1XS3A

Solution structure analysis of the xc975 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
MRKRPLDAETIRKLIESGLPEARVDVQGEDGVHFEATVVSPAFVGKAPLARHRMVYATLGELMGGAIHALQLKTLTPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein XC975
publication title Letter to the Editor: NMR structure note - Solution structure of a bacterial BolA-like protein XC975 from a plant pathogen Xanthomonas campestris pv. campestris
pubmed doi rcsb
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 1xs3A01
4PUHA 2MM9A 2NCLA 1NY8A 3TR3A 1XS3A 2KDNA 2MMAB 3O2EA 4PUIA 2KZ0A 2MCQA 5LCIA 2DHMA 1V60A 4PUGA
chains in the Genus database with same CATH superfamily
3LUSA 4JI3C 2QW0X 4TPSB 4B3MC 5AE2A 4JYAC 4GXQA 2NCLA 1KKGA 1V26A 3FCCA 4JI2C 4YHHC 2F4VC 2YX1A 4LFCC 4DG8A 4BSZA 3UOWA 2ATWA 3IEUA 4JI4C 4PHTA 3IPLA 3B7WA 1JOSA 2ZZNA 4PUGA 2UUAC 2KDNA 1BA3A 2CXCA 3DHVA 4NXNC 1XMQC 4LE5A 4G37A 4GKJC 4K0BA 3EERA 4PROC 3SO4A 1T5DX 3JAMD 4X65C 4XX2A 2JNVA 2PROA 4WV3A 1O93A 3N54B 4DV1C 2PN2A 5BSWA 2D27A 1IBLC 5T8TA 4B3RC 3A4IA 2ASBA 2CY1A 5KEIA 2D1TA 4OYCA 2ZM6C 4LF5C 4DCSA 4L4QA 3UX2A 5BUSA 1N2FA 4LF4C 1O90A 1M6XC 2D1SA 5LCIA 4GXRA 1QWIA 1USPA 4DR7C 4D57A 5H9UA 1WH9A 3LAXA 4JI0C 2MCQA 4ZJZA 5JRHA 3NYRA 1MDFA 3VNRA 4PZPA 4LFAC 3A26A 4I9GA 1VEHA 3VNQA 2D7VA 1FJGC 1HNXC 2P2BA 2BJOA 2Y4OA 4DCTA 1UKKA 2E5LC 1LQLA 1I94C 1HR0C 4U5YD 1ZB9A 3FCEA 4RLFA 1V25A 2OPLB 5KYVA 1PA4A 4G36A 5A1GA 5E7QA 1ZB8A 1PU1A 3I08A 3IEVA 1IBMC 4JI5C 5ADZA 4DV0C 1MXCA 2JMPA 4RM2A 1J5EC 4DUYC 4LF8C 4X66C 1XNQC 5IT9D 4JI7C 2QVZX 4BC9A 4DR1C 4DV4C 2DYJA 4DV3C 5BSUA 4JI6C 1PG3A 5LMNC 5KYTA 2WD9A 4DR6C 1RY2A 4JI8C 3CW9A 2UUBC 1PG4A 5K8FA 2ONFA 2XR1A 3A25A 2VQFC 1O92A 2E8CA 1MDBA 1WCJA 2P2JA 4OX9C 1XMOC 3H2TA 4IR7A 5GTDA 4DR5C 5IWAC 4OXIA 5BSTA 5LMUC 3LNVA 4EATA 5BR8C 2P2QA 3T1HC 1EGAA 2QL8A 3GPCA 1N32C 3A9UA 3NYQA 3TR3A 5BSRA 4AQYC 3CQ3A 4D4GA 3CW8X 2UU9C 1XS3A 2E0GA 3CQ2A 5BUQA 1HNWC 5CZVA 4L7IA 3PBKA 4NXMC 4L2ZA 2OPLA 4DR2C 3E7WA 4WS9A 1RG9A 4FTFA 1M6XA 4ZLPA 3PROC 3GR1A 2UXCC 3L8CA 2E8FA 2MM9A 5A19A 4DUZC 4JM1A 5AE1A 1P4EC 3ETOA 2PT7G 5A2QD 1YJ7A 1HH2P 1N34C 4PUIA 4RVOA 2HJGA 3TDEA 3DLPX 2OBVA 4FUQA 3N2QA 4RLQA 1IB8A 3ETCA 1IBKC 4KTVA 1LCIA 3AF6A 4BC7A 4RM3A 2AYAA 1N36C 3TUFA 1MXBA 4KTTA 4D4IA 4FUTA 4NOZA 2V7BA 3RG2A 2VQEC 3LGXA 4LF6C 3L95X 5BSVA 1GPMA 4LF9C 3KXWA 1FUGA 4DV5C 4MH4A 4ISBA 1WF3A 1VLAA 2D1QA 3G7SA 5K85A 1T5HX 2KZ0A 4HPVA 1NYEA 3NI2A 4X64C 2D1RA 3AF5A 3R9XA 3A9VA 2DPLA 1HNZC 3J81D 2VZEA 2M5HA 3PESA 3UX3A 4LFBC 5AE3A 3TQIA 3E7XA 4JV5C 4NDNA 4DG9A 4DR3C 3CJEA 4YY3C 1TH5A 4LF7C 4RVNA 3C5EA 4IZ6A 5A1IA 2BH1X 5FLXD 2ZZMA 3K6RA 2KZFA 4G1IA 2UXDC 3LNOA 3OTOC 4DV6C 4BCAA 2E8EA 4D56A 4BBYA 3R44A 1XRAA 5IFIA 3RV2A 1N33C 5CZXA 4JI1C 2VSQA 4X62C 1AMUA 4R1MA 2Y27A 4KHPC 4DV7C 3UEBA 4ODJA 1P7LA 4DV2C 4DCUA 2UUCC 3NPDA 4GS5A 2QVXX 4R0MA 2D28C 3AY0A 5BURA 2QVYX 1XNRC 2P02A 4B3SC 1MD9A 3I07A 3S82A 1XRCA 2UXBC 3GKUA 2DHMA 1FLOA 2P2FA 4PUHA 2P2MA 3DAYA 2M5OA 2P20A 3IMLA 1O9TA 1ULTA 1USPB 5BSMA 1P4EA 4I9FA 2EGTA 1V60A 2YWBA 3O2EA 4MTNA 3CQ1A 1NY8A 3T1YC 4B3TC 3VNSA 2MMAB 3EQ6A 1K0RA 3R9WA 2E7GA 1XHJA 4GKKC 2CU6A 3UZ0A 2OO4A 5T8SA 3J80D 4R1LA 1XRBA 1ML8A 4DR4C 2Z51A 1MXAA 4DCVA 1L2FA 2Y4NA 2YCBA 1QM4A 3GR0A 1MKYA 4RMNA 2HHHC 1UWDA 4K0KC 2YWCA 2WP0C 5DV9A
chains in the Genus database with same CATH topology
4PUHA 2MM9A 2NCLA 1NY8A 3TR3A 1XS3A 2KDNA 2MMAB 3O2EA 4PUIA 2KZ0A 2MCQA 5LCIA 2DHMA 1V60A 4PUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUH A;  2MM9 A;  2NCL A;  1NY8 A;  3TR3 A;  1XS3 A;  2KDN A;  2MMA B;  3O2E A;  4PUI A;  2KZ0 A;  2MCQ A;  5LCI A;  2DHM A;  1V60 A;  4PUG A; 
#chains in the Genus database with same CATH topology
 3LUS A;  4JI3 C;  2QW0 X;  4TPS B;  4B3M C;  5AE2 A;  4JYA C;  4GXQ A;  2NCL A;  1KKG A;  1V26 A;  3FCC A;  4JI2 C;  4YHH C;  2F4V C;  2YX1 A;  4LFC C;  4DG8 A;  4BSZ A;  3UOW A;  2ATW A;  3IEU A;  4JI4 C;  4PHT A;  3IPL A;  3B7W A;  1JOS A;  2ZZN A;  4PUG A;  2UUA C;  2KDN A;  1BA3 A;  2CXC A;  3DHV A;  4NXN C;  1XMQ C;  4LE5 A;  4G37 A;  4GKJ C;  4K0B A;  3EER A;  4PRO C;  3SO4 A;  1T5D X;  3JAM D;  4X65 C;  4XX2 A;  2JNV A;  2PRO A;  4WV3 A;  1O93 A;  3N54 B;  4DV1 C;  2PN2 A;  5BSW A;  2D27 A;  1IBL C;  5T8T A;  4B3R C;  3A4I A;  2ASB A;  2CY1 A;  5KEI A;  2D1T A;  4OYC A;  2ZM6 C;  4LF5 C;  4DCS A;  4L4Q A;  3UX2 A;  5BUS A;  1N2F A;  4LF4 C;  1O90 A;  1M6X C;  2D1S A;  5LCI A;  4GXR A;  1QWI A;  1USP A;  4DR7 C;  4D57 A;  5H9U A;  1WH9 A;  3LAX A;  4JI0 C;  2MCQ A;  4ZJZ A;  5JRH A;  3NYR A;  1MDF A;  3VNR A;  4PZP A;  4LFA C;  3A26 A;  4I9G A;  1VEH A;  3VNQ A;  2D7V A;  1FJG C;  1HNX C;  2P2B A;  2BJO A;  2Y4O A;  4DCT A;  1UKK A;  2E5L C;  1LQL A;  1I94 C;  1HR0 C;  4U5Y D;  1ZB9 A;  3FCE A;  4RLF A;  1V25 A;  2OPL B;  5KYV A;  1PA4 A;  4G36 A;  5A1G A;  5E7Q A;  1ZB8 A;  1PU1 A;  3I08 A;  3IEV A;  1IBM C;  4JI5 C;  5ADZ A;  4DV0 C;  1MXC A;  2JMP A;  4RM2 A;  1J5E C;  4DUY C;  4LF8 C;  4X66 C;  1XNQ C;  5IT9 D;  4JI7 C;  2QVZ X;  4BC9 A;  4DR1 C;  4DV4 C;  2DYJ A;  4DV3 C;  5BSU A;  4JI6 C;  1PG3 A;  5LMN C;  5KYT A;  2WD9 A;  4DR6 C;  1RY2 A;  4JI8 C;  3CW9 A;  2UUB C;  1PG4 A;  5K8F A;  2ONF A;  2XR1 A;  3A25 A;  2VQF C;  1O92 A;  2E8C A;  1MDB A;  1WCJ A;  2P2J A;  4OX9 C;  1XMO C;  3H2T A;  4IR7 A;  5GTD A;  4DR5 C;  5IWA C;  4OXI A;  5BST A;  5LMU C;  3LNV A;  4EAT A;  5BR8 C;  2P2Q A;  3T1H C;  1EGA A;  2QL8 A;  3GPC A;  1N32 C;  3A9U A;  3NYQ A;  3TR3 A;  5BSR A;  4AQY C;  3CQ3 A;  4D4G A;  3CW8 X;  2UU9 C;  1XS3 A;  2E0G A;  3CQ2 A;  5BUQ A;  1HNW C;  5CZV A;  4L7I A;  3PBK A;  4NXM C;  4L2Z A;  2OPL A;  4DR2 C;  3E7W A;  4WS9 A;  1RG9 A;  4FTF A;  1M6X A;  4ZLP A;  3PRO C;  3GR1 A;  2UXC C;  3L8C A;  2E8F A;  2MM9 A;  5A19 A;  4DUZ C;  4JM1 A;  5AE1 A;  1P4E C;  3ETO A;  2PT7 G;  5A2Q D;  1YJ7 A;  1HH2 P;  1N34 C;  4PUI A;  4RVO A;  2HJG A;  3TDE A;  3DLP X;  2OBV A;  4FUQ A;  3N2Q A;  4RLQ A;  1IB8 A;  3ETC A;  1IBK C;  4KTV A;  1LCI A;  3AF6 A;  4BC7 A;  4RM3 A;  2AYA A;  1N36 C;  3TUF A;  1MXB A;  4KTT A;  4D4I A;  4FUT A;  4NOZ A;  2V7B A;  3RG2 A;  2VQE C;  3LGX A;  4LF6 C;  3L95 X;  5BSV A;  1GPM A;  4LF9 C;  3KXW A;  1FUG A;  4DV5 C;  4MH4 A;  4ISB A;  1WF3 A;  1VLA A;  2D1Q A;  3G7S A;  5K85 A;  1T5H X;  2KZ0 A;  4HPV A;  1NYE A;  3NI2 A;  4X64 C;  2D1R A;  3AF5 A;  3R9X A;  3A9V A;  2DPL A;  1HNZ C;  3J81 D;  2VZE A;  2M5H A;  3PES A;  3UX3 A;  4LFB C;  5AE3 A;  3TQI A;  3E7X A;  4JV5 C;  4NDN A;  4DG9 A;  4DR3 C;  3CJE A;  4YY3 C;  1TH5 A;  4LF7 C;  4RVN A;  3C5E A;  4IZ6 A;  5A1I A;  2BH1 X;  5FLX D;  2ZZM A;  3K6R A;  2KZF A;  4G1I A;  2UXD C;  3LNO A;  3OTO C;  4DV6 C;  4BCA A;  2E8E A;  4D56 A;  4BBY A;  3R44 A;  1XRA A;  5IFI A;  3RV2 A;  1N33 C;  5CZX A;  4JI1 C;  2VSQ A;  4X62 C;  1AMU A;  4R1M A;  2Y27 A;  4KHP C;  4DV7 C;  3UEB A;  4ODJ A;  1P7L A;  4DV2 C;  4DCU A;  2UUC C;  3NPD A;  4GS5 A;  2QVX X;  4R0M A;  2D28 C;  3AY0 A;  5BUR A;  2QVY X;  1XNR C;  2P02 A;  4B3S C;  1MD9 A;  3I07 A;  3S82 A;  1XRC A;  2UXB C;  3GKU A;  2DHM A;  1FLO A;  2P2F A;  4PUH A;  2P2M A;  3DAY A;  2M5O A;  2P20 A;  3IML A;  1O9T A;  1ULT A;  1USP B;  5BSM A;  1P4E A;  4I9F A;  2EGT A;  1V60 A;  2YWB A;  3O2E A;  4MTN A;  3CQ1 A;  1NY8 A;  3T1Y C;  4B3T C;  3VNS A;  2MMA B;  3EQ6 A;  1K0R A;  3R9W A;  2E7G A;  1XHJ A;  4GKK C;  2CU6 A;  3UZ0 A;  2OO4 A;  5T8S A;  3J80 D;  4R1L A;  1XRB A;  1ML8 A;  4DR4 C;  2Z51 A;  1MXA A;  4DCV A;  1L2F A;  2Y4N A;  2YCB A;  1QM4 A;  3GR0 A;  1MKY A;  4RMN A;  2HHH C;  1UWD A;  4K0K C;  2YWC A;  2WP0 C;  5DV9 A; 
#chains in the Genus database with same CATH homology
 4PUH A;  2MM9 A;  2NCL A;  1NY8 A;  3TR3 A;  1XS3 A;  2KDN A;  2MMA B;  3O2E A;  4PUI A;  2KZ0 A;  2MCQ A;  5LCI A;  2DHM A;  1V60 A;  4PUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...