2OPLA

Crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
181
structure length
180
Chain Sequence
TTVVNGVNVDQLMATIEQIKAKPEIAQFKFRATNQWMGGTHNQATIKDFYGAAEDDTRKPMVFDLDEPPVLLGENRGANPVEYLLVALSGCLTTSLVAHAAARGIALRGVKSRYEGDIDLRGFLGLSEEVPVGYREIRVFFSIDADLTDGQKEELIRMAQKYSPVYNTVAKPVPVAVLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (NP_953832.1) from Geobacter sulfurreducens at 1.50 A resolution
rcsb
source organism Geobacter sulfurreducens
molecule tags Unknown function
molecule keywords Hypothetical protein
total genus 44
structure length 180
sequence length 181
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2oplA01
2UXCC 2UU9C 2E8EA 4LF9C 5BR8C 2OPLA 3GKUA 1XNQC 5IWAC 4DR1C 1HH2P 2ZM6C 5LMNC 1NYEA 2D7VA 4JV5C 4DCTA 4MTNA 2UUBC 4DUYC 2UXDC 2UXBC 4JI3C 4JI7C 2HHHC 1J5EC 4LFCC 1HNXC 1IBLC 4DR5C 2OPLB 1HNZC 3JAMD 4DCSA 4DV5C 4JI4C 2JMPA 2BJOA 2E7GA 1N32C 2VQEC 2CXCA 1HNWC 1ZB9A 4DV7C 3AF5A 4OX9C 4LF4C 4JI2C 4B3RC 2E8CA 1I94C 1N2FA 2ATWA 4JYAC 1WF3A 3IEVA 4LF7C 4DV2C 2VQFC 3T1HC 4DR4C 3EERA 4X66C 5A2QD 4DR6C 2HJGA 1K0RA 4XX2A 5LMUC 4DCVA 4MH4A 4YY3C 1ML8A 3OTOC 3I07A 4LFBC 4AQYC 1ZB8A 3R9WA 4DUZC 2XR1A 1HR0C 3CJEA 4X64C 4NXNC 4DR7C 5FLXD 4YHHC 4JI0C 1XMOC 2EGTA 4GKJC 1QWIA 4LF8C 4DV0C 4B3TC 4DV4C 4DR2C 3AF6A 4B3MC 4JI5C 2E5LC 4X65C 1IBMC 4KHPC 3J81D 1N33C 1UKKA 4LF6C 3T1YC 2CY1A 1XNRC 4JI8C 1LQLA 2PN2A 4LFAC 1WH9A 1USPA 4DR3C 1VLAA 1N34C 3IEUA 2E8FA 1JOSA 4BSZA 4DV3C 4JI1C 4X62C 3J80D 2ASBA 5IT9D 1MKYA 4B3SC 2ONFA 1L2FA 4DV1C 1EGAA 2F4VC 1XMQC 2PT7G 2UUAC 3R9XA 2KZFA 4NXMC 4NOZA 3LUSA 2DYJA 1N36C 4JI6C 2YCBA 4DV6C 1PA4A 1USPB 4LF5C 2UUCC 4GKKC 1FJGC 1KKGA 4DCUA 2QL8A 1IBKC 4K0KC
chains in the Genus database with same CATH superfamily
2E8EA 1O9TA 3CQ2A 5BR8C 3CW9A 4G36A 3CQ3A 2ZM6C 4MTNA 5AE2A 2AYAA 2UXBC 4JI3C 1MDBA 1IBLC 1HNZC 4DV5C 3TR3A 2YWCA 2E7GA 2QVXX 3GR0A 2ATWA 4JYAC 3IEVA 3SO4A 2VQFC 4DR4C 1M6XA 5LMUC 4XX2A 1ML8A 3VNQA 5CZVA 2BH1X 3NYRA 4DUZC 2XR1A 1ULTA 3CJEA 4X64C 4NXNC 4DR7C 4BC7A 2PROA 4JI0C 5KEIA 5A19A 4FUQA 1PG3A 3O2EA 4I9GA 4D56A 4KHPC 3J81D 5A1GA 5A1IA 4ISBA 1T5HX 4DG9A 2CY1A 4JI8C 1N34C 2D1RA 4RVOA 2KZ0A 2JNVA 3J80D 2ASBA 1NY8A 1L2FA 4R1MA 1EGAA 2KZFA 2CU6A 2E0GA 2Y4OA 3DAYA 3LUSA 4NOZA 5BSMA 1N36C 2P2BA 4JI6C 2YCBA 4DV6C 2Y4NA 5IFIA 2OBVA 4GKKC 3RV2A 2QL8A 2WP0C 5K85A 1WCJA 3N54B 2MCQA 3UEBA 1M6XC 4GS5A 4DCTA 2UUBC 2NCLA 4G37A 4JI7C 4BBYA 2HHHC 1J5EC 4LFCC 5E7QA 2JMPA 2BJOA 2P20A 1VEHA 1N32C 3E7WA 1GPMA 1ZB9A 4LE5A 4DV7C 4OX9C 1FUGA 2D1TA 1WF3A 2V7BA 3LNOA 3T1HC 3EERA 4TPSB 4DR6C 3UOWA 3VNRA 1K0RA 1RY2A 4YY3C 4BC9A 5T8SA 4L2ZA 5BSTA 1ZB8A 3R9WA 3GPCA 1P4EA 2DPLA 4PHTA 4YHHC 2EGTA 3ETCA 1V25A 4IR7A 4LF8C 4DR2C 2DHMA 3A25A 3GR1A 4FTFA 4R0MA 2MMAB 4RLQA 3PESA 5BSUA 5AE1A 2M5HA 3TUFA 4LF6C 1XNRC 1LQLA 4LFAC 4DR3C 3DHVA 1YJ7A 4WS9A 5JRHA 3NPDA 1JOSA 4BSZA 4DV3C 4X62C 3ETOA 1MDFA 4RM3A 2YX1A 4B3SC 4KTTA 1UWDA 2P2QA 2PT7G 2UUAC 4NXMC 5K8FA 5BSVA 3AY0A 4D4GA 1XHJA 1PA4A 1O93A 4PUIA 3TQIA 4K0BA 4DCUA 1XMQC 4L7IA 2YWBA 5BSWA 4DG8A 4LF9C 1MD9A 1XNQC 5IWAC 1HH2P 1XRCA 5LMNC 2P02A 2D7VA 4WV3A 1P7LA 2D1SA 3IPLA 3L95X 1HNXC 2OPLB 4DCSA 4G1IA 4JI4C 4OYCA 2CXCA 1HNWC 1MXAA 3B7WA 1BA3A 2QW0X 4LF4C 4JI2C 5T8TA 2E8CA 5GTDA 1I94C 1N2FA 4NDNA 4DV2C 4X66C 5A2QD 2HJGA 4PUGA 3E7XA 3FCEA 3VNSA 1O92A 3NI2A 3OTOC 3I07A 4L4QA 3R44A 2Z51A 4AQYC 1O90A 4BCAA 1HR0C 3TDEA 4GXRA 4RMNA 2VZEA 5LCIA 2ZZNA 4B3TC 4DV4C 5KYVA 3LNVA 3AF6A 4B3MC 1PG4A 4X65C 1IBMC 4JM1A 1N33C 4ZLPA 1UKKA 2D27A 3EQ6A 1XS3A 4GXQA 4D57A 1V60A 1T5DX 3S82A 1USPA 4U5YD 3G7SA 2E8FA 3I08A 2QVZX 4FUTA 3N2QA 4ZJZA 4JI1C 5H9UA 2Y27A 4RVNA 5IT9D 2ONFA 4DV1C 4KTVA 2MM9A 3FCCA 2P2JA 4PZPA 5DV9A 4LF5C 1RG9A 4IZ6A 2UUCC 1KKGA 3A4IA 2P2FA 4K0KC 2UXCC 2UU9C 2D1QA 4R1LA 2OPLA 3GKUA 5ADZA 4DR1C 1TH5A 3K6RA 1P4EC 4D4IA 1NYEA 4JV5C 3PBKA 4DUYC 2UXDC 2WD9A 1FLOA 2VSQA 4DR5C 3JAMD 2ZZMA 2M5OA 2VQEC 3AF5A 1AMUA 5BUQA 4B3RC 4EATA 3LAXA 3A9UA 4LF7C 2P2MA 4HPVA 1MXCA 3A26A 4DCVA 4MH4A 1MXBA 4LFBC 1XRBA 3NYQA 3UX3A 3A9VA 5FLXD 1XMOC 5AE3A 4GKJC 1QWIA 3UZ0A 4DV0C 5BSRA 3LGXA 1IB8A 5KYTA 4JI5C 2E5LC 2KDNA 1LCIA 1PU1A 3DLPX 4PUHA 3CW8X 3T1YC 2D28C 2PN2A 1WH9A 3UX2A 1VLAA 4RLFA 3IEUA 5BUSA 3C5EA 3PROC 3CQ1A 4PROC 2OO4A 1MKYA 4ODJA 3IMLA 2F4VC 3R9XA 4OXIA 4RM2A 5CZXA 1QM4A 1V26A 2QVYX 3L8CA 4I9FA 2DYJA 3H2TA 3RG2A 1XRAA 1USPB 3KXWA 1FJGC 5BURA 1IBKC
chains in the Genus database with same CATH topology
2E8EA 1O9TA 5BR8C 3CW9A 4G36A 2ZM6C 4MTNA 5AE2A 2AYAA 2UXBC 4JI3C 1MDBA 1IBLC 1HNZC 4DV5C 2YWCA 2E7GA 2QVXX 3GR0A 2ATWA 4JYAC 3IEVA 3SO4A 2VQFC 4DR4C 5LMUC 4XX2A 1ML8A 3VNQA 5CZVA 2BH1X 3NYRA 4DUZC 2XR1A 1ULTA 3CJEA 4X64C 4NXNC 4DR7C 4BC7A 2PROA 4JI0C 5KEIA 5A19A 4FUQA 1PG3A 4I9GA 4D56A 4KHPC 3J81D 5A1GA 5A1IA 4ISBA 1T5HX 4DG9A 2CY1A 4JI8C 1N34C 2D1RA 4RVOA 3J80D 2ASBA 1L2FA 4R1MA 1EGAA 2KZFA 2E0GA 2Y4OA 3DAYA 3LUSA 4NOZA 5BSMA 1N36C 2P2BA 4JI6C 2YCBA 2Y4NA 4DV6C 5IFIA 2OBVA 4GKKC 3RV2A 2QL8A 2WP0C 5K85A 3N54B 4GS5A 4DCTA 2UUBC 4G37A 4JI7C 4BBYA 2HHHC 1J5EC 4LFCC 5E7QA 2JMPA 2BJOA 2P20A 1N32C 3E7WA 1GPMA 1ZB9A 4LE5A 4DV7C 4OX9C 1FUGA 2D1TA 1WF3A 2V7BA 3T1HC 3EERA 4TPSB 4DR6C 3UOWA 3VNRA 1K0RA 1RY2A 4YY3C 4BC9A 5T8SA 4L2ZA 5BSTA 1ZB8A 3R9WA 3GPCA 2DPLA 4PHTA 4YHHC 2EGTA 3ETCA 1V25A 4IR7A 4LF8C 4DR2C 4FTFA 3GR1A 4R0MA 4RLQA 3PESA 5BSUA 5AE1A 3TUFA 4LF6C 1XNRC 1LQLA 4LFAC 4DR3C 3DHVA 1YJ7A 4WS9A 5JRHA 3NPDA 1JOSA 4BSZA 4DV3C 4X62C 3ETOA 1MDFA 4RM3A 4B3SC 4KTTA 2P2QA 2PT7G 2UUAC 4NXMC 5K8FA 4D4GA 5BSVA 1PA4A 1O93A 3TQIA 4K0BA 1XMQC 4DCUA 4L7IA 2YWBA 5BSWA 4DG8A 4LF9C 1MD9A 1XNQC 5IWAC 1HH2P 1XRCA 5LMNC 2P02A 2D7VA 4WV3A 1P7LA 2D1SA 3IPLA 3L95X 1HNXC 2OPLB 4DCSA 4G1IA 4JI4C 4OYCA 2CXCA 1HNWC 1MXAA 3B7WA 1BA3A 2QW0X 4LF4C 4JI2C 5T8TA 2E8CA 5GTDA 1I94C 1N2FA 4NDNA 4DV2C 4X66C 5A2QD 2HJGA 3E7XA 3FCEA 3VNSA 1O92A 3NI2A 3OTOC 3I07A 4L4QA 3R44A 4AQYC 1O90A 4BCAA 1HR0C 3TDEA 4GXRA 4RMNA 2VZEA 4B3TC 4DV4C 3LNVA 5KYVA 4B3MC 3AF6A 1PG4A 4X65C 1IBMC 4JM1A 1N33C 4ZLPA 1UKKA 2D27A 3EQ6A 4GXQA 4D57A 1T5DX 3S82A 1USPA 4U5YD 3G7SA 2E8FA 3I08A 2QVZX 4FUTA 3N2QA 4ZJZA 4JI1C 5H9UA 2Y27A 4RVNA 5IT9D 2ONFA 4DV1C 4KTVA 3FCCA 2P2JA 4PZPA 5DV9A 4LF5C 1RG9A 4IZ6A 2UUCC 1KKGA 3A4IA 2P2FA 4K0KC 2UXCC 2UU9C 2D1QA 4R1LA 2OPLA 3GKUA 5ADZA 4DR1C 4D4IA 1NYEA 4JV5C 3PBKA 4DUYC 2UXDC 2WD9A 2VSQA 4DR5C 3JAMD 2VQEC 3AF5A 1AMUA 5BUQA 4B3RC 4EATA 3LAXA 3A9UA 4LF7C 2P2MA 4HPVA 1MXCA 4DCVA 4MH4A 1MXBA 4LFBC 1XRBA 3NYQA 3A9VA 5FLXD 1XMOC 5AE3A 4GKJC 1QWIA 3UZ0A 4DV0C 5BSRA 3LGXA 5KYTA 4JI5C 2E5LC 3DLPX 1LCIA 3CW8X 3T1YC 2D28C 2PN2A 1WH9A 1VLAA 4RLFA 3IEUA 5BUSA 3C5EA 3PROC 4PROC 2OO4A 1MKYA 4ODJA 3IMLA 2F4VC 3R9XA 4OXIA 4RM2A 5CZXA 1QM4A 1V26A 2QVYX 3L8CA 4I9FA 2DYJA 3H2TA 3RG2A 1XRAA 1USPB 3KXWA 1FJGC 5BURA 1IBKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC C;  2UU9 C;  2E8E A;  4LF9 C;  5BR8 C;  2OPL A;  3GKU A;  1XNQ C;  5IWA C;  4DR1 C;  1HH2 P;  2ZM6 C;  5LMN C;  1NYE A;  2D7V A;  4JV5 C;  4DCT A;  4MTN A;  2UUB C;  4DUY C;  2UXD C;  2UXB C;  4JI3 C;  4JI7 C;  2HHH C;  1J5E C;  4LFC C;  1HNX C;  1IBL C;  4DR5 C;  2OPL B;  1HNZ C;  3JAM D;  4DCS A;  4DV5 C;  4JI4 C;  2JMP A;  2BJO A;  2E7G A;  1N32 C;  2VQE C;  2CXC A;  1HNW C;  1ZB9 A;  4DV7 C;  3AF5 A;  4OX9 C;  4LF4 C;  4JI2 C;  4B3R C;  2E8C A;  1I94 C;  1N2F A;  2ATW A;  4JYA C;  1WF3 A;  3IEV A;  4LF7 C;  4DV2 C;  2VQF C;  3T1H C;  4DR4 C;  3EER A;  4X66 C;  5A2Q D;  4DR6 C;  2HJG A;  1K0R A;  4XX2 A;  5LMU C;  4DCV A;  4MH4 A;  4YY3 C;  1ML8 A;  3OTO C;  3I07 A;  4LFB C;  4AQY C;  1ZB8 A;  3R9W A;  4DUZ C;  2XR1 A;  1HR0 C;  3CJE A;  4X64 C;  4NXN C;  4DR7 C;  5FLX D;  4YHH C;  4JI0 C;  1XMO C;  2EGT A;  4GKJ C;  1QWI A;  4LF8 C;  4DV0 C;  4B3T C;  4DV4 C;  4DR2 C;  3AF6 A;  4B3M C;  4JI5 C;  2E5L C;  4X65 C;  1IBM C;  4KHP C;  3J81 D;  1N33 C;  1UKK A;  4LF6 C;  3T1Y C;  2CY1 A;  1XNR C;  4JI8 C;  1LQL A;  2PN2 A;  4LFA C;  1WH9 A;  1USP A;  4DR3 C;  1VLA A;  1N34 C;  3IEU A;  2E8F A;  1JOS A;  4BSZ A;  4DV3 C;  4JI1 C;  4X62 C;  3J80 D;  2ASB A;  5IT9 D;  1MKY A;  4B3S C;  2ONF A;  1L2F A;  4DV1 C;  1EGA A;  2F4V C;  1XMQ C;  2PT7 G;  2UUA C;  3R9X A;  2KZF A;  4NXM C;  4NOZ A;  3LUS A;  2DYJ A;  1N36 C;  4JI6 C;  2YCB A;  4DV6 C;  1PA4 A;  1USP B;  4LF5 C;  2UUC C;  4GKK C;  1FJG C;  1KKG A;  4DCU A;  2QL8 A;  1IBK C;  4K0K C; 
#chains in the Genus database with same CATH topology
 2E8E A;  1O9T A;  3CQ2 A;  5BR8 C;  3CW9 A;  4G36 A;  3CQ3 A;  2ZM6 C;  4MTN A;  5AE2 A;  2AYA A;  2UXB C;  4JI3 C;  1MDB A;  1IBL C;  1HNZ C;  4DV5 C;  3TR3 A;  2YWC A;  2E7G A;  2QVX X;  3GR0 A;  2ATW A;  4JYA C;  3IEV A;  3SO4 A;  2VQF C;  4DR4 C;  1M6X A;  5LMU C;  4XX2 A;  1ML8 A;  3VNQ A;  5CZV A;  2BH1 X;  3NYR A;  4DUZ C;  2XR1 A;  1ULT A;  3CJE A;  4X64 C;  4NXN C;  4DR7 C;  4BC7 A;  2PRO A;  4JI0 C;  5KEI A;  5A19 A;  4FUQ A;  1PG3 A;  3O2E A;  4I9G A;  4D56 A;  4KHP C;  3J81 D;  5A1G A;  5A1I A;  4ISB A;  1T5H X;  4DG9 A;  2CY1 A;  4JI8 C;  1N34 C;  2D1R A;  4RVO A;  2KZ0 A;  2JNV A;  3J80 D;  2ASB A;  1NY8 A;  1L2F A;  4R1M A;  1EGA A;  2KZF A;  2CU6 A;  2E0G A;  2Y4O A;  3DAY A;  3LUS A;  4NOZ A;  5BSM A;  1N36 C;  2P2B A;  4JI6 C;  2YCB A;  4DV6 C;  2Y4N A;  5IFI A;  2OBV A;  4GKK C;  3RV2 A;  2QL8 A;  2WP0 C;  5K85 A;  1WCJ A;  3N54 B;  2MCQ A;  3UEB A;  1M6X C;  4GS5 A;  4DCT A;  2UUB C;  2NCL A;  4G37 A;  4JI7 C;  4BBY A;  2HHH C;  1J5E C;  4LFC C;  5E7Q A;  2JMP A;  2BJO A;  2P20 A;  1VEH A;  1N32 C;  3E7W A;  1GPM A;  1ZB9 A;  4LE5 A;  4DV7 C;  4OX9 C;  1FUG A;  2D1T A;  1WF3 A;  2V7B A;  3LNO A;  3T1H C;  3EER A;  4TPS B;  4DR6 C;  3UOW A;  3VNR A;  1K0R A;  1RY2 A;  4YY3 C;  4BC9 A;  5T8S A;  4L2Z A;  5BST A;  1ZB8 A;  3R9W A;  3GPC A;  1P4E A;  2DPL A;  4PHT A;  4YHH C;  2EGT A;  3ETC A;  1V25 A;  4IR7 A;  4LF8 C;  4DR2 C;  2DHM A;  3A25 A;  3GR1 A;  4FTF A;  4R0M A;  2MMA B;  4RLQ A;  3PES A;  5BSU A;  5AE1 A;  2M5H A;  3TUF A;  4LF6 C;  1XNR C;  1LQL A;  4LFA C;  4DR3 C;  3DHV A;  1YJ7 A;  4WS9 A;  5JRH A;  3NPD A;  1JOS A;  4BSZ A;  4DV3 C;  4X62 C;  3ETO A;  1MDF A;  4RM3 A;  2YX1 A;  4B3S C;  4KTT A;  1UWD A;  2P2Q A;  2PT7 G;  2UUA C;  4NXM C;  5K8F A;  5BSV A;  3AY0 A;  4D4G A;  1XHJ A;  1PA4 A;  1O93 A;  4PUI A;  3TQI A;  4K0B A;  4DCU A;  1XMQ C;  4L7I A;  2YWB A;  5BSW A;  4DG8 A;  4LF9 C;  1MD9 A;  1XNQ C;  5IWA C;  1HH2 P;  1XRC A;  5LMN C;  2P02 A;  2D7V A;  4WV3 A;  1P7L A;  2D1S A;  3IPL A;  3L95 X;  1HNX C;  2OPL B;  4DCS A;  4G1I A;  4JI4 C;  4OYC A;  2CXC A;  1HNW C;  1MXA A;  3B7W A;  1BA3 A;  2QW0 X;  4LF4 C;  4JI2 C;  5T8T A;  2E8C A;  5GTD A;  1I94 C;  1N2F A;  4NDN A;  4DV2 C;  4X66 C;  5A2Q D;  2HJG A;  4PUG A;  3E7X A;  3FCE A;  3VNS A;  1O92 A;  3NI2 A;  3OTO C;  3I07 A;  4L4Q A;  3R44 A;  2Z51 A;  4AQY C;  1O90 A;  4BCA A;  1HR0 C;  3TDE A;  4GXR A;  4RMN A;  2VZE A;  5LCI A;  2ZZN A;  4B3T C;  4DV4 C;  5KYV A;  3LNV A;  3AF6 A;  4B3M C;  1PG4 A;  4X65 C;  1IBM C;  4JM1 A;  1N33 C;  4ZLP A;  1UKK A;  2D27 A;  3EQ6 A;  1XS3 A;  4GXQ A;  4D57 A;  1V60 A;  1T5D X;  3S82 A;  1USP A;  4U5Y D;  3G7S A;  2E8F A;  3I08 A;  2QVZ X;  4FUT A;  3N2Q A;  4ZJZ A;  4JI1 C;  5H9U A;  2Y27 A;  4RVN A;  5IT9 D;  2ONF A;  4DV1 C;  4KTV A;  2MM9 A;  3FCC A;  2P2J A;  4PZP A;  5DV9 A;  4LF5 C;  1RG9 A;  4IZ6 A;  2UUC C;  1KKG A;  3A4I A;  2P2F A;  4K0K C;  2UXC C;  2UU9 C;  2D1Q A;  4R1L A;  2OPL A;  3GKU A;  5ADZ A;  4DR1 C;  1TH5 A;  3K6R A;  1P4E C;  4D4I A;  1NYE A;  4JV5 C;  3PBK A;  4DUY C;  2UXD C;  2WD9 A;  1FLO A;  2VSQ A;  4DR5 C;  3JAM D;  2ZZM A;  2M5O A;  2VQE C;  3AF5 A;  1AMU A;  5BUQ A;  4B3R C;  4EAT A;  3LAX A;  3A9U A;  4LF7 C;  2P2M A;  4HPV A;  1MXC A;  3A26 A;  4DCV A;  4MH4 A;  1MXB A;  4LFB C;  1XRB A;  3NYQ A;  3UX3 A;  3A9V A;  5FLX D;  1XMO C;  5AE3 A;  4GKJ C;  1QWI A;  3UZ0 A;  4DV0 C;  5BSR A;  3LGX A;  1IB8 A;  5KYT A;  4JI5 C;  2E5L C;  2KDN A;  1LCI A;  1PU1 A;  3DLP X;  4PUH A;  3CW8 X;  3T1Y C;  2D28 C;  2PN2 A;  1WH9 A;  3UX2 A;  1VLA A;  4RLF A;  3IEU A;  5BUS A;  3C5E A;  3PRO C;  3CQ1 A;  4PRO C;  2OO4 A;  1MKY A;  4ODJ A;  3IML A;  2F4V C;  3R9X A;  4OXI A;  4RM2 A;  5CZX A;  1QM4 A;  1V26 A;  2QVY X;  3L8C A;  4I9F A;  2DYJ A;  3H2T A;  3RG2 A;  1XRA A;  1USP B;  3KXW A;  1FJG C;  5BUR A;  1IBK C; 
#chains in the Genus database with same CATH homology
 2E8E A;  1O9T A;  5BR8 C;  3CW9 A;  4G36 A;  2ZM6 C;  4MTN A;  5AE2 A;  2AYA A;  2UXB C;  4JI3 C;  1MDB A;  1IBL C;  1HNZ C;  4DV5 C;  2YWC A;  2E7G A;  2QVX X;  3GR0 A;  2ATW A;  4JYA C;  3IEV A;  3SO4 A;  2VQF C;  4DR4 C;  5LMU C;  4XX2 A;  1ML8 A;  3VNQ A;  5CZV A;  2BH1 X;  3NYR A;  4DUZ C;  2XR1 A;  1ULT A;  3CJE A;  4X64 C;  4NXN C;  4DR7 C;  4BC7 A;  2PRO A;  4JI0 C;  5KEI A;  5A19 A;  4FUQ A;  1PG3 A;  4I9G A;  4D56 A;  4KHP C;  3J81 D;  5A1G A;  5A1I A;  4ISB A;  1T5H X;  4DG9 A;  2CY1 A;  4JI8 C;  1N34 C;  2D1R A;  4RVO A;  3J80 D;  2ASB A;  1L2F A;  4R1M A;  1EGA A;  2KZF A;  2E0G A;  2Y4O A;  3DAY A;  3LUS A;  4NOZ A;  5BSM A;  1N36 C;  2P2B A;  4JI6 C;  2YCB A;  2Y4N A;  4DV6 C;  5IFI A;  2OBV A;  4GKK C;  3RV2 A;  2QL8 A;  2WP0 C;  5K85 A;  3N54 B;  4GS5 A;  4DCT A;  2UUB C;  4G37 A;  4JI7 C;  4BBY A;  2HHH C;  1J5E C;  4LFC C;  5E7Q A;  2JMP A;  2BJO A;  2P20 A;  1N32 C;  3E7W A;  1GPM A;  1ZB9 A;  4LE5 A;  4DV7 C;  4OX9 C;  1FUG A;  2D1T A;  1WF3 A;  2V7B A;  3T1H C;  3EER A;  4TPS B;  4DR6 C;  3UOW A;  3VNR A;  1K0R A;  1RY2 A;  4YY3 C;  4BC9 A;  5T8S A;  4L2Z A;  5BST A;  1ZB8 A;  3R9W A;  3GPC A;  2DPL A;  4PHT A;  4YHH C;  2EGT A;  3ETC A;  1V25 A;  4IR7 A;  4LF8 C;  4DR2 C;  4FTF A;  3GR1 A;  4R0M A;  4RLQ A;  3PES A;  5BSU A;  5AE1 A;  3TUF A;  4LF6 C;  1XNR C;  1LQL A;  4LFA C;  4DR3 C;  3DHV A;  1YJ7 A;  4WS9 A;  5JRH A;  3NPD A;  1JOS A;  4BSZ A;  4DV3 C;  4X62 C;  3ETO A;  1MDF A;  4RM3 A;  4B3S C;  4KTT A;  2P2Q A;  2PT7 G;  2UUA C;  4NXM C;  5K8F A;  4D4G A;  5BSV A;  1PA4 A;  1O93 A;  3TQI A;  4K0B A;  1XMQ C;  4DCU A;  4L7I A;  2YWB A;  5BSW A;  4DG8 A;  4LF9 C;  1MD9 A;  1XNQ C;  5IWA C;  1HH2 P;  1XRC A;  5LMN C;  2P02 A;  2D7V A;  4WV3 A;  1P7L A;  2D1S A;  3IPL A;  3L95 X;  1HNX C;  2OPL B;  4DCS A;  4G1I A;  4JI4 C;  4OYC A;  2CXC A;  1HNW C;  1MXA A;  3B7W A;  1BA3 A;  2QW0 X;  4LF4 C;  4JI2 C;  5T8T A;  2E8C A;  5GTD A;  1I94 C;  1N2F A;  4NDN A;  4DV2 C;  4X66 C;  5A2Q D;  2HJG A;  3E7X A;  3FCE A;  3VNS A;  1O92 A;  3NI2 A;  3OTO C;  3I07 A;  4L4Q A;  3R44 A;  4AQY C;  1O90 A;  4BCA A;  1HR0 C;  3TDE A;  4GXR A;  4RMN A;  2VZE A;  4B3T C;  4DV4 C;  3LNV A;  5KYV A;  4B3M C;  3AF6 A;  1PG4 A;  4X65 C;  1IBM C;  4JM1 A;  1N33 C;  4ZLP A;  1UKK A;  2D27 A;  3EQ6 A;  4GXQ A;  4D57 A;  1T5D X;  3S82 A;  1USP A;  4U5Y D;  3G7S A;  2E8F A;  3I08 A;  2QVZ X;  4FUT A;  3N2Q A;  4ZJZ A;  4JI1 C;  5H9U A;  2Y27 A;  4RVN A;  5IT9 D;  2ONF A;  4DV1 C;  4KTV A;  3FCC A;  2P2J A;  4PZP A;  5DV9 A;  4LF5 C;  1RG9 A;  4IZ6 A;  2UUC C;  1KKG A;  3A4I A;  2P2F A;  4K0K C;  2UXC C;  2UU9 C;  2D1Q A;  4R1L A;  2OPL A;  3GKU A;  5ADZ A;  4DR1 C;  4D4I A;  1NYE A;  4JV5 C;  3PBK A;  4DUY C;  2UXD C;  2WD9 A;  2VSQ A;  4DR5 C;  3JAM D;  2VQE C;  3AF5 A;  1AMU A;  5BUQ A;  4B3R C;  4EAT A;  3LAX A;  3A9U A;  4LF7 C;  2P2M A;  4HPV A;  1MXC A;  4DCV A;  4MH4 A;  1MXB A;  4LFB C;  1XRB A;  3NYQ A;  3A9V A;  5FLX D;  1XMO C;  5AE3 A;  4GKJ C;  1QWI A;  3UZ0 A;  4DV0 C;  5BSR A;  3LGX A;  5KYT A;  4JI5 C;  2E5L C;  3DLP X;  1LCI A;  3CW8 X;  3T1Y C;  2D28 C;  2PN2 A;  1WH9 A;  1VLA A;  4RLF A;  3IEU A;  5BUS A;  3C5E A;  3PRO C;  4PRO C;  2OO4 A;  1MKY A;  4ODJ A;  3IML A;  2F4V C;  3R9X A;  4OXI A;  4RM2 A;  5CZX A;  1QM4 A;  1V26 A;  2QVY X;  3L8C A;  4I9F A;  2DYJ A;  3H2T A;  3RG2 A;  1XRA A;  1USP B;  3KXW A;  1FJG C;  5BUR A;  1IBK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...