2E8FA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (oxidised form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Aq_1549
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 40
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8fA00
4YHHC 4JI2C 4AQYC 2PN2A 1USPA 1NYEA 2E5LC 3T1HC 5BR8C 2E8EA 4X62C 4DV0C 4LF9C 1ML8A 1N34C 2HHHC 1IBKC 2OPLA 2VQFC 2F4VC 2QL8A 1HR0C 3R9WA 4X64C 1N32C 4B3TC 4JI1C 2ONFA 2UUBC 5IT9D 1IBLC 3GKUA 1XMOC 4JI7C 5IWAC 5LMNC 4LFBC 3I07A 4DV6C 2UXBC 4DV4C 4GKJC 3R9XA 2XR1A 2BJOA 4DV7C 1USPB 4DCSA 4JYAC 2PT7G 3T1YC 1LQLA 2DYJA 4JI0C 4JI3C 1JOSA 2OPLB 1PA4A 5A2QD 2JMPA 2CXCA 3CJEA 4DV3C 2D7VA 2E7GA 4NXMC 3JAMD 4DV1C 4LF8C 2EGTA 3LUSA 4MTNA 3EERA 4XX2A 4DV5C 4LF4C 4X65C 3AF6A 3IEVA 1HH2P 3J80D 1ZB8A 1WH9A 4DR1C 1XMQC 4LF5C 2UXDC 2UUAC 4B3SC 2E8FA 4YY3C 2KZFA 4DUYC 4DR5C 1UKKA 1ZB9A 1MKYA 4DCTA 4DR3C 3AF5A 1WF3A 2ASBA 4X66C 2HJGA 2UU9C 2CY1A 4LF6C 4DCUA 2UUCC 4JI4C 2UXCC 4JI8C 3IEUA 2VQEC 1N2FA 4B3MC 5FLXD 4DR6C 4NXNC 4KHPC 4DR7C 4DUZC 1N33C 1HNXC 4B3RC 1K0RA 1VLAA 4MH4A 4BSZA 2E8CA 1L2FA 2YCBA 4JI6C 3J81D 4DR2C 1KKGA 4JI5C 1HNWC 4K0KC 4JV5C 1XNRC 3OTOC 2ATWA 2ZM6C 4DR4C 1J5EC 4LFAC 4DV2C 1FJGC 4DCVA 1IBMC 1XNQC 5LMUC 4LF7C 1EGAA 4LFCC 4OX9C 1QWIA 1N36C 4NOZA 1HNZC 4GKKC 1I94C
chains in the Genus database with same CATH superfamily
5T8TA 4DG9A 2JNVA 1USPA 1NYEA 1XS3A 4RLFA 5BR8C 2AYAA 4G36A 3VNSA 3RV2A 4GS5A 2OPLA 2F4VC 2QL8A 1HR0C 4X64C 3KXWA 2D27A 2KZ0A 3L8CA 4I9FA 3DAYA 4BCAA 2V7BA 2QVYX 3I07A 1BA3A 3A9UA 5ADZA 3NYQA 1AMUA 1LQLA 1UWDA 4WS9A 1JOSA 5BSRA 1PG3A 5BSUA 2JMPA 2CXCA 3GPCA 3LNVA 4FTFA 4XX2A 4DG8A 4DV5C 4ISBA 5T8SA 3CW8X 2WP0C 4DR1C 3J80D 1XMQC 2UXDC 3A9VA 2UUAC 2E8FA 4YY3C 3NYRA 1O93A 2QVZX 1MKYA 3SO4A 4U5YD 5A1GA 2P2BA 4TPSB 1M6XC 4JI4C 2UXCC 4JI8C 1XHJA 2D1QA 3E7XA 4NXNC 4PZPA 3NPDA 1HNXC 4D57A 1FUGA 4MH4A 3NI2A 3FCEA 5KYTA 2P2JA 5BSVA 5A1IA 2OO4A 2CU6A 1V25A 1XNRC 3OTOC 2ATWA 3A25A 2ZM6C 1RY2A 4DV2C 1IBMC 1N36C 4NOZA 1HNZC 5BSWA 5BSMA 2PN2A 4L4QA 2E8EA 3TDEA 5IFIA 5CZXA 3TUFA 1N34C 2HHHC 2VQFC 1N32C 2ONFA 2UUBC 1FLOA 5IT9D 1IBLC 4RM3A 4D4IA 2VZEA 1MXBA 4ZLPA 4DV6C 3A26A 3R9XA 1M6XA 2VSQA 4DCSA 4JYAC 3UX3A 4L2ZA 4JI0C 1V26A 3CJEA 4DV3C 2E7GA 2EGTA 3LUSA 4MTNA 3EERA 1P4EC 5CZVA 3DHVA 4X65C 1HH2P 5BUSA 4LF5C 4GXQA 2Y4OA 2MM9A 1IB8A 1ZB9A 1WF3A 4X66C 2HJGA 2MCQA 1PG4A 4DCUA 4LF6C 2D28C 4BBYA 1PU1A 3CW9A 4WV3A 5LCIA 1N2FA 2BH1X 4ZJZA 4RM2A 1XRCA 2NCLA 4K0BA 5E7QA 5BSTA 2P2QA 3C5EA 1K0RA 3LGXA 5BUQA 2P2MA 4BSZA 1L2FA 4JI6C 4KTVA 3A4IA 2DPLA 2ZZMA 1TH5A 1FJGC 1EGAA 3TQIA 5AE2A 4G37A 3CQ3A 1O90A 1I94C 4R1MA 1MDBA 3S82A 4R1LA 4R0MA 4JI2C 2E5LC 4X62C 2P20A 4DV0C 1QM4A 4ODJA 3AY0A 4PUHA 3IMLA 4PHTA 4RMNA 5JRHA 1P4EA 3K6RA 4B3TC 3CQ2A 4JI1C 3FCCA 3GKUA 3IPLA 4JI7C 2MMAB 4G1IA 4LFBC 5K8FA 2QW0X 2UXBC 1RG9A 2BJOA 2Y4NA 1USPB 4PUIA 2PT7G 3T1YC 2DYJA 5KEIA 2OPLB 1T5DX 3I08A 4FUTA 4I9GA 4PROC 3ETCA 2M5OA 4NXMC 4DV1C 4LF8C 2DHMA 2Y27A 1O9TA 5K85A 3EQ6A 4LF4C 3IEVA 4LE5A 1WH9A 4DUYC 3CQ1A 4DCTA 4DR3C 2KDNA 4HPVA 4D56A 2ASBA 2P2FA 4GXRA 4NDNA 4PUGA 2VQEC 4B3MC 2YWCA 3N54B 5FLXD 4DR6C 3H2TA 3UOWA 4DR7C 1MD9A 2M5HA 4BC7A 2P02A 5GTDA 2E8CA 3LAXA 2YCBA 2D1RA 3TR3A 3B7WA 3VNRA 1HNWC 4K0KC 1V60A 3UZ0A 1LCIA 4D4GA 3RG2A 5DV9A 2YWBA 1O92A 3E7WA 2Z51A 3R44A 4DR4C 1T5HX 1GPMA 4LFAC 2D1TA 5LMUC 4LFCC 4OX9C 4GKKC 1MDFA 4YHHC 4AQYC 4JM1A 3T1HC 4FUQA 1WCJA 3PBKA 3UX2A 4LF9C 1ML8A 1IBKC 3GR0A 3R9WA 1MXAA 4BC9A 5KYVA 5H9UA 5AE1A 1XMOC 5IWAC 1YJ7A 5LMNC 2WD9A 1MXCA 4EATA 4DV4C 4GKJC 1XRBA 2XR1A 4DV7C 2QVXX 4JI3C 2E0GA 2ZZNA 1PA4A 3ETOA 5A2QD 1P7LA 3LNOA 4OYCA 2D7VA 3JAMD 2YX1A 5A19A 4L7IA 3G7SA 3AF6A 1ZB8A 4B3SC 2KZFA 3O2EA 4DR5C 1UKKA 1NY8A 3AF5A 4RLQA 1ULTA 4RVNA 2UU9C 2CY1A 3N2QA 4IZ6A 2UUCC 2OBVA 3IEUA 4KHPC 3GR1A 3L95X 4KTTA 4DUZC 1N33C 2D1SA 4B3RC 1VLAA 2PROA 1KKGA 3J81D 4IR7A 4DR2C 3PROC 1VEHA 4JI5C 4JV5C 4OXIA 3VNQA 5AE3A 1XRAA 1J5EC 3UEBA 4DCVA 1XNQC 4LF7C 4RVOA 3PESA 5BURA 1QWIA 3DLPX
chains in the Genus database with same CATH topology
5T8TA 4DG9A 1USPA 1NYEA 4RLFA 5BR8C 2AYAA 4G36A 3VNSA 3RV2A 4GS5A 2OPLA 2F4VC 2QL8A 1HR0C 4X64C 3KXWA 2D27A 3L8CA 4I9FA 3DAYA 4BCAA 2V7BA 2QVYX 3I07A 1BA3A 3A9UA 5ADZA 3NYQA 1AMUA 1LQLA 4WS9A 1JOSA 5BSRA 1PG3A 5BSUA 2JMPA 2CXCA 3GPCA 3LNVA 4FTFA 4XX2A 4DG8A 4DV5C 4ISBA 5T8SA 3CW8X 2WP0C 4DR1C 3J80D 1XMQC 2UXDC 3A9VA 2UUAC 2E8FA 4YY3C 3NYRA 1O93A 2QVZX 1MKYA 3SO4A 4U5YD 5A1GA 2P2BA 4TPSB 4JI4C 2UXCC 4JI8C 2D1QA 3E7XA 4NXNC 4PZPA 3NPDA 1HNXC 4D57A 1FUGA 4MH4A 3NI2A 3FCEA 5KYTA 2P2JA 5BSVA 5A1IA 2OO4A 1V25A 1XNRC 3OTOC 2ATWA 2ZM6C 1RY2A 4DV2C 1IBMC 1N36C 4NOZA 1HNZC 5BSWA 5BSMA 2PN2A 4L4QA 2E8EA 3TDEA 5IFIA 5CZXA 3TUFA 1N34C 2HHHC 2VQFC 1N32C 2ONFA 2UUBC 5IT9D 1IBLC 4RM3A 4D4IA 2VZEA 1MXBA 4ZLPA 4DV6C 3R9XA 2VSQA 4DCSA 4JYAC 4L2ZA 4JI0C 1V26A 3CJEA 4DV3C 2E7GA 2EGTA 3LUSA 4MTNA 3EERA 5CZVA 3DHVA 4X65C 1HH2P 5BUSA 4LF5C 4GXQA 2Y4OA 1ZB9A 1WF3A 4X66C 2HJGA 1PG4A 4DCUA 4LF6C 2D28C 3CW9A 4BBYA 4WV3A 1N2FA 2BH1X 4ZJZA 4RM2A 1XRCA 4K0BA 5E7QA 5BSTA 2P2QA 3C5EA 1K0RA 3LGXA 5BUQA 2P2MA 4BSZA 1L2FA 4JI6C 4KTVA 3A4IA 2DPLA 1FJGC 1EGAA 3TQIA 5AE2A 4G37A 1O90A 1I94C 4R1MA 1MDBA 3S82A 4R1LA 4R0MA 4JI2C 2E5LC 4X62C 2P20A 4DV0C 1QM4A 4ODJA 3IMLA 4PHTA 4RMNA 5JRHA 4B3TC 4JI1C 3FCCA 3GKUA 3IPLA 4JI7C 4G1IA 4LFBC 5K8FA 2QW0X 2UXBC 1RG9A 2BJOA 2Y4NA 1USPB 2PT7G 3T1YC 2DYJA 5KEIA 2OPLB 1T5DX 3I08A 4FUTA 4I9GA 4PROC 3ETCA 4NXMC 4DV1C 4LF8C 2Y27A 1O9TA 5K85A 3EQ6A 4LF4C 3IEVA 4LE5A 1WH9A 4DUYC 4DCTA 4DR3C 4HPVA 4D56A 2ASBA 2P2FA 4GXRA 4NDNA 2VQEC 4B3MC 2YWCA 3N54B 5FLXD 4DR6C 3H2TA 3UOWA 4DR7C 1MD9A 4BC7A 2P02A 5GTDA 2E8CA 3LAXA 2YCBA 2D1RA 3B7WA 3VNRA 1HNWC 4K0KC 3UZ0A 1LCIA 4D4GA 3RG2A 5DV9A 2YWBA 1O92A 3E7WA 4DR4C 3R44A 1T5HX 1GPMA 4LFAC 2D1TA 5LMUC 4LFCC 4OX9C 4GKKC 1MDFA 4YHHC 4AQYC 4JM1A 3T1HC 4FUQA 3PBKA 4LF9C 1ML8A 1IBKC 3GR0A 3R9WA 1MXAA 4BC9A 5KYVA 5H9UA 5AE1A 1XMOC 5IWAC 1YJ7A 5LMNC 2WD9A 1MXCA 4EATA 4DV4C 4GKJC 1XRBA 2XR1A 4DV7C 2QVXX 4JI3C 2E0GA 1PA4A 3ETOA 5A2QD 1P7LA 4OYCA 2D7VA 3JAMD 5A19A 4L7IA 3AF6A 3G7SA 1ZB8A 4B3SC 2KZFA 4DR5C 1UKKA 3AF5A 4RLQA 1ULTA 4RVNA 2UU9C 2CY1A 3N2QA 4IZ6A 2UUCC 2OBVA 3IEUA 4KHPC 3GR1A 3L95X 4KTTA 4DUZC 1N33C 2D1SA 4B3RC 1VLAA 2PROA 1KKGA 3J81D 4IR7A 4DR2C 3PROC 4JI5C 4JV5C 4OXIA 3VNQA 5AE3A 1XRAA 1J5EC 4DCVA 1XNQC 4LF7C 4RVOA 3PESA 5BURA 1QWIA 3DLPX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH C;  4JI2 C;  4AQY C;  2PN2 A;  1USP A;  1NYE A;  2E5L C;  3T1H C;  5BR8 C;  2E8E A;  4X62 C;  4DV0 C;  4LF9 C;  1ML8 A;  1N34 C;  2HHH C;  1IBK C;  2OPL A;  2VQF C;  2F4V C;  2QL8 A;  1HR0 C;  3R9W A;  4X64 C;  1N32 C;  4B3T C;  4JI1 C;  2ONF A;  2UUB C;  5IT9 D;  1IBL C;  3GKU A;  1XMO C;  4JI7 C;  5IWA C;  5LMN C;  4LFB C;  3I07 A;  4DV6 C;  2UXB C;  4DV4 C;  4GKJ C;  3R9X A;  2XR1 A;  2BJO A;  4DV7 C;  1USP B;  4DCS A;  4JYA C;  2PT7 G;  3T1Y C;  1LQL A;  2DYJ A;  4JI0 C;  4JI3 C;  1JOS A;  2OPL B;  1PA4 A;  5A2Q D;  2JMP A;  2CXC A;  3CJE A;  4DV3 C;  2D7V A;  2E7G A;  4NXM C;  3JAM D;  4DV1 C;  4LF8 C;  2EGT A;  3LUS A;  4MTN A;  3EER A;  4XX2 A;  4DV5 C;  4LF4 C;  4X65 C;  3AF6 A;  3IEV A;  1HH2 P;  3J80 D;  1ZB8 A;  1WH9 A;  4DR1 C;  1XMQ C;  4LF5 C;  2UXD C;  2UUA C;  4B3S C;  2E8F A;  4YY3 C;  2KZF A;  4DUY C;  4DR5 C;  1UKK A;  1ZB9 A;  1MKY A;  4DCT A;  4DR3 C;  3AF5 A;  1WF3 A;  2ASB A;  4X66 C;  2HJG A;  2UU9 C;  2CY1 A;  4LF6 C;  4DCU A;  2UUC C;  4JI4 C;  2UXC C;  4JI8 C;  3IEU A;  2VQE C;  1N2F A;  4B3M C;  5FLX D;  4DR6 C;  4NXN C;  4KHP C;  4DR7 C;  4DUZ C;  1N33 C;  1HNX C;  4B3R C;  1K0R A;  1VLA A;  4MH4 A;  4BSZ A;  2E8C A;  1L2F A;  2YCB A;  4JI6 C;  3J81 D;  4DR2 C;  1KKG A;  4JI5 C;  1HNW C;  4K0K C;  4JV5 C;  1XNR C;  3OTO C;  2ATW A;  2ZM6 C;  4DR4 C;  1J5E C;  4LFA C;  4DV2 C;  1FJG C;  4DCV A;  1IBM C;  1XNQ C;  5LMU C;  4LF7 C;  1EGA A;  4LFC C;  4OX9 C;  1QWI A;  1N36 C;  4NOZ A;  1HNZ C;  4GKK C;  1I94 C; 
#chains in the Genus database with same CATH topology
 5T8T A;  4DG9 A;  2JNV A;  1USP A;  1NYE A;  1XS3 A;  4RLF A;  5BR8 C;  2AYA A;  4G36 A;  3VNS A;  3RV2 A;  4GS5 A;  2OPL A;  2F4V C;  2QL8 A;  1HR0 C;  4X64 C;  3KXW A;  2D27 A;  2KZ0 A;  3L8C A;  4I9F A;  3DAY A;  4BCA A;  2V7B A;  2QVY X;  3I07 A;  1BA3 A;  3A9U A;  5ADZ A;  3NYQ A;  1AMU A;  1LQL A;  1UWD A;  4WS9 A;  1JOS A;  5BSR A;  1PG3 A;  5BSU A;  2JMP A;  2CXC A;  3GPC A;  3LNV A;  4FTF A;  4XX2 A;  4DG8 A;  4DV5 C;  4ISB A;  5T8S A;  3CW8 X;  2WP0 C;  4DR1 C;  3J80 D;  1XMQ C;  2UXD C;  3A9V A;  2UUA C;  2E8F A;  4YY3 C;  3NYR A;  1O93 A;  2QVZ X;  1MKY A;  3SO4 A;  4U5Y D;  5A1G A;  2P2B A;  4TPS B;  1M6X C;  4JI4 C;  2UXC C;  4JI8 C;  1XHJ A;  2D1Q A;  3E7X A;  4NXN C;  4PZP A;  3NPD A;  1HNX C;  4D57 A;  1FUG A;  4MH4 A;  3NI2 A;  3FCE A;  5KYT A;  2P2J A;  5BSV A;  5A1I A;  2OO4 A;  2CU6 A;  1V25 A;  1XNR C;  3OTO C;  2ATW A;  3A25 A;  2ZM6 C;  1RY2 A;  4DV2 C;  1IBM C;  1N36 C;  4NOZ A;  1HNZ C;  5BSW A;  5BSM A;  2PN2 A;  4L4Q A;  2E8E A;  3TDE A;  5IFI A;  5CZX A;  3TUF A;  1N34 C;  2HHH C;  2VQF C;  1N32 C;  2ONF A;  2UUB C;  1FLO A;  5IT9 D;  1IBL C;  4RM3 A;  4D4I A;  2VZE A;  1MXB A;  4ZLP A;  4DV6 C;  3A26 A;  3R9X A;  1M6X A;  2VSQ A;  4DCS A;  4JYA C;  3UX3 A;  4L2Z A;  4JI0 C;  1V26 A;  3CJE A;  4DV3 C;  2E7G A;  2EGT A;  3LUS A;  4MTN A;  3EER A;  1P4E C;  5CZV A;  3DHV A;  4X65 C;  1HH2 P;  5BUS A;  4LF5 C;  4GXQ A;  2Y4O A;  2MM9 A;  1IB8 A;  1ZB9 A;  1WF3 A;  4X66 C;  2HJG A;  2MCQ A;  1PG4 A;  4DCU A;  4LF6 C;  2D28 C;  4BBY A;  1PU1 A;  3CW9 A;  4WV3 A;  5LCI A;  1N2F A;  2BH1 X;  4ZJZ A;  4RM2 A;  1XRC A;  2NCL A;  4K0B A;  5E7Q A;  5BST A;  2P2Q A;  3C5E A;  1K0R A;  3LGX A;  5BUQ A;  2P2M A;  4BSZ A;  1L2F A;  4JI6 C;  4KTV A;  3A4I A;  2DPL A;  2ZZM A;  1TH5 A;  1FJG C;  1EGA A;  3TQI A;  5AE2 A;  4G37 A;  3CQ3 A;  1O90 A;  1I94 C;  4R1M A;  1MDB A;  3S82 A;  4R1L A;  4R0M A;  4JI2 C;  2E5L C;  4X62 C;  2P20 A;  4DV0 C;  1QM4 A;  4ODJ A;  3AY0 A;  4PUH A;  3IML A;  4PHT A;  4RMN A;  5JRH A;  1P4E A;  3K6R A;  4B3T C;  3CQ2 A;  4JI1 C;  3FCC A;  3GKU A;  3IPL A;  4JI7 C;  2MMA B;  4G1I A;  4LFB C;  5K8F A;  2QW0 X;  2UXB C;  1RG9 A;  2BJO A;  2Y4N A;  1USP B;  4PUI A;  2PT7 G;  3T1Y C;  2DYJ A;  5KEI A;  2OPL B;  1T5D X;  3I08 A;  4FUT A;  4I9G A;  4PRO C;  3ETC A;  2M5O A;  4NXM C;  4DV1 C;  4LF8 C;  2DHM A;  2Y27 A;  1O9T A;  5K85 A;  3EQ6 A;  4LF4 C;  3IEV A;  4LE5 A;  1WH9 A;  4DUY C;  3CQ1 A;  4DCT A;  4DR3 C;  2KDN A;  4HPV A;  4D56 A;  2ASB A;  2P2F A;  4GXR A;  4NDN A;  4PUG A;  2VQE C;  4B3M C;  2YWC A;  3N54 B;  5FLX D;  4DR6 C;  3H2T A;  3UOW A;  4DR7 C;  1MD9 A;  2M5H A;  4BC7 A;  2P02 A;  5GTD A;  2E8C A;  3LAX A;  2YCB A;  2D1R A;  3TR3 A;  3B7W A;  3VNR A;  1HNW C;  4K0K C;  1V60 A;  3UZ0 A;  1LCI A;  4D4G A;  3RG2 A;  5DV9 A;  2YWB A;  1O92 A;  3E7W A;  2Z51 A;  3R44 A;  4DR4 C;  1T5H X;  1GPM A;  4LFA C;  2D1T A;  5LMU C;  4LFC C;  4OX9 C;  4GKK C;  1MDF A;  4YHH C;  4AQY C;  4JM1 A;  3T1H C;  4FUQ A;  1WCJ A;  3PBK A;  3UX2 A;  4LF9 C;  1ML8 A;  1IBK C;  3GR0 A;  3R9W A;  1MXA A;  4BC9 A;  5KYV A;  5H9U A;  5AE1 A;  1XMO C;  5IWA C;  1YJ7 A;  5LMN C;  2WD9 A;  1MXC A;  4EAT A;  4DV4 C;  4GKJ C;  1XRB A;  2XR1 A;  4DV7 C;  2QVX X;  4JI3 C;  2E0G A;  2ZZN A;  1PA4 A;  3ETO A;  5A2Q D;  1P7L A;  3LNO A;  4OYC A;  2D7V A;  3JAM D;  2YX1 A;  5A19 A;  4L7I A;  3G7S A;  3AF6 A;  1ZB8 A;  4B3S C;  2KZF A;  3O2E A;  4DR5 C;  1UKK A;  1NY8 A;  3AF5 A;  4RLQ A;  1ULT A;  4RVN A;  2UU9 C;  2CY1 A;  3N2Q A;  4IZ6 A;  2UUC C;  2OBV A;  3IEU A;  4KHP C;  3GR1 A;  3L95 X;  4KTT A;  4DUZ C;  1N33 C;  2D1S A;  4B3R C;  1VLA A;  2PRO A;  1KKG A;  3J81 D;  4IR7 A;  4DR2 C;  3PRO C;  1VEH A;  4JI5 C;  4JV5 C;  4OXI A;  3VNQ A;  5AE3 A;  1XRA A;  1J5E C;  3UEB A;  4DCV A;  1XNQ C;  4LF7 C;  4RVO A;  3PES A;  5BUR A;  1QWI A;  3DLP X; 
#chains in the Genus database with same CATH homology
 5T8T A;  4DG9 A;  1USP A;  1NYE A;  4RLF A;  5BR8 C;  2AYA A;  4G36 A;  3VNS A;  3RV2 A;  4GS5 A;  2OPL A;  2F4V C;  2QL8 A;  1HR0 C;  4X64 C;  3KXW A;  2D27 A;  3L8C A;  4I9F A;  3DAY A;  4BCA A;  2V7B A;  2QVY X;  3I07 A;  1BA3 A;  3A9U A;  5ADZ A;  3NYQ A;  1AMU A;  1LQL A;  4WS9 A;  1JOS A;  5BSR A;  1PG3 A;  5BSU A;  2JMP A;  2CXC A;  3GPC A;  3LNV A;  4FTF A;  4XX2 A;  4DG8 A;  4DV5 C;  4ISB A;  5T8S A;  3CW8 X;  2WP0 C;  4DR1 C;  3J80 D;  1XMQ C;  2UXD C;  3A9V A;  2UUA C;  2E8F A;  4YY3 C;  3NYR A;  1O93 A;  2QVZ X;  1MKY A;  3SO4 A;  4U5Y D;  5A1G A;  2P2B A;  4TPS B;  4JI4 C;  2UXC C;  4JI8 C;  2D1Q A;  3E7X A;  4NXN C;  4PZP A;  3NPD A;  1HNX C;  4D57 A;  1FUG A;  4MH4 A;  3NI2 A;  3FCE A;  5KYT A;  2P2J A;  5BSV A;  5A1I A;  2OO4 A;  1V25 A;  1XNR C;  3OTO C;  2ATW A;  2ZM6 C;  1RY2 A;  4DV2 C;  1IBM C;  1N36 C;  4NOZ A;  1HNZ C;  5BSW A;  5BSM A;  2PN2 A;  4L4Q A;  2E8E A;  3TDE A;  5IFI A;  5CZX A;  3TUF A;  1N34 C;  2HHH C;  2VQF C;  1N32 C;  2ONF A;  2UUB C;  5IT9 D;  1IBL C;  4RM3 A;  4D4I A;  2VZE A;  1MXB A;  4ZLP A;  4DV6 C;  3R9X A;  2VSQ A;  4DCS A;  4JYA C;  4L2Z A;  4JI0 C;  1V26 A;  3CJE A;  4DV3 C;  2E7G A;  2EGT A;  3LUS A;  4MTN A;  3EER A;  5CZV A;  3DHV A;  4X65 C;  1HH2 P;  5BUS A;  4LF5 C;  4GXQ A;  2Y4O A;  1ZB9 A;  1WF3 A;  4X66 C;  2HJG A;  1PG4 A;  4DCU A;  4LF6 C;  2D28 C;  3CW9 A;  4BBY A;  4WV3 A;  1N2F A;  2BH1 X;  4ZJZ A;  4RM2 A;  1XRC A;  4K0B A;  5E7Q A;  5BST A;  2P2Q A;  3C5E A;  1K0R A;  3LGX A;  5BUQ A;  2P2M A;  4BSZ A;  1L2F A;  4JI6 C;  4KTV A;  3A4I A;  2DPL A;  1FJG C;  1EGA A;  3TQI A;  5AE2 A;  4G37 A;  1O90 A;  1I94 C;  4R1M A;  1MDB A;  3S82 A;  4R1L A;  4R0M A;  4JI2 C;  2E5L C;  4X62 C;  2P20 A;  4DV0 C;  1QM4 A;  4ODJ A;  3IML A;  4PHT A;  4RMN A;  5JRH A;  4B3T C;  4JI1 C;  3FCC A;  3GKU A;  3IPL A;  4JI7 C;  4G1I A;  4LFB C;  5K8F A;  2QW0 X;  2UXB C;  1RG9 A;  2BJO A;  2Y4N A;  1USP B;  2PT7 G;  3T1Y C;  2DYJ A;  5KEI A;  2OPL B;  1T5D X;  3I08 A;  4FUT A;  4I9G A;  4PRO C;  3ETC A;  4NXM C;  4DV1 C;  4LF8 C;  2Y27 A;  1O9T A;  5K85 A;  3EQ6 A;  4LF4 C;  3IEV A;  4LE5 A;  1WH9 A;  4DUY C;  4DCT A;  4DR3 C;  4HPV A;  4D56 A;  2ASB A;  2P2F A;  4GXR A;  4NDN A;  2VQE C;  4B3M C;  2YWC A;  3N54 B;  5FLX D;  4DR6 C;  3H2T A;  3UOW A;  4DR7 C;  1MD9 A;  4BC7 A;  2P02 A;  5GTD A;  2E8C A;  3LAX A;  2YCB A;  2D1R A;  3B7W A;  3VNR A;  1HNW C;  4K0K C;  3UZ0 A;  1LCI A;  4D4G A;  3RG2 A;  5DV9 A;  2YWB A;  1O92 A;  3E7W A;  4DR4 C;  3R44 A;  1T5H X;  1GPM A;  4LFA C;  2D1T A;  5LMU C;  4LFC C;  4OX9 C;  4GKK C;  1MDF A;  4YHH C;  4AQY C;  4JM1 A;  3T1H C;  4FUQ A;  3PBK A;  4LF9 C;  1ML8 A;  1IBK C;  3GR0 A;  3R9W A;  1MXA A;  4BC9 A;  5KYV A;  5H9U A;  5AE1 A;  1XMO C;  5IWA C;  1YJ7 A;  5LMN C;  2WD9 A;  1MXC A;  4EAT A;  4DV4 C;  4GKJ C;  1XRB A;  2XR1 A;  4DV7 C;  2QVX X;  4JI3 C;  2E0G A;  1PA4 A;  3ETO A;  5A2Q D;  1P7L A;  4OYC A;  2D7V A;  3JAM D;  5A19 A;  4L7I A;  3AF6 A;  3G7S A;  1ZB8 A;  4B3S C;  2KZF A;  4DR5 C;  1UKK A;  3AF5 A;  4RLQ A;  1ULT A;  4RVN A;  2UU9 C;  2CY1 A;  3N2Q A;  4IZ6 A;  2UUC C;  2OBV A;  3IEU A;  4KHP C;  3GR1 A;  3L95 X;  4KTT A;  4DUZ C;  1N33 C;  2D1S A;  4B3R C;  1VLA A;  2PRO A;  1KKG A;  3J81 D;  4IR7 A;  4DR2 C;  3PRO C;  4JI5 C;  4JV5 C;  4OXI A;  3VNQ A;  5AE3 A;  1XRA A;  1J5E C;  4DCV A;  1XNQ C;  4LF7 C;  4RVO A;  3PES A;  5BUR A;  1QWI A;  3DLP X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...