1XS3A

Solution structure analysis of the xc975 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
MRKRPLDAETIRKLIESGLPEARVDVQGEDGVHFEATVVSPAFVGKAPLARHRMVYATLGELMGGAIHALQLKTLTPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein XC975
publication title Letter to the Editor: NMR structure note - Solution structure of a bacterial BolA-like protein XC975 from a plant pathogen Xanthomonas campestris pv. campestris
pubmed doi rcsb
molecule tags Structural genomics, unknown function
total genus 12
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2004-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 1xs3A01
2KDNA 1NY8A 2DHMA 2MMAB 3O2EA 5LCIA 2MCQA 2MM9A 2NCLA 4PUHA 3TR3A 4PUIA 2KZ0A 1XS3A 4PUGA 1V60A
chains in the Genus database with same CATH superfamily
4KTTA 4PUIA 4L7IA 4YHHC 3O2EA 3EQ6A 4LF7C 3DAYA 5AE2A 4TPSB 3UZ0A 2M5OA 3UX3A 2PROA 1N32C 2HJGA 4LFCC 2ATWA 1IBMC 3A25A 3DLPX 1O92A 1AMUA 4GS5A 2OPLB 1MXCA 5H9UA 2V7BA 1XMOC 4MH4A 4GXQA 1T5DX 5AE3A 3NYRA 2VQEC 5AE1A 5KYTA 5IT9D 2P2QA 4WV3A 4RLQA 2PN2A 3AY0A 2E8FA 4DR4C 5BSUA 3AF5A 2CU6A 1V26A 1M6XC 2P2BA 4OX9C 1XS3A 3LNOA 3LGXA 3TR3A 3GR1A 2JMPA 1XMQC 3IPLA 5A2QD 1XRAA 4R0MA 4RM3A 1XRBA 4JI5C 4DCTA 3I08A 4JI3C 4KTVA 3CW9A 3A9VA 2ONFA 3TDEA 2WP0C 4LFAC 4R1MA 2E8EA 2QVYX 4U5YD 2QL8A 1PA4A 3A9UA 5T8SA 2YCBA 4DR2C 1BA3A 3UX2A 3CQ3A 1N36C 4DR5C 4DV6C 1N2FA 4LF9C 2UXBC 3CJEA 3VNQA 4K0BA 5ADZA 5LCIA 2UUAC 1USPA 4NXNC 1IB8A 3KXWA 4MTNA 4DV5C 4G37A 2VSQA 5BSRA 3H2TA 2Y27A 2UUCC 2D1QA 4G36A 4X64C 5IWAC 4JV5C 4OXIA 1XHJA 5BUQA 4I9FA 5FLXD 4DR6C 2UXDC 4PUGA 4DV1C 2ASBA 1XRCA 1MDBA 3UOWA 3GKUA 1N33C 5DV9A 4ODJA 4X66C 5BURA 4PUHA 3E7WA 1JOSA 3OTOC 2HHHC 1NY8A 4ZJZA 4X65C 3ETOA 2QW0X 4IR7A 1PU1A 2UXCC 5BSMA 1T5HX 2ZM6C 4D56A 2YX1A 4JI2C 1RY2A 3L8CA 4RVNA 2UUBC 2E0GA 2CXCA 1P4EA 3N2QA 5E7QA 2E7GA 5CZVA 2MCQA 1GPMA 4B3RC 4YY3C 1WF3A 2D1SA 4HPVA 3T1YC 3PESA 3A26A 2YWCA 3IMLA 4DV3C 4WS9A 1HH2P 3CW8X 4IZ6A 2OO4A 1O90A 1O93A 4PZPA 3R9WA 3LNVA 2QVXX 4AQYC 1PG4A 2Y4NA 1HNXC 1IBKC 1MKYA 4BBYA 4L4QA 1V25A 1ZB8A 3CQ1A 4LF5C 1ML8A 5KEIA 3J81D 1XNQC 4GXRA 4LE5A 3PBKA 4FUTA 3LUSA 1NYEA 4RM2A 4JM1A 5BSVA 4NXMC 1N34C 3RG2A 1WCJA 4JI7C 4JI8C 1O9TA 3N54B 3C5EA 4FTFA 1USPB 3RV2A 1HR0C 1ULTA 3I07A 4DUZC 4LF4C 4DV0C 1KKGA 4D4IA 4LFBC 4NOZA 2D1RA 5JRHA 1YJ7A 5BSWA 4ZLPA 1VEHA 1I94C 5K8FA 2E8CA 1XNRC 1J5EC 4DR1C 3SO4A 4JI1C 2Y4OA 5K85A 4RMNA 1QWIA 1LQLA 2XR1A 3UEBA 3JAMD 2KZFA 4BCAA 1IBLC 2KZ0A 4DR7C 3VNRA 1K0RA 3PROC 4K0KC 4DCSA 2MMAB 2D28C 4LF8C 1WH9A 5IFIA 4LF6C 4R1LA 4RVOA 1PG3A 4GKJC 2BH1X 3K6RA 3DHVA 4D57A 2F4VC 5BSTA 4DCVA 2P2MA 2D27A 4DV2C 4I9GA 2BJOA 4PROC 5KYVA 4KHPC 5A1IA 1P7LA 2OPLA 1M6XA 2VZEA 1V60A 4XX2A 3LAXA 4DG8A 3L95X 3NPDA 2M5HA 2P02A 2AYAA 3FCEA 4D4GA 4DV7C 3R44A 1MD9A 1MDFA 2DYJA 4B3MC 4B3SC 1QM4A 1ZB9A 2YWBA 2Z51A 1HNZC 4GKKC 3B7WA 1FLOA 3NYQA 1FUGA 3G7SA 2D1TA 1P4EC 1TH5A 3TQIA 1UKKA 4L2ZA 4DR3C 1LCIA 3TUFA 5A19A 3J80D 2VQFC 3NI2A 4FUQA 2KDNA 4DV4C 1FJGC 1MXBA 3E7XA 3GPCA 4BC7A 1VLAA 2P20A 3AF6A 4OYCA 2NCLA 3R9XA 5LMUC 1MXAA 5BUSA 2QVZX 3IEUA 3IEVA 4ISBA 4RLFA 2JNVA 2MM9A 2P2FA 2D7VA 3T1HC 4JYAC 5A1GA 3FCCA 4BSZA 4EATA 3CQ2A 4JI6C 3EERA 4BC9A 4PHTA 5BR8C 3VNSA 4X62C 2E5LC 3S82A 1EGAA 2UU9C 1RG9A 4DCUA 1L2FA 2OBVA 3GR0A 4NDNA 2ZZMA 2EGTA 2DPLA 4B3TC 4JI0C 3A4IA 2CY1A 1HNWC 4JI4C 2P2JA 2ZZNA 2WD9A 4DG9A 5T8TA 5GTDA 5LMNC 2DHMA 4DUYC 3ETCA 4G1IA 5CZXA 1UWDA 2PT7G
chains in the Genus database with same CATH topology
2KDNA 1NY8A 2DHMA 2MMAB 3O2EA 5LCIA 2MCQA 2MM9A 2NCLA 4PUHA 3TR3A 4PUIA 2KZ0A 1XS3A 4PUGA 1V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDN A;  1NY8 A;  2DHM A;  2MMA B;  3O2E A;  5LCI A;  2MCQ A;  2MM9 A;  2NCL A;  4PUH A;  3TR3 A;  4PUI A;  2KZ0 A;  1XS3 A;  4PUG A;  1V60 A; 
#chains in the Genus database with same CATH topology
 4KTT A;  4PUI A;  4L7I A;  4YHH C;  3O2E A;  3EQ6 A;  4LF7 C;  3DAY A;  5AE2 A;  4TPS B;  3UZ0 A;  2M5O A;  3UX3 A;  2PRO A;  1N32 C;  2HJG A;  4LFC C;  2ATW A;  1IBM C;  3A25 A;  3DLP X;  1O92 A;  1AMU A;  4GS5 A;  2OPL B;  1MXC A;  5H9U A;  2V7B A;  1XMO C;  4MH4 A;  4GXQ A;  1T5D X;  5AE3 A;  3NYR A;  2VQE C;  5AE1 A;  5KYT A;  5IT9 D;  2P2Q A;  4WV3 A;  4RLQ A;  2PN2 A;  3AY0 A;  2E8F A;  4DR4 C;  5BSU A;  3AF5 A;  2CU6 A;  1V26 A;  1M6X C;  2P2B A;  4OX9 C;  1XS3 A;  3LNO A;  3LGX A;  3TR3 A;  3GR1 A;  2JMP A;  1XMQ C;  3IPL A;  5A2Q D;  1XRA A;  4R0M A;  4RM3 A;  1XRB A;  4JI5 C;  4DCT A;  3I08 A;  4JI3 C;  4KTV A;  3CW9 A;  3A9V A;  2ONF A;  3TDE A;  2WP0 C;  4LFA C;  4R1M A;  2E8E A;  2QVY X;  4U5Y D;  2QL8 A;  1PA4 A;  3A9U A;  5T8S A;  2YCB A;  4DR2 C;  1BA3 A;  3UX2 A;  3CQ3 A;  1N36 C;  4DR5 C;  4DV6 C;  1N2F A;  4LF9 C;  2UXB C;  3CJE A;  3VNQ A;  4K0B A;  5ADZ A;  5LCI A;  2UUA C;  1USP A;  4NXN C;  1IB8 A;  3KXW A;  4MTN A;  4DV5 C;  4G37 A;  2VSQ A;  5BSR A;  3H2T A;  2Y27 A;  2UUC C;  2D1Q A;  4G36 A;  4X64 C;  5IWA C;  4JV5 C;  4OXI A;  1XHJ A;  5BUQ A;  4I9F A;  5FLX D;  4DR6 C;  2UXD C;  4PUG A;  4DV1 C;  2ASB A;  1XRC A;  1MDB A;  3UOW A;  3GKU A;  1N33 C;  5DV9 A;  4ODJ A;  4X66 C;  5BUR A;  4PUH A;  3E7W A;  1JOS A;  3OTO C;  2HHH C;  1NY8 A;  4ZJZ A;  4X65 C;  3ETO A;  2QW0 X;  4IR7 A;  1PU1 A;  2UXC C;  5BSM A;  1T5H X;  2ZM6 C;  4D56 A;  2YX1 A;  4JI2 C;  1RY2 A;  3L8C A;  4RVN A;  2UUB C;  2E0G A;  2CXC A;  1P4E A;  3N2Q A;  5E7Q A;  2E7G A;  5CZV A;  2MCQ A;  1GPM A;  4B3R C;  4YY3 C;  1WF3 A;  2D1S A;  4HPV A;  3T1Y C;  3PES A;  3A26 A;  2YWC A;  3IML A;  4DV3 C;  4WS9 A;  1HH2 P;  3CW8 X;  4IZ6 A;  2OO4 A;  1O90 A;  1O93 A;  4PZP A;  3R9W A;  3LNV A;  2QVX X;  4AQY C;  1PG4 A;  2Y4N A;  1HNX C;  1IBK C;  1MKY A;  4BBY A;  4L4Q A;  1V25 A;  1ZB8 A;  3CQ1 A;  4LF5 C;  1ML8 A;  5KEI A;  3J81 D;  1XNQ C;  4GXR A;  4LE5 A;  3PBK A;  4FUT A;  3LUS A;  1NYE A;  4RM2 A;  4JM1 A;  5BSV A;  4NXM C;  1N34 C;  3RG2 A;  1WCJ A;  4JI7 C;  4JI8 C;  1O9T A;  3N54 B;  3C5E A;  4FTF A;  1USP B;  3RV2 A;  1HR0 C;  1ULT A;  3I07 A;  4DUZ C;  4LF4 C;  4DV0 C;  1KKG A;  4D4I A;  4LFB C;  4NOZ A;  2D1R A;  5JRH A;  1YJ7 A;  5BSW A;  4ZLP A;  1VEH A;  1I94 C;  5K8F A;  2E8C A;  1XNR C;  1J5E C;  4DR1 C;  3SO4 A;  4JI1 C;  2Y4O A;  5K85 A;  4RMN A;  1QWI A;  1LQL A;  2XR1 A;  3UEB A;  3JAM D;  2KZF A;  4BCA A;  1IBL C;  2KZ0 A;  4DR7 C;  3VNR A;  1K0R A;  3PRO C;  4K0K C;  4DCS A;  2MMA B;  2D28 C;  4LF8 C;  1WH9 A;  5IFI A;  4LF6 C;  4R1L A;  4RVO A;  1PG3 A;  4GKJ C;  2BH1 X;  3K6R A;  3DHV A;  4D57 A;  2F4V C;  5BST A;  4DCV A;  2P2M A;  2D27 A;  4DV2 C;  4I9G A;  2BJO A;  4PRO C;  5KYV A;  4KHP C;  5A1I A;  1P7L A;  2OPL A;  1M6X A;  2VZE A;  1V60 A;  4XX2 A;  3LAX A;  4DG8 A;  3L95 X;  3NPD A;  2M5H A;  2P02 A;  2AYA A;  3FCE A;  4D4G A;  4DV7 C;  3R44 A;  1MD9 A;  1MDF A;  2DYJ A;  4B3M C;  4B3S C;  1QM4 A;  1ZB9 A;  2YWB A;  2Z51 A;  1HNZ C;  4GKK C;  3B7W A;  1FLO A;  3NYQ A;  1FUG A;  3G7S A;  2D1T A;  1P4E C;  1TH5 A;  3TQI A;  1UKK A;  4L2Z A;  4DR3 C;  1LCI A;  3TUF A;  5A19 A;  3J80 D;  2VQF C;  3NI2 A;  4FUQ A;  2KDN A;  4DV4 C;  1FJG C;  1MXB A;  3E7X A;  3GPC A;  4BC7 A;  1VLA A;  2P20 A;  3AF6 A;  4OYC A;  2NCL A;  3R9X A;  5LMU C;  1MXA A;  5BUS A;  2QVZ X;  3IEU A;  3IEV A;  4ISB A;  4RLF A;  2JNV A;  2MM9 A;  2P2F A;  2D7V A;  3T1H C;  4JYA C;  5A1G A;  3FCC A;  4BSZ A;  4EAT A;  3CQ2 A;  4JI6 C;  3EER A;  4BC9 A;  4PHT A;  5BR8 C;  3VNS A;  4X62 C;  2E5L C;  3S82 A;  1EGA A;  2UU9 C;  1RG9 A;  4DCU A;  1L2F A;  2OBV A;  3GR0 A;  4NDN A;  2ZZM A;  2EGT A;  2DPL A;  4B3T C;  4JI0 C;  3A4I A;  2CY1 A;  1HNW C;  4JI4 C;  2P2J A;  2ZZN A;  2WD9 A;  4DG9 A;  5T8T A;  5GTD A;  5LMN C;  2DHM A;  4DUY C;  3ETC A;  4G1I A;  5CZX A;  1UWD A;  2PT7 G; 
#chains in the Genus database with same CATH homology
 2KDN A;  1NY8 A;  2DHM A;  2MMA B;  3O2E A;  5LCI A;  2MCQ A;  2MM9 A;  2NCL A;  4PUH A;  3TR3 A;  4PUI A;  2KZ0 A;  1XS3 A;  4PUG A;  1V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...