2E8FA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 (oxidised form)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Aq_1549
publication title Crystal Structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 40
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8fA00
2HHHC 2BJOA 2UUAC 1USPB 1XMQC 4B3RC 1N34C 5IT9D 2JMPA 4JI6C 3AF6A 1JOSA 2PT7G 4OX9C 3EERA 1QWIA 4X62C 4DR1C 1N33C 4B3TC 4DV7C 4LF7C 5A2QD 4JI1C 2UXBC 4LF9C 3R9WA 2HJGA 1HNWC 1LQLA 4X65C 1K0RA 2YCBA 2E8EA 3T1YC 1FJGC 3IEVA 2D7VA 1PA4A 4DV3C 4JI4C 2E7GA 4AQYC 4LFCC 2CY1A 2DYJA 4B3MC 4DR4C 4DV4C 4NXMC 2E8CA 3OTOC 1NYEA 4DV0C 1HR0C 1IBKC 4DCTA 4LF5C 4LF8C 2ASBA 2PN2A 1HNZC 1XNRC 2ONFA 1XMOC 1HNXC 4DV5C 5IWAC 4LF4C 2EGTA 5LMNC 4DCSA 2UXDC 4DCVA 4LFAC 4MTNA 1KKGA 4DR2C 2XR1A 1EGAA 1N36C 1ZB8A 5LMUC 3IEUA 1UKKA 3T1HC 2UXCC 1ZB9A 1IBMC 4JI5C 4DR7C 4DCUA 4DUYC 4JYAC 2F4VC 4XX2A 4NOZA 1I94C 2UUCC 4LFBC 3AF5A 1USPA 4MH4A 2ZM6C 4LF6C 2ATWA 4DR5C 1MKYA 3JAMD 3R9XA 4GKKC 4DUZC 4DV2C 4JI0C 4X66C 1XNQC 2VQEC 3LUSA 4KHPC 4YHHC 4YY3C 2UUBC 4BSZA 4JI2C 4JV5C 2OPLA 2VQFC 3J80D 5FLXD 3GKUA 1L2FA 1N2FA 4DV6C 4GKJC 4K0KC 4X64C 1VLAA 4JI3C 1WF3A 2E5LC 2UU9C 2QL8A 4NXNC 2E8FA 4DR6C 1HH2P 2CXCA 1IBLC 2KZFA 5BR8C 3I07A 3J81D 2OPLB 4JI7C 4DR3C 4JI8C 4DV1C 1ML8A 1N32C 3CJEA 4B3SC 1J5EC 1WH9A
chains in the Genus database with same CATH superfamily
4PHTA 3CQ3A 4JI6C 4FTFA 4RVOA 5A2QD 4LF9C 2HJGA 1PG4A 2ZZMA 1T5HX 3LNVA 5E7QA 3PROC 3O2EA 2D1TA 1FJGC 3IEVA 2D7VA 3K6RA 5BSUA 4D57A 2DYJA 4R1LA 2P2FA 4DR4C 4RM2A 1T5DX 5AE2A 1ULTA 1MXAA 1RY2A 3AY0A 1IBKC 4GXQA 1XS3A 4DCTA 1O93A 2PN2A 1VEHA 2ONFA 1XMOC 1HNXC 4K0BA 3GPCA 3UX3A 4MTNA 1EGAA 3UZ0A 4FUTA 5LMUC 2KZ0A 3T1HC 5BSWA 2D1SA 5KYTA 4DR7C 1I94C 2WP0C 3NYQA 4PUHA 3TQIA 2UUCC 1USPA 3VNQA 1MXBA 4GS5A 4R0MA 2CU6A 5AE3A 1P4EC 3E7XA 4X66C 2VQEC 4KHPC 4YY3C 4PUIA 4JV5C 1XRBA 3E7WA 1NY8A 2MMAB 4G1IA 4DV6C 2D28C 2YX1A 2UU9C 2DPLA 2E8FA 5T8SA 4DR6C 1IBLC 5K8FA 1GPMA 4JI7C 1IB8A 3L8CA 1N32C 4B3SC 4PROC 4KTVA 4BC9A 4RMNA 4WS9A 1USPB 5IT9D 1JOSA 4OX9C 4X62C 4WV3A 2UXBC 3CW8X 4L2ZA 3NI2A 4RVNA 2YCBA 5CZXA 3T1YC 4JI4C 1BA3A 4RM3A 4NXMC 1O90A 1NYEA 4DV0C 1HR0C 4BC7A 2VZEA 4NDNA 2V7BA 3FCCA 4LF8C 3TUFA 2ASBA 1XNRC 1O9TA 5BSTA 4GXRA 1LCIA 5IWAC 4LF4C 2EGTA 4EATA 2QVXX 4DCSA 4DCVA 5GTDA 4LFAC 2P2QA 1KKGA 1N36C 3LAXA 1ZB8A 3NPDA 4ODJA 3IEUA 1UKKA 5BSMA 1YJ7A 1ZB9A 5BSRA 3S82A 3ETCA 4XX2A 3DLPX 4MH4A 2ZM6C 1MKYA 2QVYX 5KEIA 4G36A 2NCLA 4DUZC 4DV2C 3CQ2A 1MDFA 3A9VA 1XNQC 5T8TA 5BURA 2UUBC 4JI2C 3SO4A 4D56A 3CW9A 4X64C 2YWCA 1MDBA 2QL8A 4NXNC 4IR7A 3TR3A 3GR0A 5BSVA 1HH2P 2CXCA 5AE1A 2KZFA 1M6XC 1XHJA 2BH1X 5CZVA 4JI8C 4PUGA 4ISBA 1WH9A 2BJOA 2PROA 3KXWA 2UUAC 5BUSA 5IFIA 5A19A 1FLOA 2P02A 3CQ1A 3AF6A 3EQ6A 3EERA 1QWIA 2ZZNA 1N33C 4B3TC 4DV7C 4JI1C 3TDEA 4L7IA 4X65C 2WD9A 2E8EA 2P20A 1PA4A 1PG3A 4R1MA 4BBYA 4OYCA 4DV4C 5H9UA 1M6XA 4KTTA 5DV9A 3IMLA 1XRCA 4LF5C 4DV5C 4I9FA 2Y4OA 2XR1A 2D27A 2VSQA 3N2QA 3LNOA 5K85A 2UXCC 2MCQA 4DUYC 4JYAC 3PESA 4D4IA 4NOZA 4RLFA 3AF5A 4LF6C 2AYAA 4DR5C 3B7WA 3GR1A 4JI0C 3A9UA 1UWDA 2KDNA 2VQFC 4OXIA 4ZJZA 1TH5A 2QW0X 1P7LA 1N2FA 1V26A 3DAYA 1VLAA 4I9GA 1WF3A 2E5LC 1QM4A 5LCIA 4DG9A 3A25A 2DHMA 2Y27A 4TPSB 3I07A 4D4GA 3J81D 2OPLB 1V60A 3UOWA 4DV1C 1ML8A 3DHVA 3R44A 1FUGA 3CJEA 4B3MC 2OO4A 2HHHC 2D1RA 1XMQC 4B3RC 1N34C 1MXCA 2JMPA 2PT7G 3PBKA 3G7SA 4DR1C 4PZPA 4LF7C 3R9WA 1HNWC 1LQLA 2E0GA 2P2MA 1K0RA 3IPLA 4DV3C 4G37A 2E7GA 4AQYC 5ADZA 4LFCC 2CY1A 1RG9A 2Z51A 5KYVA 2QVZX 3OTOC 2E8CA 5A1GA 3L95X 1WCJA 3H2TA 1HNZC 1PU1A 5LMNC 1O92A 2UXDC 5JRHA 3UX2A 4L4QA 4DR2C 4JM1A 2YWBA 3VNRA 3VNSA 1IBMC 2MM9A 4JI5C 1V25A 4DCUA 3C5EA 2F4VC 5A1IA 4BCAA 4LFBC 3A26A 2ATWA 3UEBA 2M5OA 3JAMD 2JNVA 3R9XA 4GKKC 3ETOA 5BUQA 3LUSA 4YHHC 4BSZA 2OPLA 3J80D 2Y4NA 5FLXD 2OBVA 3GKUA 1L2FA 4U5YD 4GKJC 2P2JA 4LE5A 3RV2A 4K0KC 2M5HA 1AMUA 4JI3C 3N54B 1P4EA 4DG8A 2D1QA 4RLQA 3I08A 4HPVA 3RG2A 1XRAA 5BR8C 3A4IA 4IZ6A 3FCEA 4DR3C 4ZLPA 2P2BA 4FUQA 3NYRA 3LGXA 1MD9A 1J5EC
chains in the Genus database with same CATH topology
4PHTA 4JI6C 4FTFA 4RVOA 5A2QD 4LF9C 2HJGA 1PG4A 1T5HX 3LNVA 5E7QA 3PROC 2D1TA 1FJGC 3IEVA 2D7VA 5BSUA 4D57A 2DYJA 4R1LA 2P2FA 4DR4C 4RM2A 1T5DX 5AE2A 1ULTA 1MXAA 1RY2A 1IBKC 4GXQA 4DCTA 1O93A 2PN2A 2ONFA 1XMOC 1HNXC 4K0BA 3GPCA 4MTNA 1EGAA 3UZ0A 4FUTA 5LMUC 3T1HC 5BSWA 2D1SA 5KYTA 4DR7C 1I94C 2WP0C 3NYQA 3TQIA 2UUCC 1USPA 3VNQA 1MXBA 4GS5A 4R0MA 5AE3A 3E7XA 4X66C 2VQEC 4KHPC 4YY3C 4JV5C 1XRBA 3E7WA 4G1IA 4DV6C 2D28C 2UU9C 2DPLA 2E8FA 5T8SA 4DR6C 1IBLC 5K8FA 1GPMA 4JI7C 3L8CA 1N32C 4B3SC 4PROC 4KTVA 4BC9A 4RMNA 4WS9A 1USPB 5IT9D 1JOSA 4OX9C 4X62C 4WV3A 2UXBC 3CW8X 4L2ZA 3NI2A 4RVNA 2YCBA 5CZXA 3T1YC 4JI4C 1BA3A 4RM3A 4NXMC 1O90A 1NYEA 4DV0C 1HR0C 4BC7A 2VZEA 4NDNA 2V7BA 3FCCA 4LF8C 3TUFA 2ASBA 1XNRC 1O9TA 5BSTA 4GXRA 1LCIA 5IWAC 4LF4C 2EGTA 4EATA 2QVXX 4DCSA 4DCVA 5GTDA 4LFAC 2P2QA 1KKGA 1N36C 3LAXA 1ZB8A 3NPDA 4ODJA 3IEUA 1UKKA 5BSMA 1YJ7A 1ZB9A 5BSRA 3S82A 3ETCA 4XX2A 3DLPX 4MH4A 2ZM6C 1MKYA 2QVYX 5KEIA 4G36A 4DUZC 4DV2C 1MDFA 3A9VA 1XNQC 5T8TA 5BURA 2UUBC 4JI2C 3SO4A 4D56A 3CW9A 4X64C 2YWCA 1MDBA 2QL8A 4NXNC 4IR7A 3GR0A 5BSVA 1HH2P 2CXCA 5AE1A 2KZFA 2BH1X 5CZVA 4JI8C 4ISBA 1WH9A 2BJOA 2PROA 3KXWA 2UUAC 5BUSA 5IFIA 5A19A 2P02A 3AF6A 3EQ6A 3EERA 1QWIA 1N33C 4B3TC 4DV7C 4JI1C 3TDEA 4L7IA 4X65C 2WD9A 2E8EA 2P20A 1PA4A 1PG3A 4R1MA 4BBYA 4OYCA 4DV4C 5H9UA 4KTTA 5DV9A 3IMLA 1XRCA 4LF5C 4DV5C 4I9FA 2Y4OA 2XR1A 2D27A 2VSQA 3N2QA 5K85A 2UXCC 4DUYC 4JYAC 3PESA 4D4IA 4NOZA 4RLFA 3AF5A 4LF6C 2AYAA 4DR5C 3B7WA 3GR1A 4JI0C 3A9UA 2VQFC 4OXIA 4ZJZA 2QW0X 1P7LA 1N2FA 1V26A 3DAYA 1VLAA 4I9GA 1WF3A 2E5LC 1QM4A 4DG9A 2Y27A 4TPSB 3I07A 4D4GA 3J81D 2OPLB 3UOWA 4DV1C 1ML8A 3DHVA 3R44A 1FUGA 3CJEA 4B3MC 2OO4A 2HHHC 2D1RA 1XMQC 4B3RC 1N34C 1MXCA 2JMPA 2PT7G 3PBKA 3G7SA 4DR1C 4PZPA 4LF7C 3R9WA 1HNWC 1LQLA 2E0GA 2P2MA 1K0RA 3IPLA 4DV3C 4G37A 2E7GA 4AQYC 5ADZA 4LFCC 2CY1A 1RG9A 5KYVA 2QVZX 3OTOC 2E8CA 5A1GA 3L95X 3H2TA 1HNZC 5LMNC 1O92A 2UXDC 5JRHA 4L4QA 4DR2C 4JM1A 2YWBA 3VNRA 3VNSA 1IBMC 4JI5C 1V25A 4DCUA 3C5EA 2F4VC 5A1IA 4BCAA 4LFBC 2ATWA 3JAMD 3R9XA 4GKKC 3ETOA 5BUQA 3LUSA 4YHHC 4BSZA 2OPLA 3J80D 2Y4NA 5FLXD 2OBVA 3GKUA 1L2FA 4U5YD 4GKJC 2P2JA 4LE5A 3RV2A 4K0KC 1AMUA 4JI3C 3N54B 4DG8A 2D1QA 4RLQA 3I08A 4HPVA 3RG2A 1XRAA 5BR8C 3A4IA 4IZ6A 3FCEA 4DR3C 4ZLPA 2P2BA 4FUQA 3NYRA 3LGXA 1MD9A 1J5EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH C;  2BJO A;  2UUA C;  1USP B;  1XMQ C;  4B3R C;  1N34 C;  5IT9 D;  2JMP A;  4JI6 C;  3AF6 A;  1JOS A;  2PT7 G;  4OX9 C;  3EER A;  1QWI A;  4X62 C;  4DR1 C;  1N33 C;  4B3T C;  4DV7 C;  4LF7 C;  5A2Q D;  4JI1 C;  2UXB C;  4LF9 C;  3R9W A;  2HJG A;  1HNW C;  1LQL A;  4X65 C;  1K0R A;  2YCB A;  2E8E A;  3T1Y C;  1FJG C;  3IEV A;  2D7V A;  1PA4 A;  4DV3 C;  4JI4 C;  2E7G A;  4AQY C;  4LFC C;  2CY1 A;  2DYJ A;  4B3M C;  4DR4 C;  4DV4 C;  4NXM C;  2E8C A;  3OTO C;  1NYE A;  4DV0 C;  1HR0 C;  1IBK C;  4DCT A;  4LF5 C;  4LF8 C;  2ASB A;  2PN2 A;  1HNZ C;  1XNR C;  2ONF A;  1XMO C;  1HNX C;  4DV5 C;  5IWA C;  4LF4 C;  2EGT A;  5LMN C;  4DCS A;  2UXD C;  4DCV A;  4LFA C;  4MTN A;  1KKG A;  4DR2 C;  2XR1 A;  1EGA A;  1N36 C;  1ZB8 A;  5LMU C;  3IEU A;  1UKK A;  3T1H C;  2UXC C;  1ZB9 A;  1IBM C;  4JI5 C;  4DR7 C;  4DCU A;  4DUY C;  4JYA C;  2F4V C;  4XX2 A;  4NOZ A;  1I94 C;  2UUC C;  4LFB C;  3AF5 A;  1USP A;  4MH4 A;  2ZM6 C;  4LF6 C;  2ATW A;  4DR5 C;  1MKY A;  3JAM D;  3R9X A;  4GKK C;  4DUZ C;  4DV2 C;  4JI0 C;  4X66 C;  1XNQ C;  2VQE C;  3LUS A;  4KHP C;  4YHH C;  4YY3 C;  2UUB C;  4BSZ A;  4JI2 C;  4JV5 C;  2OPL A;  2VQF C;  3J80 D;  5FLX D;  3GKU A;  1L2F A;  1N2F A;  4DV6 C;  4GKJ C;  4K0K C;  4X64 C;  1VLA A;  4JI3 C;  1WF3 A;  2E5L C;  2UU9 C;  2QL8 A;  4NXN C;  2E8F A;  4DR6 C;  1HH2 P;  2CXC A;  1IBL C;  2KZF A;  5BR8 C;  3I07 A;  3J81 D;  2OPL B;  4JI7 C;  4DR3 C;  4JI8 C;  4DV1 C;  1ML8 A;  1N32 C;  3CJE A;  4B3S C;  1J5E C;  1WH9 A; 
#chains in the Genus database with same CATH topology
 4PHT A;  3CQ3 A;  4JI6 C;  4FTF A;  4RVO A;  5A2Q D;  4LF9 C;  2HJG A;  1PG4 A;  2ZZM A;  1T5H X;  3LNV A;  5E7Q A;  3PRO C;  3O2E A;  2D1T A;  1FJG C;  3IEV A;  2D7V A;  3K6R A;  5BSU A;  4D57 A;  2DYJ A;  4R1L A;  2P2F A;  4DR4 C;  4RM2 A;  1T5D X;  5AE2 A;  1ULT A;  1MXA A;  1RY2 A;  3AY0 A;  1IBK C;  4GXQ A;  1XS3 A;  4DCT A;  1O93 A;  2PN2 A;  1VEH A;  2ONF A;  1XMO C;  1HNX C;  4K0B A;  3GPC A;  3UX3 A;  4MTN A;  1EGA A;  3UZ0 A;  4FUT A;  5LMU C;  2KZ0 A;  3T1H C;  5BSW A;  2D1S A;  5KYT A;  4DR7 C;  1I94 C;  2WP0 C;  3NYQ A;  4PUH A;  3TQI A;  2UUC C;  1USP A;  3VNQ A;  1MXB A;  4GS5 A;  4R0M A;  2CU6 A;  5AE3 A;  1P4E C;  3E7X A;  4X66 C;  2VQE C;  4KHP C;  4YY3 C;  4PUI A;  4JV5 C;  1XRB A;  3E7W A;  1NY8 A;  2MMA B;  4G1I A;  4DV6 C;  2D28 C;  2YX1 A;  2UU9 C;  2DPL A;  2E8F A;  5T8S A;  4DR6 C;  1IBL C;  5K8F A;  1GPM A;  4JI7 C;  1IB8 A;  3L8C A;  1N32 C;  4B3S C;  4PRO C;  4KTV A;  4BC9 A;  4RMN A;  4WS9 A;  1USP B;  5IT9 D;  1JOS A;  4OX9 C;  4X62 C;  4WV3 A;  2UXB C;  3CW8 X;  4L2Z A;  3NI2 A;  4RVN A;  2YCB A;  5CZX A;  3T1Y C;  4JI4 C;  1BA3 A;  4RM3 A;  4NXM C;  1O90 A;  1NYE A;  4DV0 C;  1HR0 C;  4BC7 A;  2VZE A;  4NDN A;  2V7B A;  3FCC A;  4LF8 C;  3TUF A;  2ASB A;  1XNR C;  1O9T A;  5BST A;  4GXR A;  1LCI A;  5IWA C;  4LF4 C;  2EGT A;  4EAT A;  2QVX X;  4DCS A;  4DCV A;  5GTD A;  4LFA C;  2P2Q A;  1KKG A;  1N36 C;  3LAX A;  1ZB8 A;  3NPD A;  4ODJ A;  3IEU A;  1UKK A;  5BSM A;  1YJ7 A;  1ZB9 A;  5BSR A;  3S82 A;  3ETC A;  4XX2 A;  3DLP X;  4MH4 A;  2ZM6 C;  1MKY A;  2QVY X;  5KEI A;  4G36 A;  2NCL A;  4DUZ C;  4DV2 C;  3CQ2 A;  1MDF A;  3A9V A;  1XNQ C;  5T8T A;  5BUR A;  2UUB C;  4JI2 C;  3SO4 A;  4D56 A;  3CW9 A;  4X64 C;  2YWC A;  1MDB A;  2QL8 A;  4NXN C;  4IR7 A;  3TR3 A;  3GR0 A;  5BSV A;  1HH2 P;  2CXC A;  5AE1 A;  2KZF A;  1M6X C;  1XHJ A;  2BH1 X;  5CZV A;  4JI8 C;  4PUG A;  4ISB A;  1WH9 A;  2BJO A;  2PRO A;  3KXW A;  2UUA C;  5BUS A;  5IFI A;  5A19 A;  1FLO A;  2P02 A;  3CQ1 A;  3AF6 A;  3EQ6 A;  3EER A;  1QWI A;  2ZZN A;  1N33 C;  4B3T C;  4DV7 C;  4JI1 C;  3TDE A;  4L7I A;  4X65 C;  2WD9 A;  2E8E A;  2P20 A;  1PA4 A;  1PG3 A;  4R1M A;  4BBY A;  4OYC A;  4DV4 C;  5H9U A;  1M6X A;  4KTT A;  5DV9 A;  3IML A;  1XRC A;  4LF5 C;  4DV5 C;  4I9F A;  2Y4O A;  2XR1 A;  2D27 A;  2VSQ A;  3N2Q A;  3LNO A;  5K85 A;  2UXC C;  2MCQ A;  4DUY C;  4JYA C;  3PES A;  4D4I A;  4NOZ A;  4RLF A;  3AF5 A;  4LF6 C;  2AYA A;  4DR5 C;  3B7W A;  3GR1 A;  4JI0 C;  3A9U A;  1UWD A;  2KDN A;  2VQF C;  4OXI A;  4ZJZ A;  1TH5 A;  2QW0 X;  1P7L A;  1N2F A;  1V26 A;  3DAY A;  1VLA A;  4I9G A;  1WF3 A;  2E5L C;  1QM4 A;  5LCI A;  4DG9 A;  3A25 A;  2DHM A;  2Y27 A;  4TPS B;  3I07 A;  4D4G A;  3J81 D;  2OPL B;  1V60 A;  3UOW A;  4DV1 C;  1ML8 A;  3DHV A;  3R44 A;  1FUG A;  3CJE A;  4B3M C;  2OO4 A;  2HHH C;  2D1R A;  1XMQ C;  4B3R C;  1N34 C;  1MXC A;  2JMP A;  2PT7 G;  3PBK A;  3G7S A;  4DR1 C;  4PZP A;  4LF7 C;  3R9W A;  1HNW C;  1LQL A;  2E0G A;  2P2M A;  1K0R A;  3IPL A;  4DV3 C;  4G37 A;  2E7G A;  4AQY C;  5ADZ A;  4LFC C;  2CY1 A;  1RG9 A;  2Z51 A;  5KYV A;  2QVZ X;  3OTO C;  2E8C A;  5A1G A;  3L95 X;  1WCJ A;  3H2T A;  1HNZ C;  1PU1 A;  5LMN C;  1O92 A;  2UXD C;  5JRH A;  3UX2 A;  4L4Q A;  4DR2 C;  4JM1 A;  2YWB A;  3VNR A;  3VNS A;  1IBM C;  2MM9 A;  4JI5 C;  1V25 A;  4DCU A;  3C5E A;  2F4V C;  5A1I A;  4BCA A;  4LFB C;  3A26 A;  2ATW A;  3UEB A;  2M5O A;  3JAM D;  2JNV A;  3R9X A;  4GKK C;  3ETO A;  5BUQ A;  3LUS A;  4YHH C;  4BSZ A;  2OPL A;  3J80 D;  2Y4N A;  5FLX D;  2OBV A;  3GKU A;  1L2F A;  4U5Y D;  4GKJ C;  2P2J A;  4LE5 A;  3RV2 A;  4K0K C;  2M5H A;  1AMU A;  4JI3 C;  3N54 B;  1P4E A;  4DG8 A;  2D1Q A;  4RLQ A;  3I08 A;  4HPV A;  3RG2 A;  1XRA A;  5BR8 C;  3A4I A;  4IZ6 A;  3FCE A;  4DR3 C;  4ZLP A;  2P2B A;  4FUQ A;  3NYR A;  3LGX A;  1MD9 A;  1J5E C; 
#chains in the Genus database with same CATH homology
 4PHT A;  4JI6 C;  4FTF A;  4RVO A;  5A2Q D;  4LF9 C;  2HJG A;  1PG4 A;  1T5H X;  3LNV A;  5E7Q A;  3PRO C;  2D1T A;  1FJG C;  3IEV A;  2D7V A;  5BSU A;  4D57 A;  2DYJ A;  4R1L A;  2P2F A;  4DR4 C;  4RM2 A;  1T5D X;  5AE2 A;  1ULT A;  1MXA A;  1RY2 A;  1IBK C;  4GXQ A;  4DCT A;  1O93 A;  2PN2 A;  2ONF A;  1XMO C;  1HNX C;  4K0B A;  3GPC A;  4MTN A;  1EGA A;  3UZ0 A;  4FUT A;  5LMU C;  3T1H C;  5BSW A;  2D1S A;  5KYT A;  4DR7 C;  1I94 C;  2WP0 C;  3NYQ A;  3TQI A;  2UUC C;  1USP A;  3VNQ A;  1MXB A;  4GS5 A;  4R0M A;  5AE3 A;  3E7X A;  4X66 C;  2VQE C;  4KHP C;  4YY3 C;  4JV5 C;  1XRB A;  3E7W A;  4G1I A;  4DV6 C;  2D28 C;  2UU9 C;  2DPL A;  2E8F A;  5T8S A;  4DR6 C;  1IBL C;  5K8F A;  1GPM A;  4JI7 C;  3L8C A;  1N32 C;  4B3S C;  4PRO C;  4KTV A;  4BC9 A;  4RMN A;  4WS9 A;  1USP B;  5IT9 D;  1JOS A;  4OX9 C;  4X62 C;  4WV3 A;  2UXB C;  3CW8 X;  4L2Z A;  3NI2 A;  4RVN A;  2YCB A;  5CZX A;  3T1Y C;  4JI4 C;  1BA3 A;  4RM3 A;  4NXM C;  1O90 A;  1NYE A;  4DV0 C;  1HR0 C;  4BC7 A;  2VZE A;  4NDN A;  2V7B A;  3FCC A;  4LF8 C;  3TUF A;  2ASB A;  1XNR C;  1O9T A;  5BST A;  4GXR A;  1LCI A;  5IWA C;  4LF4 C;  2EGT A;  4EAT A;  2QVX X;  4DCS A;  4DCV A;  5GTD A;  4LFA C;  2P2Q A;  1KKG A;  1N36 C;  3LAX A;  1ZB8 A;  3NPD A;  4ODJ A;  3IEU A;  1UKK A;  5BSM A;  1YJ7 A;  1ZB9 A;  5BSR A;  3S82 A;  3ETC A;  4XX2 A;  3DLP X;  4MH4 A;  2ZM6 C;  1MKY A;  2QVY X;  5KEI A;  4G36 A;  4DUZ C;  4DV2 C;  1MDF A;  3A9V A;  1XNQ C;  5T8T A;  5BUR A;  2UUB C;  4JI2 C;  3SO4 A;  4D56 A;  3CW9 A;  4X64 C;  2YWC A;  1MDB A;  2QL8 A;  4NXN C;  4IR7 A;  3GR0 A;  5BSV A;  1HH2 P;  2CXC A;  5AE1 A;  2KZF A;  2BH1 X;  5CZV A;  4JI8 C;  4ISB A;  1WH9 A;  2BJO A;  2PRO A;  3KXW A;  2UUA C;  5BUS A;  5IFI A;  5A19 A;  2P02 A;  3AF6 A;  3EQ6 A;  3EER A;  1QWI A;  1N33 C;  4B3T C;  4DV7 C;  4JI1 C;  3TDE A;  4L7I A;  4X65 C;  2WD9 A;  2E8E A;  2P20 A;  1PA4 A;  1PG3 A;  4R1M A;  4BBY A;  4OYC A;  4DV4 C;  5H9U A;  4KTT A;  5DV9 A;  3IML A;  1XRC A;  4LF5 C;  4DV5 C;  4I9F A;  2Y4O A;  2XR1 A;  2D27 A;  2VSQ A;  3N2Q A;  5K85 A;  2UXC C;  4DUY C;  4JYA C;  3PES A;  4D4I A;  4NOZ A;  4RLF A;  3AF5 A;  4LF6 C;  2AYA A;  4DR5 C;  3B7W A;  3GR1 A;  4JI0 C;  3A9U A;  2VQF C;  4OXI A;  4ZJZ A;  2QW0 X;  1P7L A;  1N2F A;  1V26 A;  3DAY A;  1VLA A;  4I9G A;  1WF3 A;  2E5L C;  1QM4 A;  4DG9 A;  2Y27 A;  4TPS B;  3I07 A;  4D4G A;  3J81 D;  2OPL B;  3UOW A;  4DV1 C;  1ML8 A;  3DHV A;  3R44 A;  1FUG A;  3CJE A;  4B3M C;  2OO4 A;  2HHH C;  2D1R A;  1XMQ C;  4B3R C;  1N34 C;  1MXC A;  2JMP A;  2PT7 G;  3PBK A;  3G7S A;  4DR1 C;  4PZP A;  4LF7 C;  3R9W A;  1HNW C;  1LQL A;  2E0G A;  2P2M A;  1K0R A;  3IPL A;  4DV3 C;  4G37 A;  2E7G A;  4AQY C;  5ADZ A;  4LFC C;  2CY1 A;  1RG9 A;  5KYV A;  2QVZ X;  3OTO C;  2E8C A;  5A1G A;  3L95 X;  3H2T A;  1HNZ C;  5LMN C;  1O92 A;  2UXD C;  5JRH A;  4L4Q A;  4DR2 C;  4JM1 A;  2YWB A;  3VNR A;  3VNS A;  1IBM C;  4JI5 C;  1V25 A;  4DCU A;  3C5E A;  2F4V C;  5A1I A;  4BCA A;  4LFB C;  2ATW A;  3JAM D;  3R9X A;  4GKK C;  3ETO A;  5BUQ A;  3LUS A;  4YHH C;  4BSZ A;  2OPL A;  3J80 D;  2Y4N A;  5FLX D;  2OBV A;  3GKU A;  1L2F A;  4U5Y D;  4GKJ C;  2P2J A;  4LE5 A;  3RV2 A;  4K0K C;  1AMU A;  4JI3 C;  3N54 B;  4DG8 A;  2D1Q A;  4RLQ A;  3I08 A;  4HPV A;  3RG2 A;  1XRA A;  5BR8 C;  3A4I A;  4IZ6 A;  3FCE A;  4DR3 C;  4ZLP A;  2P2B A;  4FUQ A;  3NYR A;  3LGX A;  1MD9 A;  1J5E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...