3KVOA 1UC9A 5HUHA 2JLAA 1WSBA 2WZBA 3RF6A 5DN9A 2XZDA 3CZ5A 4WNAA 3ORFA 4HWPA 4JXZA 1UMCB 1R4AA 2XI4A 3IA7A 4AFNA 2BFOA 2J48A 1G3RA 3AJEA 4KHPC 4DLWA 3W4JA 1NOKA 1UQTA 3Q7PA 3OHMA 5C8DA 1JXQA 1CLEA 1HLPA 1WABA 2EJTA 3A36A 4RYLA 5COBA 5MF6A 4XIGS 2C07A 4F04A 1I3LA 3T94A 5LCXA 3OQHA 4Z3DA 1JT2A 4H16A 3G9ZA 3T5AA 3GVHA 2QRHA 3NYQA 4HATA 3LT0A 3T1NA 1OBHA 1SBQA 4IQ0A 4RJIA 3D7MA 2P40A 3B60A 2VAXA 3SHQA 2H2AA 3T9DA 1ZQ1A 3GA5A 4Z0NA 1NPYA 1Z5ZA 2QTNA 3DZBA 3QUCA 4ZWNA 5D01A 4RF2A 1GIAA 2ZIWB 3L1HA 4A5SA 2ZYRA 3OAAD 5IN4A 2F67A 1OFIA 1WW8A 3C1AA 4JVMA 2DHEA 3HCBA 4M54A 4JI3B 2I34A 5EERA 3T1QA 1YL6A 4OIMA 3ZBPA 5H9WA 1M1NA 3AHEA 2ECQA 1R4ZA 1YZNA 4RJ2A 1P7WA 3PYMA 1B6RA 2YRWA 5E7IA 5LBTA 1ECFA 1X7XA 2PBRA 4A15A 1NUUA 1J7KA 1OLXA 2WIFA 2W2OA 3AYZB 1UZUA 3OZBA 3TKAA 2JATA 1IZZA 2ATEA 1IPEA 3STVA 3DV0A 4DDVA 3EG9B 3HLKA 5I7WA 4IV0A 5GV7A 3UKJA 1JAIA 1NVMB 1ZC4A 3G1TA 4Z1OA 1HDGO 5DTRA 4AD8A 1BXRB 3VO1A 2CZGA 4L3WA 4EJ0A 4D0SA 4FKZA 1OJLA 5JNVA 1Q1GA 4EVRA 1VI6A 4HPJB 4UCFA 3K8YA 2WF6A 5A5DA 4D0LB 3IHLA 1S1MA 4BQEA 3U3XA 5JD4A 2FPIA 4M99A 4LJ9A 3MRSA 3HO6A 2CXOA 2B9VA 2OV1A 1K1EA 2Y1XA 3KALA 4U6QA 5KNCH 2CT8A 1HE3A 4X91A 3UHOA 4D8UA 4U3JA 2YASA 4MEAA 1G0NA 4UUOA 1OYVA 1RC8A 5JYCA 1AS3A 4E2XA 4YRZA 2WK1A 1M72A 4EHHA 4S05A 5B4TA 3CX4A 1NIPA 2WFLA 1R6VA 4CF5A 2UYOA 1HDOA 3L7IA 2C1XA 3QF4B 3V2GA 2PRIA 4HRYA 4UARA 1NLFA 1T9ZA 2GJAA 3HVIA 4PIMA 5BXQC 2XADA 1IZ0A 1ADFA 1LBIA 3CUTA 4FEGA 5BUCA 5EEGA 3KZKA 2A1IA 2A7XA 2ZULA 1UKVY 1ABFA 1QH1B 2ZZNA 1VJRA 2ODBA 1BS2A 3NETA 4DM3A 3LC1O 2EFGA 3FCXA 3GLHB 3UWOA 1KI9A 4Z4QA 1KYWA 2BEWB 2JI7A 2R96A 3B5JA 3G2IA 4KPGA 3DV9A 2ZYIA 3D3WB 2YJTD 3L1UA 4Y18A 2O19A 1RXSA 2R6ZA 2OG2A 2ZWOA 4OYYA 4POAA 1KNXA 5KI6A 5I9MA