2OPLA

Crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
181
structure length
180
Chain Sequence
TTVVNGVNVDQLMATIEQIKAKPEIAQFKFRATNQWMGGTHNQATIKDFYGAAEDDTRKPMVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGLSEEVPVGYREIRVFFSIDADLTDGQKEELIRMAQKYSPVYNTVAKPVPVAVLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (NP_953832.1) from Geobacter sulfurreducens at 1.50 A resolution
rcsb
source organism Geobacter sulfurreducens
total genus 44
structure length 180
sequence length 181
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2oplA01
4JI3C 1WF3A 1QWIA 4JI6C 5LMUC 5BR8C 4LF9C 4NXMC 1J5EC 4B3MC 1HR0C 1L2FA 2YCBA 1IBLC 4MTNA 3I07A 2HHHC 3EERA 3GKUA 1PA4A 4JI1C 2E5LC 2ONFA 3T1YC 4JI0C 1XNQC 2XR1A 3T1HC 4YY3C 2CXCA 4B3SC 4X64C 4K0KC 5IT9D 2EGTA 4DV5C 4JI5C 4NOZA 4OX9C 4JI4C 4AQYC 1N32C 1ZB9A 1VLAA 3AF6A 4LF8C 1KKGA 1FJGC 4DV0C 2KZFA 2UUBC 5LMNC 1N33C 4YHHC 3JAMD 4B3TC 4KHPC 4DCTA 4DR6C 2UU9C 4JI8C 4XX2A 2ZM6C 1IBKC 1HNXC 2OPLB 1NYEA 1MKYA 1N36C 1JOSA 2HJGA 4DV2C 4LFAC 1HNZC 1K0RA 2DYJA 2PN2A 1N2FA 4GKJC 4JI7C 4GKKC 4DV6C 1XMQC 1IBMC 4DV1C 4LFCC 3J81D 2E7GA 4DCUA 5A2QD 2F4VC 2BJOA 1HNWC 3R9XA 4DR1C 2UXCC 4NXNC 4DR3C 1I94C 2ASBA 4DR7C 1N34C 4DUZC 4DCVA 1USPB 2OPLA 2VQEC 2JMPA 3IEVA 3LUSA 4X65C 5IWAC 2UXDC 3IEUA 2CY1A 3CJEA 4LF6C 4LF5C 4DUYC 4MH4A 1XNRC 1HH2P 4JYAC 4DV3C 1EGAA 2E8CA 4X62C 4DR2C 2D7VA 5FLXD 4JV5C 4B3RC 4LF4C 1UKKA 4X66C 2E8EA 2ATWA 3J80D 4DCSA 4DR5C 4JI2C 4DV7C 2UXBC 3OTOC 4BSZA 1ZB8A 1WH9A 4LFBC 4DR4C 1ML8A 2UUAC 2VQFC 2UUCC 3R9WA 2PT7G 1LQLA 2QL8A 4DV4C 1USPA 3AF5A 2E8FA 1XMOC 4LF7C
chains in the Genus database with same CATH superfamily
1QWIA 3CW9A 3O2EA 1L2FA 2YCBA 1IBLC 2DHMA 3A26A 2HHHC 3PBKA 3GKUA 3NPDA 2CXCA 2MMAB 4D57A 2D27A 2Y4NA 1O93A 2Y4OA 1ZB9A 5BSRA 4BC7A 1KKGA 1FJGC 3UX3A 4DV0C 2KZFA 3DHVA 5BSUA 1N33C 3JAMD 4B3TC 4KHPC 4ZLPA 4EATA 1HNXC 3EQ6A 4GXRA 4DV2C 1T5HX 4R0MA 3E7XA 4GKKC 1MXBA 3J81D 1XRBA 2F4VC 3UEBA 3R44A 4ISBA 1O92A 3CQ2A 2Y27A 3UOWA 1GPMA 1WCJA 2VSQA 3TUFA 2V7BA 4D56A 1MD9A 2VQEC 2JMPA 1MXCA 3LUSA 5IWAC 4LF6C 4FTFA 4JM1A 3SO4A 4MH4A 5BUSA 5JRHA 1EGAA 4X62C 1XRAA 3VNSA 1UKKA 2D1RA 5BSTA 4X66C 2ATWA 4DCSA 2YX1A 2UXBC 3NYRA 4BSZA 2VQFC 4RMNA 2UUCC 1MXAA 3A9VA 5A1GA 1WF3A 4LF9C 4IZ6A 4B3MC 2ZZNA 4G37A 3TDEA 3AY0A 3EERA 1AMUA 4JI1C 1ULTA 3PROC 2ONFA 1XNQC 3VNQA 2E0GA 4NOZA 4OX9C 4BC9A 2P20A 4LF8C 4BBYA 1TH5A 4RLQA 4L7IA 5H9UA 4XX2A 1IBKC 3CW8X 2NCLA 1JOSA 1V25A 1K0RA 2PN2A 1N2FA 4GKJC 3IPLA 4I9GA 5CZXA 4DV6C 2E7GA 4PUHA 5A2QD 3R9XA 5KYVA 3TQIA 4NXNC 4DR3C 3FCEA 3KXWA 1PG3A 4GS5A 3RV2A 2UXDC 1NY8A 3DLPX 4PROC 1HH2P 1XS3A 4D4GA 2E8CA 4DR2C 5DV9A 5FLXD 5K8FA 2WD9A 3A25A 3VNRA 3UX2A 2UUAC 1RY2A 4G36A 4U5YD 4G1IA 4JI3C 4JI6C 5LMUC 5BR8C 5BSMA 4ODJA 4NXMC 3FCCA 1UWDA 3I07A 1FUGA 2YWCA 3E7WA 1IB8A 2OBVA 3IMLA 4RVOA 3N2QA 3PESA 3CQ3A 5LCIA 4IR7A 4JI0C 3T1HC 3GR0A 4YY3C 4X64C 3L95X 2MM9A 4RLFA 5IT9D 2EGTA 5E7QA 4DV5C 4JI5C 1V26A 1QM4A 4JI4C 3S82A 4AQYC 4BCAA 1N32C 2P02A 1VLAA 5AE3A 1YJ7A 5KYTA 3GR1A 4KTTA 4WS9A 3A9UA 3CQ1A 4DR6C 2UU9C 5BSWA 2AYAA 4RM3A 2ZM6C 3A4IA 1NYEA 4PHTA 5KEIA 3H2TA 4R1LA 2HJGA 4LFAC 1V60A 1HNZC 2DYJA 4RM2A 2P2JA 3LAXA 4HPVA 4DV1C 2BH1X 4PUGA 2D1QA 4RVNA 3I08A 1O90A 4I9FA 4DG9A 4OXIA 1I94C 1FLOA 4DUZC 2P2FA 2OPLA 1XRCA 2CU6A 3IEVA 3IEUA 2CY1A 3CJEA 3RG2A 5IFIA 4DUYC 5BSVA 1XNRC 4JYAC 4DV3C 5BURA 2D7VA 1BA3A 4B3RC 2D1TA 4LF4C 3LGXA 4R1MA 2MCQA 3J80D 4NDNA 1O9TA 4DV7C 4WV3A 2DPLA 3NI2A 1ZB8A 4DR4C 1ML8A 3R9WA 2QVZX 1LQLA 2QL8A 4FUQA 5CZVA 2OO4A 4DV4C 5BUQA 1USPA 3AF5A 3B7WA 5T8SA 4LF7C 2QVYX 2P2MA 3ETCA 3C5EA 3DAYA 1J5EC 1HR0C 4MTNA 1M6XC 5AE2A 1PA4A 4TPSB 2E5LC 4GXQA 3T1YC 2XR1A 4B3SC 4K0KC 1RG9A 4LE5A 1T5DX 3G7SA 3AF6A 2D1SA 1P7LA 1VEHA 1MDFA 2UUBC 3L8CA 5LMNC 3LNOA 3LNVA 4YHHC 4DCTA 4D4IA 4JI8C 3K6RA 5AE1A 2OPLB 2P2BA 1MKYA 3N54B 1N36C 4K0BA 2JNVA 4L2ZA 2QVXX 2KZ0A 2KDNA 1P4EA 4JI7C 1PU1A 3NYQA 5ADZA 1XMQC 1IBMC 5T8TA 4LFCC 2PROA 2P2QA 4DCUA 2WP0C 1MDBA 2BJOA 1HNWC 4DR1C 2UXCC 4L4QA 2YWBA 2ASBA 4DR7C 1N34C 4DCVA 5A19A 5GTDA 1USPB 3ETOA 4X65C 4OYCA 4PUIA 4LF5C 4KTVA 2QW0X 1P4EC 5K85A 2Z51A 4ZJZA 3GPCA 2ZZMA 5A1IA 4JV5C 3TR3A 2E8EA 4DR5C 4FUTA 4PZPA 4JI2C 1XHJA 1LCIA 2M5OA 3OTOC 4DG8A 1WH9A 4LFBC 2M5HA 1PG4A 2D28C 3UZ0A 2PT7G 1XMOC 2E8FA 2VZEA 1M6XA
chains in the Genus database with same CATH topology
1QWIA 3CW9A 1L2FA 2YCBA 1IBLC 2HHHC 3PBKA 3GKUA 3NPDA 2CXCA 4D57A 2D27A 2Y4NA 1O93A 2Y4OA 1ZB9A 5BSRA 4BC7A 1KKGA 1FJGC 4DV0C 2KZFA 3DHVA 5BSUA 1N33C 3JAMD 4B3TC 4KHPC 4ZLPA 4EATA 1HNXC 3EQ6A 4GXRA 4DV2C 1T5HX 4R0MA 3E7XA 4GKKC 1MXBA 3J81D 1XRBA 2F4VC 3R44A 4ISBA 1O92A 2Y27A 3UOWA 1GPMA 2VSQA 3TUFA 2V7BA 4D56A 1MD9A 2VQEC 2JMPA 1MXCA 3LUSA 5IWAC 4LF6C 4FTFA 4JM1A 3SO4A 4MH4A 5BUSA 5JRHA 1EGAA 4X62C 1XRAA 3VNSA 1UKKA 2D1RA 5BSTA 4X66C 2ATWA 4DCSA 2UXBC 3NYRA 4BSZA 2VQFC 4RMNA 2UUCC 1MXAA 3A9VA 5A1GA 1WF3A 4LF9C 4IZ6A 4B3MC 4G37A 3TDEA 3EERA 1AMUA 4JI1C 1ULTA 3PROC 2ONFA 1XNQC 3VNQA 2E0GA 4NOZA 4OX9C 4BC9A 2P20A 4LF8C 4BBYA 4RLQA 4L7IA 5H9UA 4XX2A 1IBKC 3CW8X 1JOSA 1V25A 1K0RA 2PN2A 1N2FA 4GKJC 3IPLA 4I9GA 5CZXA 4DV6C 2E7GA 5A2QD 3R9XA 5KYVA 3TQIA 4NXNC 4DR3C 3FCEA 3KXWA 1PG3A 4GS5A 3RV2A 2UXDC 3DLPX 4PROC 1HH2P 4D4GA 2E8CA 4DR2C 5DV9A 5FLXD 5K8FA 2WD9A 3VNRA 2UUAC 1RY2A 4G36A 4U5YD 4G1IA 4JI3C 4JI6C 5LMUC 5BR8C 5BSMA 4ODJA 4NXMC 3FCCA 3I07A 1FUGA 2YWCA 3E7WA 2OBVA 3IMLA 4RVOA 3N2QA 3PESA 4IR7A 4JI0C 3T1HC 3GR0A 4YY3C 4X64C 3L95X 4RLFA 5IT9D 2EGTA 5E7QA 4DV5C 4JI5C 1V26A 1QM4A 4JI4C 3S82A 4AQYC 4BCAA 1N32C 2P02A 1VLAA 5AE3A 1YJ7A 5KYTA 3GR1A 4KTTA 4WS9A 3A9UA 4DR6C 2UU9C 5BSWA 2AYAA 4RM3A 2ZM6C 3A4IA 1NYEA 4PHTA 5KEIA 3H2TA 4R1LA 2HJGA 4LFAC 1HNZC 2DYJA 4RM2A 2P2JA 3LAXA 4HPVA 4DV1C 2BH1X 2D1QA 4RVNA 3I08A 1O90A 4I9FA 4DG9A 4OXIA 1I94C 4DUZC 2P2FA 2OPLA 1XRCA 3IEVA 3IEUA 2CY1A 3CJEA 3RG2A 5IFIA 4DUYC 5BSVA 1XNRC 4JYAC 4DV3C 5BURA 2D7VA 1BA3A 4B3RC 2D1TA 4LF4C 3LGXA 4R1MA 3J80D 4NDNA 1O9TA 4DV7C 4WV3A 2DPLA 3NI2A 1ZB8A 4DR4C 1ML8A 3R9WA 2QVZX 1LQLA 2QL8A 4DV4C 4FUQA 2OO4A 5CZVA 5BUQA 1USPA 3AF5A 3B7WA 5T8SA 4LF7C 2QVYX 2P2MA 3ETCA 3C5EA 3DAYA 1J5EC 1HR0C 4MTNA 5AE2A 1PA4A 4TPSB 2E5LC 4GXQA 3T1YC 2XR1A 4B3SC 4K0KC 1RG9A 4LE5A 1T5DX 3G7SA 3AF6A 2D1SA 1P7LA 2UUBC 1MDFA 3L8CA 5LMNC 3LNVA 4YHHC 4DCTA 4D4IA 4JI8C 5AE1A 2OPLB 2P2BA 1MKYA 3N54B 1N36C 4K0BA 4L2ZA 2QVXX 4JI7C 3NYQA 5ADZA 1XMQC 1IBMC 5T8TA 4LFCC 2PROA 2P2QA 4DCUA 2WP0C 1MDBA 2BJOA 1HNWC 4DR1C 2UXCC 4L4QA 2YWBA 2ASBA 4DR7C 1N34C 4DCVA 5A19A 5GTDA 1USPB 3ETOA 4X65C 4OYCA 4LF5C 4KTVA 2QW0X 5K85A 4ZJZA 3GPCA 5A1IA 4JV5C 2E8EA 4DR5C 4FUTA 4PZPA 4JI2C 1LCIA 3OTOC 4DG8A 1WH9A 4LFBC 1PG4A 2D28C 3UZ0A 2PT7G 1XMOC 2E8FA 2VZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 C;  1WF3 A;  1QWI A;  4JI6 C;  5LMU C;  5BR8 C;  4LF9 C;  4NXM C;  1J5E C;  4B3M C;  1HR0 C;  1L2F A;  2YCB A;  1IBL C;  4MTN A;  3I07 A;  2HHH C;  3EER A;  3GKU A;  1PA4 A;  4JI1 C;  2E5L C;  2ONF A;  3T1Y C;  4JI0 C;  1XNQ C;  2XR1 A;  3T1H C;  4YY3 C;  2CXC A;  4B3S C;  4X64 C;  4K0K C;  5IT9 D;  2EGT A;  4DV5 C;  4JI5 C;  4NOZ A;  4OX9 C;  4JI4 C;  4AQY C;  1N32 C;  1ZB9 A;  1VLA A;  3AF6 A;  4LF8 C;  1KKG A;  1FJG C;  4DV0 C;  2KZF A;  2UUB C;  5LMN C;  1N33 C;  4YHH C;  3JAM D;  4B3T C;  4KHP C;  4DCT A;  4DR6 C;  2UU9 C;  4JI8 C;  4XX2 A;  2ZM6 C;  1IBK C;  1HNX C;  2OPL B;  1NYE A;  1MKY A;  1N36 C;  1JOS A;  2HJG A;  4DV2 C;  4LFA C;  1HNZ C;  1K0R A;  2DYJ A;  2PN2 A;  1N2F A;  4GKJ C;  4JI7 C;  4GKK C;  4DV6 C;  1XMQ C;  1IBM C;  4DV1 C;  4LFC C;  3J81 D;  2E7G A;  4DCU A;  5A2Q D;  2F4V C;  2BJO A;  1HNW C;  3R9X A;  4DR1 C;  2UXC C;  4NXN C;  4DR3 C;  1I94 C;  2ASB A;  4DR7 C;  1N34 C;  4DUZ C;  4DCV A;  1USP B;  2OPL A;  2VQE C;  2JMP A;  3IEV A;  3LUS A;  4X65 C;  5IWA C;  2UXD C;  3IEU A;  2CY1 A;  3CJE A;  4LF6 C;  4LF5 C;  4DUY C;  4MH4 A;  1XNR C;  1HH2 P;  4JYA C;  4DV3 C;  1EGA A;  2E8C A;  4X62 C;  4DR2 C;  2D7V A;  5FLX D;  4JV5 C;  4B3R C;  4LF4 C;  1UKK A;  4X66 C;  2E8E A;  2ATW A;  3J80 D;  4DCS A;  4DR5 C;  4JI2 C;  4DV7 C;  2UXB C;  3OTO C;  4BSZ A;  1ZB8 A;  1WH9 A;  4LFB C;  4DR4 C;  1ML8 A;  2UUA C;  2VQF C;  2UUC C;  3R9W A;  2PT7 G;  1LQL A;  2QL8 A;  4DV4 C;  1USP A;  3AF5 A;  2E8F A;  1XMO C;  4LF7 C; 
#chains in the Genus database with same CATH topology
 1QWI A;  3CW9 A;  3O2E A;  1L2F A;  2YCB A;  1IBL C;  2DHM A;  3A26 A;  2HHH C;  3PBK A;  3GKU A;  3NPD A;  2CXC A;  2MMA B;  4D57 A;  2D27 A;  2Y4N A;  1O93 A;  2Y4O A;  1ZB9 A;  5BSR A;  4BC7 A;  1KKG A;  1FJG C;  3UX3 A;  4DV0 C;  2KZF A;  3DHV A;  5BSU A;  1N33 C;  3JAM D;  4B3T C;  4KHP C;  4ZLP A;  4EAT A;  1HNX C;  3EQ6 A;  4GXR A;  4DV2 C;  1T5H X;  4R0M A;  3E7X A;  4GKK C;  1MXB A;  3J81 D;  1XRB A;  2F4V C;  3UEB A;  3R44 A;  4ISB A;  1O92 A;  3CQ2 A;  2Y27 A;  3UOW A;  1GPM A;  1WCJ A;  2VSQ A;  3TUF A;  2V7B A;  4D56 A;  1MD9 A;  2VQE C;  2JMP A;  1MXC A;  3LUS A;  5IWA C;  4LF6 C;  4FTF A;  4JM1 A;  3SO4 A;  4MH4 A;  5BUS A;  5JRH A;  1EGA A;  4X62 C;  1XRA A;  3VNS A;  1UKK A;  2D1R A;  5BST A;  4X66 C;  2ATW A;  4DCS A;  2YX1 A;  2UXB C;  3NYR A;  4BSZ A;  2VQF C;  4RMN A;  2UUC C;  1MXA A;  3A9V A;  5A1G A;  1WF3 A;  4LF9 C;  4IZ6 A;  4B3M C;  2ZZN A;  4G37 A;  3TDE A;  3AY0 A;  3EER A;  1AMU A;  4JI1 C;  1ULT A;  3PRO C;  2ONF A;  1XNQ C;  3VNQ A;  2E0G A;  4NOZ A;  4OX9 C;  4BC9 A;  2P20 A;  4LF8 C;  4BBY A;  1TH5 A;  4RLQ A;  4L7I A;  5H9U A;  4XX2 A;  1IBK C;  3CW8 X;  2NCL A;  1JOS A;  1V25 A;  1K0R A;  2PN2 A;  1N2F A;  4GKJ C;  3IPL A;  4I9G A;  5CZX A;  4DV6 C;  2E7G A;  4PUH A;  5A2Q D;  3R9X A;  5KYV A;  3TQI A;  4NXN C;  4DR3 C;  3FCE A;  3KXW A;  1PG3 A;  4GS5 A;  3RV2 A;  2UXD C;  1NY8 A;  3DLP X;  4PRO C;  1HH2 P;  1XS3 A;  4D4G A;  2E8C A;  4DR2 C;  5DV9 A;  5FLX D;  5K8F A;  2WD9 A;  3A25 A;  3VNR A;  3UX2 A;  2UUA C;  1RY2 A;  4G36 A;  4U5Y D;  4G1I A;  4JI3 C;  4JI6 C;  5LMU C;  5BR8 C;  5BSM A;  4ODJ A;  4NXM C;  3FCC A;  1UWD A;  3I07 A;  1FUG A;  2YWC A;  3E7W A;  1IB8 A;  2OBV A;  3IML A;  4RVO A;  3N2Q A;  3PES A;  3CQ3 A;  5LCI A;  4IR7 A;  4JI0 C;  3T1H C;  3GR0 A;  4YY3 C;  4X64 C;  3L95 X;  2MM9 A;  4RLF A;  5IT9 D;  2EGT A;  5E7Q A;  4DV5 C;  4JI5 C;  1V26 A;  1QM4 A;  4JI4 C;  3S82 A;  4AQY C;  4BCA A;  1N32 C;  2P02 A;  1VLA A;  5AE3 A;  1YJ7 A;  5KYT A;  3GR1 A;  4KTT A;  4WS9 A;  3A9U A;  3CQ1 A;  4DR6 C;  2UU9 C;  5BSW A;  2AYA A;  4RM3 A;  2ZM6 C;  3A4I A;  1NYE A;  4PHT A;  5KEI A;  3H2T A;  4R1L A;  2HJG A;  4LFA C;  1V60 A;  1HNZ C;  2DYJ A;  4RM2 A;  2P2J A;  3LAX A;  4HPV A;  4DV1 C;  2BH1 X;  4PUG A;  2D1Q A;  4RVN A;  3I08 A;  1O90 A;  4I9F A;  4DG9 A;  4OXI A;  1I94 C;  1FLO A;  4DUZ C;  2P2F A;  2OPL A;  1XRC A;  2CU6 A;  3IEV A;  3IEU A;  2CY1 A;  3CJE A;  3RG2 A;  5IFI A;  4DUY C;  5BSV A;  1XNR C;  4JYA C;  4DV3 C;  5BUR A;  2D7V A;  1BA3 A;  4B3R C;  2D1T A;  4LF4 C;  3LGX A;  4R1M A;  2MCQ A;  3J80 D;  4NDN A;  1O9T A;  4DV7 C;  4WV3 A;  2DPL A;  3NI2 A;  1ZB8 A;  4DR4 C;  1ML8 A;  3R9W A;  2QVZ X;  1LQL A;  2QL8 A;  4FUQ A;  5CZV A;  2OO4 A;  4DV4 C;  5BUQ A;  1USP A;  3AF5 A;  3B7W A;  5T8S A;  4LF7 C;  2QVY X;  2P2M A;  3ETC A;  3C5E A;  3DAY A;  1J5E C;  1HR0 C;  4MTN A;  1M6X C;  5AE2 A;  1PA4 A;  4TPS B;  2E5L C;  4GXQ A;  3T1Y C;  2XR1 A;  4B3S C;  4K0K C;  1RG9 A;  4LE5 A;  1T5D X;  3G7S A;  3AF6 A;  2D1S A;  1P7L A;  1VEH A;  1MDF A;  2UUB C;  3L8C A;  5LMN C;  3LNO A;  3LNV A;  4YHH C;  4DCT A;  4D4I A;  4JI8 C;  3K6R A;  5AE1 A;  2OPL B;  2P2B A;  1MKY A;  3N54 B;  1N36 C;  4K0B A;  2JNV A;  4L2Z A;  2QVX X;  2KZ0 A;  2KDN A;  1P4E A;  4JI7 C;  1PU1 A;  3NYQ A;  5ADZ A;  1XMQ C;  1IBM C;  5T8T A;  4LFC C;  2PRO A;  2P2Q A;  4DCU A;  2WP0 C;  1MDB A;  2BJO A;  1HNW C;  4DR1 C;  2UXC C;  4L4Q A;  2YWB A;  2ASB A;  4DR7 C;  1N34 C;  4DCV A;  5A19 A;  5GTD A;  1USP B;  3ETO A;  4X65 C;  4OYC A;  4PUI A;  4LF5 C;  4KTV A;  2QW0 X;  1P4E C;  5K85 A;  2Z51 A;  4ZJZ A;  3GPC A;  2ZZM A;  5A1I A;  4JV5 C;  3TR3 A;  2E8E A;  4DR5 C;  4FUT A;  4PZP A;  4JI2 C;  1XHJ A;  1LCI A;  2M5O A;  3OTO C;  4DG8 A;  1WH9 A;  4LFB C;  2M5H A;  1PG4 A;  2D28 C;  3UZ0 A;  2PT7 G;  1XMO C;  2E8F A;  2VZE A;  1M6X A; 
#chains in the Genus database with same CATH homology
 1QWI A;  3CW9 A;  1L2F A;  2YCB A;  1IBL C;  2HHH C;  3PBK A;  3GKU A;  3NPD A;  2CXC A;  4D57 A;  2D27 A;  2Y4N A;  1O93 A;  2Y4O A;  1ZB9 A;  5BSR A;  4BC7 A;  1KKG A;  1FJG C;  4DV0 C;  2KZF A;  3DHV A;  5BSU A;  1N33 C;  3JAM D;  4B3T C;  4KHP C;  4ZLP A;  4EAT A;  1HNX C;  3EQ6 A;  4GXR A;  4DV2 C;  1T5H X;  4R0M A;  3E7X A;  4GKK C;  1MXB A;  3J81 D;  1XRB A;  2F4V C;  3R44 A;  4ISB A;  1O92 A;  2Y27 A;  3UOW A;  1GPM A;  2VSQ A;  3TUF A;  2V7B A;  4D56 A;  1MD9 A;  2VQE C;  2JMP A;  1MXC A;  3LUS A;  5IWA C;  4LF6 C;  4FTF A;  4JM1 A;  3SO4 A;  4MH4 A;  5BUS A;  5JRH A;  1EGA A;  4X62 C;  1XRA A;  3VNS A;  1UKK A;  2D1R A;  5BST A;  4X66 C;  2ATW A;  4DCS A;  2UXB C;  3NYR A;  4BSZ A;  2VQF C;  4RMN A;  2UUC C;  1MXA A;  3A9V A;  5A1G A;  1WF3 A;  4LF9 C;  4IZ6 A;  4B3M C;  4G37 A;  3TDE A;  3EER A;  1AMU A;  4JI1 C;  1ULT A;  3PRO C;  2ONF A;  1XNQ C;  3VNQ A;  2E0G A;  4NOZ A;  4OX9 C;  4BC9 A;  2P20 A;  4LF8 C;  4BBY A;  4RLQ A;  4L7I A;  5H9U A;  4XX2 A;  1IBK C;  3CW8 X;  1JOS A;  1V25 A;  1K0R A;  2PN2 A;  1N2F A;  4GKJ C;  3IPL A;  4I9G A;  5CZX A;  4DV6 C;  2E7G A;  5A2Q D;  3R9X A;  5KYV A;  3TQI A;  4NXN C;  4DR3 C;  3FCE A;  3KXW A;  1PG3 A;  4GS5 A;  3RV2 A;  2UXD C;  3DLP X;  4PRO C;  1HH2 P;  4D4G A;  2E8C A;  4DR2 C;  5DV9 A;  5FLX D;  5K8F A;  2WD9 A;  3VNR A;  2UUA C;  1RY2 A;  4G36 A;  4U5Y D;  4G1I A;  4JI3 C;  4JI6 C;  5LMU C;  5BR8 C;  5BSM A;  4ODJ A;  4NXM C;  3FCC A;  3I07 A;  1FUG A;  2YWC A;  3E7W A;  2OBV A;  3IML A;  4RVO A;  3N2Q A;  3PES A;  4IR7 A;  4JI0 C;  3T1H C;  3GR0 A;  4YY3 C;  4X64 C;  3L95 X;  4RLF A;  5IT9 D;  2EGT A;  5E7Q A;  4DV5 C;  4JI5 C;  1V26 A;  1QM4 A;  4JI4 C;  3S82 A;  4AQY C;  4BCA A;  1N32 C;  2P02 A;  1VLA A;  5AE3 A;  1YJ7 A;  5KYT A;  3GR1 A;  4KTT A;  4WS9 A;  3A9U A;  4DR6 C;  2UU9 C;  5BSW A;  2AYA A;  4RM3 A;  2ZM6 C;  3A4I A;  1NYE A;  4PHT A;  5KEI A;  3H2T A;  4R1L A;  2HJG A;  4LFA C;  1HNZ C;  2DYJ A;  4RM2 A;  2P2J A;  3LAX A;  4HPV A;  4DV1 C;  2BH1 X;  2D1Q A;  4RVN A;  3I08 A;  1O90 A;  4I9F A;  4DG9 A;  4OXI A;  1I94 C;  4DUZ C;  2P2F A;  2OPL A;  1XRC A;  3IEV A;  3IEU A;  2CY1 A;  3CJE A;  3RG2 A;  5IFI A;  4DUY C;  5BSV A;  1XNR C;  4JYA C;  4DV3 C;  5BUR A;  2D7V A;  1BA3 A;  4B3R C;  2D1T A;  4LF4 C;  3LGX A;  4R1M A;  3J80 D;  4NDN A;  1O9T A;  4DV7 C;  4WV3 A;  2DPL A;  3NI2 A;  1ZB8 A;  4DR4 C;  1ML8 A;  3R9W A;  2QVZ X;  1LQL A;  2QL8 A;  4DV4 C;  4FUQ A;  2OO4 A;  5CZV A;  5BUQ A;  1USP A;  3AF5 A;  3B7W A;  5T8S A;  4LF7 C;  2QVY X;  2P2M A;  3ETC A;  3C5E A;  3DAY A;  1J5E C;  1HR0 C;  4MTN A;  5AE2 A;  1PA4 A;  4TPS B;  2E5L C;  4GXQ A;  3T1Y C;  2XR1 A;  4B3S C;  4K0K C;  1RG9 A;  4LE5 A;  1T5D X;  3G7S A;  3AF6 A;  2D1S A;  1P7L A;  2UUB C;  1MDF A;  3L8C A;  5LMN C;  3LNV A;  4YHH C;  4DCT A;  4D4I A;  4JI8 C;  5AE1 A;  2OPL B;  2P2B A;  1MKY A;  3N54 B;  1N36 C;  4K0B A;  4L2Z A;  2QVX X;  4JI7 C;  3NYQ A;  5ADZ A;  1XMQ C;  1IBM C;  5T8T A;  4LFC C;  2PRO A;  2P2Q A;  4DCU A;  2WP0 C;  1MDB A;  2BJO A;  1HNW C;  4DR1 C;  2UXC C;  4L4Q A;  2YWB A;  2ASB A;  4DR7 C;  1N34 C;  4DCV A;  5A19 A;  5GTD A;  1USP B;  3ETO A;  4X65 C;  4OYC A;  4LF5 C;  4KTV A;  2QW0 X;  5K85 A;  4ZJZ A;  3GPC A;  5A1I A;  4JV5 C;  2E8E A;  4DR5 C;  4FUT A;  4PZP A;  4JI2 C;  1LCI A;  3OTO C;  4DG8 A;  1WH9 A;  4LFB C;  1PG4 A;  2D28 C;  3UZ0 A;  2PT7 G;  1XMO C;  2E8F A;  2VZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...