1MXBA

S-adenosylmethionine synthetase with adp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
total genus 125
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA01
1XRCA 3RV2A 5T8SA 1FUGA 3S82A 2OBVA 4L4QA 2YWBA 4KTVA 4HPVA 1RG9A 3IMLA 4LE5A 5H9UA 1O90A 5A1GA 1QM4A 1XRAA 2YWCA 1MXCA 3TQIA 1MXBA 3A4IA 3TDEA 5A1IA 4KTTA 1O93A 3UOWA 4L2ZA 4ODJA 4K0BA 4WS9A 1XRBA 1GPMA 1P7LA 3SO4A 1O92A 1O9TA 4NDNA 4L7IA 1MXAA 2DPLA 5T8TA 2P02A 5A19A
chains in the Genus database with same CATH superfamily
4JI2C 4B3MC 4JI1C 1FUGA 4DUZC 4PUHA 5KYVA 5LMUC 4ZJZA 1N36C 4PUGA 5BSUA 3VNRA 4DV2C 4JI4C 2P2QA 3KXWA 3A4IA 1N34C 4LF5C 4GKKC 2E8CA 3CQ2A 4NDNA 2DPLA 2E8FA 4IR7A 2JMPA 3A9UA 3I07A 1BA3A 3VNQA 5BSTA 4JI0C 5H9UA 4GKJC 4XX2A 5KEIA 2Y4OA 1V60A 5LCIA 4I9GA 2P20A 4PHTA 4RLQA 3IPLA 1XS3A 3A25A 1LCIA 3GKUA 4L2ZA 4ZLPA 3NYRA 1MD9A 4DR6C 2F4VC 1M6XA 2P02A 2E5LC 2KDNA 1IBLC 1IBMC 2D1TA 3ETOA 4DCUA 3O2EA 3FCEA 2YWCA 4NOZA 5BSMA 4R1LA 5IFIA 2P2FA 2QVZX 3DLPX 1YJ7A 1HNZC 1MDFA 4LF9C 5CZXA 4DV5C 2ZZNA 4JV5C 5ADZA 2OO4A 1FLOA 2HJGA 4OXIA 3LNOA 5JRHA 4DR7C 5BURA 3C5EA 2PROA 2ZZMA 3N2QA 1IB8A 1MXCA 1JOSA 5AE3A 3PESA 1VLAA 4JI5C 2PT7G 4ISBA 3UOWA 3CQ3A 2Y4NA 5BSVA 1XNQC 1O92A 5A1GA 1PA4A 1PU1A 4RVOA 2HHHC 2UUAC 1ZB9A 2KZ0A 3EERA 1O90A 4D57A 3ETCA 2ASBA 5E7QA 4DV6C 4IZ6A 2OPLB 4PZPA 4ODJA 4B3TC 2UXDC 2ATWA 1RY2A 4LF7C 4L7IA 2QVXX 5IT9D 2BH1X 5T8TA 3AF5A 3RV2A 3S82A 5CZVA 4WV3A 4NXMC 5IWAC 5LMNC 3J81D 3T1HC 2UXBC 5A1IA 2P2BA 3TDEA 3H2TA 2AYAA 4DCSA 2MM9A 2CXCA 5GTDA 4AQYC 5A2QD 3UX3A 4FUTA 4JI8C 4D56A 4LFBC 1N33C 4RVNA 4BC7A 4TPSB 5A19A 5BUSA 1XNRC 3UZ0A 4L4QA 2D27A 1HH2P 2UXCC 4LE5A 4DV7C 4YY3C 3AF6A 4DR1C 3JAMD 3NYQA 2M5HA 4PUIA 2OPLA 1P4EC 4WS9A 4DCVA 2DHMA 4LFAC 4OYCA 1K0RA 3OTOC 5KYTA 2YWBA 3GPCA 1WCJA 2YCBA 4HPVA 1MDBA 4LF4C 1V25A 1IBKC 3DAYA 5BSWA 4DV3C 4B3SC 4DV4C 4GXQA 4K0BA 1GPMA 3NI2A 1LQLA 1MXAA 5T8SA 1XHJA 3A26A 3TR3A 3AY0A 1N32C 1ZB8A 4LF6C 1VEHA 1ULTA 1UKKA 1P4EA 1V26A 1XMOC 2BJOA 3IEUA 2WD9A 3NPDA 2D1SA 2UUBC 2P2JA 2UUCC 1XRCA 4DV0C 2D7VA 1N2FA 4G37A 2M5OA 4DV1C 2PN2A 3FCCA 1T5HX 5K8FA 2ZM6C 3LUSA 2ONFA 4U5YD 4FTFA 4K0KC 2JNVA 3CQ1A 1USPB 1AMUA 3CW9A 4BC9A 1HNWC 2P2MA 2D28C 4DR2C 3DHVA 4X62C 2QVYX 4OX9C 3E7XA 1RG9A 4LFCC 2EGTA 4KHPC 2XR1A 3CW8X 1PG3A 3R9XA 2D1QA 3E7WA 3UX2A 2VQEC 4D4GA 3I08A 1HR0C 1XRBA 4GS5A 4BBYA 4B3RC 5AE2A 4YHHC 4I9FA 4DR5C 4KTVA 1M6XC 3IMLA 4DCTA 4NXNC 2Z51A 5BR8C 5K85A 3CJEA 1TH5A 1KKGA 1MXBA 2VZEA 3LNVA 3L95X 3L8CA 4MH4A 4RM2A 2MCQA 2KZFA 4JYAC 1EGAA 1USPA 4PROC 2DYJA 4DR3C 4RM3A 2OBVA 4DR4C 4X65C 3TUFA 3G7SA 3R9WA 2QL8A 3VNSA 4FUQA 1O93A 1QWIA 2E8EA 1XMQC 1J5EC 1MKYA 2E7GA 2CU6A 5BUQA 3SO4A 4JI3C 4RLFA 1UWDA 4MTNA 3A9VA 1HNXC 3GR0A 3B7WA 4RMNA 4R0MA 1PG4A 4DG8A 3GR1A 1QM4A 3IEVA 2CY1A 5DV9A 2NCLA 3UEBA 4G1IA 3R44A 2WP0C 3T1YC 3PBKA 4BSZA 3J80D 3PROC 4X64C 3N54B 4LF8C 4DUYC 2VQFC 1NY8A 4G36A 4X66C 4JM1A 2E0GA 3K6RA 2V7BA 1FJGC 1I94C 1WF3A 1XRAA 5AE1A 2MMAB 2Y27A 3EQ6A 4DG9A 4KTTA 2UU9C 4D4IA 2QW0X 1P7LA 1O9TA 4R1MA 4EATA 3LGXA 4GXRA 3RG2A 2YX1A 2D1RA 4JI7C 4BCAA 3TQIA 4JI6C 3LAXA 2VSQA 1T5DX 1WH9A 5FLXD 1ML8A 5BSRA 1NYEA 1L2FA
chains in the Genus database with same CATH topology
4JI2C 4B3MC 4JI1C 1FUGA 4DUZC 5KYVA 5LMUC 4ZJZA 1N36C 5BSUA 3VNRA 4DV2C 4JI4C 2P2QA 3KXWA 3A4IA 1N34C 4LF5C 4GKKC 2E8CA 4NDNA 2DPLA 2E8FA 4IR7A 2JMPA 3A9UA 3I07A 1BA3A 3VNQA 5BSTA 4JI0C 5H9UA 4GKJC 4XX2A 5KEIA 2Y4OA 4I9GA 2P20A 4PHTA 4RLQA 3IPLA 1LCIA 3GKUA 4L2ZA 4ZLPA 3NYRA 1MD9A 4DR6C 2F4VC 2P02A 2E5LC 1IBLC 1IBMC 2D1TA 3ETOA 4DCUA 3FCEA 2YWCA 4NOZA 5BSMA 4R1LA 5IFIA 2P2FA 2QVZX 3DLPX 1YJ7A 1HNZC 1MDFA 4LF9C 5CZXA 4DV5C 4JV5C 5ADZA 2OO4A 2HJGA 4OXIA 5JRHA 4DR7C 5BURA 3C5EA 2PROA 3N2QA 1MXCA 1JOSA 5AE3A 3PESA 1VLAA 4JI5C 2PT7G 4ISBA 3UOWA 2Y4NA 5BSVA 1XNQC 1O92A 5A1GA 1PA4A 4RVOA 2HHHC 2UUAC 1ZB9A 3EERA 1O90A 4D57A 3ETCA 2ASBA 5E7QA 4DV6C 4IZ6A 2OPLB 4PZPA 4ODJA 4B3TC 2UXDC 2ATWA 1RY2A 4LF7C 4L7IA 2QVXX 5IT9D 2BH1X 5T8TA 3AF5A 3RV2A 3S82A 5CZVA 4WV3A 4NXMC 5IWAC 5LMNC 3J81D 3T1HC 2UXBC 3TDEA 2P2BA 5A1IA 3H2TA 2AYAA 4DCSA 2CXCA 5GTDA 4AQYC 5A2QD 4FUTA 4JI8C 4D56A 4LFBC 1N33C 4RVNA 4BC7A 4TPSB 5A19A 5BUSA 1XNRC 3UZ0A 4L4QA 2D27A 1HH2P 2UXCC 4LE5A 4DV7C 4YY3C 3AF6A 4DR1C 3JAMD 3NYQA 2OPLA 4WS9A 4DCVA 4LFAC 4OYCA 1K0RA 3OTOC 5KYTA 2YWBA 3GPCA 2YCBA 4HPVA 1MDBA 4LF4C 1V25A 1IBKC 3DAYA 5BSWA 4DV3C 4B3SC 4DV4C 4GXQA 4K0BA 1GPMA 3NI2A 1LQLA 1MXAA 5T8SA 1N32C 1ZB8A 4LF6C 1ULTA 1UKKA 1V26A 1XMOC 2BJOA 3IEUA 2WD9A 3NPDA 2D1SA 2UUBC 2P2JA 2UUCC 1XRCA 4DV0C 2D7VA 1N2FA 4G37A 4DV1C 2PN2A 3FCCA 1T5HX 5K8FA 2ZM6C 3LUSA 2ONFA 4U5YD 4FTFA 4K0KC 1USPB 1AMUA 3CW9A 4BC9A 1HNWC 2P2MA 2D28C 4DR2C 3DHVA 4X62C 2QVYX 4OX9C 3E7XA 1RG9A 4LFCC 2EGTA 4KHPC 2XR1A 3CW8X 1PG3A 3R9XA 2D1QA 3E7WA 2VQEC 4D4GA 3I08A 1HR0C 1XRBA 4GS5A 4BBYA 4B3RC 5AE2A 4YHHC 4I9FA 4DR5C 4KTVA 3IMLA 4DCTA 4NXNC 5BR8C 5K85A 3CJEA 1KKGA 1MXBA 2VZEA 3LNVA 3L95X 3L8CA 4MH4A 4RM2A 2KZFA 4JYAC 1EGAA 1USPA 4PROC 2DYJA 4DR3C 4RM3A 2OBVA 4DR4C 4X65C 3TUFA 3G7SA 3R9WA 2QL8A 3VNSA 4FUQA 1O93A 1QWIA 2E8EA 1XMQC 1J5EC 1MKYA 2E7GA 5BUQA 3SO4A 4JI3C 4RLFA 4MTNA 3A9VA 1HNXC 3GR0A 3B7WA 4RMNA 4R0MA 1PG4A 4DG8A 3GR1A 1QM4A 3IEVA 2CY1A 5DV9A 4G1IA 3R44A 2WP0C 3T1YC 3PBKA 4BSZA 3J80D 3PROC 4X64C 3N54B 4LF8C 4DUYC 2VQFC 4G36A 4X66C 4JM1A 2E0GA 2V7BA 1FJGC 1I94C 1WF3A 1XRAA 5AE1A 2Y27A 3EQ6A 4DG9A 4KTTA 2UU9C 4D4IA 2QW0X 1P7LA 1O9TA 4R1MA 4EATA 3LGXA 4GXRA 3RG2A 2D1RA 4JI7C 4BCAA 3TQIA 4JI6C 3LAXA 2VSQA 1T5DX 1WH9A 5FLXD 1ML8A 5BSRA 1NYEA 1L2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRC A;  3RV2 A;  5T8S A;  1FUG A;  3S82 A;  2OBV A;  4L4Q A;  2YWB A;  4KTV A;  4HPV A;  1RG9 A;  3IML A;  4LE5 A;  5H9U A;  1O90 A;  5A1G A;  1QM4 A;  1XRA A;  2YWC A;  1MXC A;  3TQI A;  1MXB A;  3A4I A;  3TDE A;  5A1I A;  4KTT A;  1O93 A;  3UOW A;  4L2Z A;  4ODJ A;  4K0B A;  4WS9 A;  1XRB A;  1GPM A;  1P7L A;  3SO4 A;  1O92 A;  1O9T A;  4NDN A;  4L7I A;  1MXA A;  2DPL A;  5T8T A;  2P02 A;  5A19 A; 
#chains in the Genus database with same CATH topology
 4JI2 C;  4B3M C;  4JI1 C;  1FUG A;  4DUZ C;  4PUH A;  5KYV A;  5LMU C;  4ZJZ A;  1N36 C;  4PUG A;  5BSU A;  3VNR A;  4DV2 C;  4JI4 C;  2P2Q A;  3KXW A;  3A4I A;  1N34 C;  4LF5 C;  4GKK C;  2E8C A;  3CQ2 A;  4NDN A;  2DPL A;  2E8F A;  4IR7 A;  2JMP A;  3A9U A;  3I07 A;  1BA3 A;  3VNQ A;  5BST A;  4JI0 C;  5H9U A;  4GKJ C;  4XX2 A;  5KEI A;  2Y4O A;  1V60 A;  5LCI A;  4I9G A;  2P20 A;  4PHT A;  4RLQ A;  3IPL A;  1XS3 A;  3A25 A;  1LCI A;  3GKU A;  4L2Z A;  4ZLP A;  3NYR A;  1MD9 A;  4DR6 C;  2F4V C;  1M6X A;  2P02 A;  2E5L C;  2KDN A;  1IBL C;  1IBM C;  2D1T A;  3ETO A;  4DCU A;  3O2E A;  3FCE A;  2YWC A;  4NOZ A;  5BSM A;  4R1L A;  5IFI A;  2P2F A;  2QVZ X;  3DLP X;  1YJ7 A;  1HNZ C;  1MDF A;  4LF9 C;  5CZX A;  4DV5 C;  2ZZN A;  4JV5 C;  5ADZ A;  2OO4 A;  1FLO A;  2HJG A;  4OXI A;  3LNO A;  5JRH A;  4DR7 C;  5BUR A;  3C5E A;  2PRO A;  2ZZM A;  3N2Q A;  1IB8 A;  1MXC A;  1JOS A;  5AE3 A;  3PES A;  1VLA A;  4JI5 C;  2PT7 G;  4ISB A;  3UOW A;  3CQ3 A;  2Y4N A;  5BSV A;  1XNQ C;  1O92 A;  5A1G A;  1PA4 A;  1PU1 A;  4RVO A;  2HHH C;  2UUA C;  1ZB9 A;  2KZ0 A;  3EER A;  1O90 A;  4D57 A;  3ETC A;  2ASB A;  5E7Q A;  4DV6 C;  4IZ6 A;  2OPL B;  4PZP A;  4ODJ A;  4B3T C;  2UXD C;  2ATW A;  1RY2 A;  4LF7 C;  4L7I A;  2QVX X;  5IT9 D;  2BH1 X;  5T8T A;  3AF5 A;  3RV2 A;  3S82 A;  5CZV A;  4WV3 A;  4NXM C;  5IWA C;  5LMN C;  3J81 D;  3T1H C;  2UXB C;  5A1I A;  2P2B A;  3TDE A;  3H2T A;  2AYA A;  4DCS A;  2MM9 A;  2CXC A;  5GTD A;  4AQY C;  5A2Q D;  3UX3 A;  4FUT A;  4JI8 C;  4D56 A;  4LFB C;  1N33 C;  4RVN A;  4BC7 A;  4TPS B;  5A19 A;  5BUS A;  1XNR C;  3UZ0 A;  4L4Q A;  2D27 A;  1HH2 P;  2UXC C;  4LE5 A;  4DV7 C;  4YY3 C;  3AF6 A;  4DR1 C;  3JAM D;  3NYQ A;  2M5H A;  4PUI A;  2OPL A;  1P4E C;  4WS9 A;  4DCV A;  2DHM A;  4LFA C;  4OYC A;  1K0R A;  3OTO C;  5KYT A;  2YWB A;  3GPC A;  1WCJ A;  2YCB A;  4HPV A;  1MDB A;  4LF4 C;  1V25 A;  1IBK C;  3DAY A;  5BSW A;  4DV3 C;  4B3S C;  4DV4 C;  4GXQ A;  4K0B A;  1GPM A;  3NI2 A;  1LQL A;  1MXA A;  5T8S A;  1XHJ A;  3A26 A;  3TR3 A;  3AY0 A;  1N32 C;  1ZB8 A;  4LF6 C;  1VEH A;  1ULT A;  1UKK A;  1P4E A;  1V26 A;  1XMO C;  2BJO A;  3IEU A;  2WD9 A;  3NPD A;  2D1S A;  2UUB C;  2P2J A;  2UUC C;  1XRC A;  4DV0 C;  2D7V A;  1N2F A;  4G37 A;  2M5O A;  4DV1 C;  2PN2 A;  3FCC A;  1T5H X;  5K8F A;  2ZM6 C;  3LUS A;  2ONF A;  4U5Y D;  4FTF A;  4K0K C;  2JNV A;  3CQ1 A;  1USP B;  1AMU A;  3CW9 A;  4BC9 A;  1HNW C;  2P2M A;  2D28 C;  4DR2 C;  3DHV A;  4X62 C;  2QVY X;  4OX9 C;  3E7X A;  1RG9 A;  4LFC C;  2EGT A;  4KHP C;  2XR1 A;  3CW8 X;  1PG3 A;  3R9X A;  2D1Q A;  3E7W A;  3UX2 A;  2VQE C;  4D4G A;  3I08 A;  1HR0 C;  1XRB A;  4GS5 A;  4BBY A;  4B3R C;  5AE2 A;  4YHH C;  4I9F A;  4DR5 C;  4KTV A;  1M6X C;  3IML A;  4DCT A;  4NXN C;  2Z51 A;  5BR8 C;  5K85 A;  3CJE A;  1TH5 A;  1KKG A;  1MXB A;  2VZE A;  3LNV A;  3L95 X;  3L8C A;  4MH4 A;  4RM2 A;  2MCQ A;  2KZF A;  4JYA C;  1EGA A;  1USP A;  4PRO C;  2DYJ A;  4DR3 C;  4RM3 A;  2OBV A;  4DR4 C;  4X65 C;  3TUF A;  3G7S A;  3R9W A;  2QL8 A;  3VNS A;  4FUQ A;  1O93 A;  1QWI A;  2E8E A;  1XMQ C;  1J5E C;  1MKY A;  2E7G A;  2CU6 A;  5BUQ A;  3SO4 A;  4JI3 C;  4RLF A;  1UWD A;  4MTN A;  3A9V A;  1HNX C;  3GR0 A;  3B7W A;  4RMN A;  4R0M A;  1PG4 A;  4DG8 A;  3GR1 A;  1QM4 A;  3IEV A;  2CY1 A;  5DV9 A;  2NCL A;  3UEB A;  4G1I A;  3R44 A;  2WP0 C;  3T1Y C;  3PBK A;  4BSZ A;  3J80 D;  3PRO C;  4X64 C;  3N54 B;  4LF8 C;  4DUY C;  2VQF C;  1NY8 A;  4G36 A;  4X66 C;  4JM1 A;  2E0G A;  3K6R A;  2V7B A;  1FJG C;  1I94 C;  1WF3 A;  1XRA A;  5AE1 A;  2MMA B;  2Y27 A;  3EQ6 A;  4DG9 A;  4KTT A;  2UU9 C;  4D4I A;  2QW0 X;  1P7L A;  1O9T A;  4R1M A;  4EAT A;  3LGX A;  4GXR A;  3RG2 A;  2YX1 A;  2D1R A;  4JI7 C;  4BCA A;  3TQI A;  4JI6 C;  3LAX A;  2VSQ A;  1T5D X;  1WH9 A;  5FLX D;  1ML8 A;  5BSR A;  1NYE A;  1L2F A; 
#chains in the Genus database with same CATH homology
 4JI2 C;  4B3M C;  4JI1 C;  1FUG A;  4DUZ C;  5KYV A;  5LMU C;  4ZJZ A;  1N36 C;  5BSU A;  3VNR A;  4DV2 C;  4JI4 C;  2P2Q A;  3KXW A;  3A4I A;  1N34 C;  4LF5 C;  4GKK C;  2E8C A;  4NDN A;  2DPL A;  2E8F A;  4IR7 A;  2JMP A;  3A9U A;  3I07 A;  1BA3 A;  3VNQ A;  5BST A;  4JI0 C;  5H9U A;  4GKJ C;  4XX2 A;  5KEI A;  2Y4O A;  4I9G A;  2P20 A;  4PHT A;  4RLQ A;  3IPL A;  1LCI A;  3GKU A;  4L2Z A;  4ZLP A;  3NYR A;  1MD9 A;  4DR6 C;  2F4V C;  2P02 A;  2E5L C;  1IBL C;  1IBM C;  2D1T A;  3ETO A;  4DCU A;  3FCE A;  2YWC A;  4NOZ A;  5BSM A;  4R1L A;  5IFI A;  2P2F A;  2QVZ X;  3DLP X;  1YJ7 A;  1HNZ C;  1MDF A;  4LF9 C;  5CZX A;  4DV5 C;  4JV5 C;  5ADZ A;  2OO4 A;  2HJG A;  4OXI A;  5JRH A;  4DR7 C;  5BUR A;  3C5E A;  2PRO A;  3N2Q A;  1MXC A;  1JOS A;  5AE3 A;  3PES A;  1VLA A;  4JI5 C;  2PT7 G;  4ISB A;  3UOW A;  2Y4N A;  5BSV A;  1XNQ C;  1O92 A;  5A1G A;  1PA4 A;  4RVO A;  2HHH C;  2UUA C;  1ZB9 A;  3EER A;  1O90 A;  4D57 A;  3ETC A;  2ASB A;  5E7Q A;  4DV6 C;  4IZ6 A;  2OPL B;  4PZP A;  4ODJ A;  4B3T C;  2UXD C;  2ATW A;  1RY2 A;  4LF7 C;  4L7I A;  2QVX X;  5IT9 D;  2BH1 X;  5T8T A;  3AF5 A;  3RV2 A;  3S82 A;  5CZV A;  4WV3 A;  4NXM C;  5IWA C;  5LMN C;  3J81 D;  3T1H C;  2UXB C;  3TDE A;  2P2B A;  5A1I A;  3H2T A;  2AYA A;  4DCS A;  2CXC A;  5GTD A;  4AQY C;  5A2Q D;  4FUT A;  4JI8 C;  4D56 A;  4LFB C;  1N33 C;  4RVN A;  4BC7 A;  4TPS B;  5A19 A;  5BUS A;  1XNR C;  3UZ0 A;  4L4Q A;  2D27 A;  1HH2 P;  2UXC C;  4LE5 A;  4DV7 C;  4YY3 C;  3AF6 A;  4DR1 C;  3JAM D;  3NYQ A;  2OPL A;  4WS9 A;  4DCV A;  4LFA C;  4OYC A;  1K0R A;  3OTO C;  5KYT A;  2YWB A;  3GPC A;  2YCB A;  4HPV A;  1MDB A;  4LF4 C;  1V25 A;  1IBK C;  3DAY A;  5BSW A;  4DV3 C;  4B3S C;  4DV4 C;  4GXQ A;  4K0B A;  1GPM A;  3NI2 A;  1LQL A;  1MXA A;  5T8S A;  1N32 C;  1ZB8 A;  4LF6 C;  1ULT A;  1UKK A;  1V26 A;  1XMO C;  2BJO A;  3IEU A;  2WD9 A;  3NPD A;  2D1S A;  2UUB C;  2P2J A;  2UUC C;  1XRC A;  4DV0 C;  2D7V A;  1N2F A;  4G37 A;  4DV1 C;  2PN2 A;  3FCC A;  1T5H X;  5K8F A;  2ZM6 C;  3LUS A;  2ONF A;  4U5Y D;  4FTF A;  4K0K C;  1USP B;  1AMU A;  3CW9 A;  4BC9 A;  1HNW C;  2P2M A;  2D28 C;  4DR2 C;  3DHV A;  4X62 C;  2QVY X;  4OX9 C;  3E7X A;  1RG9 A;  4LFC C;  2EGT A;  4KHP C;  2XR1 A;  3CW8 X;  1PG3 A;  3R9X A;  2D1Q A;  3E7W A;  2VQE C;  4D4G A;  3I08 A;  1HR0 C;  1XRB A;  4GS5 A;  4BBY A;  4B3R C;  5AE2 A;  4YHH C;  4I9F A;  4DR5 C;  4KTV A;  3IML A;  4DCT A;  4NXN C;  5BR8 C;  5K85 A;  3CJE A;  1KKG A;  1MXB A;  2VZE A;  3LNV A;  3L95 X;  3L8C A;  4MH4 A;  4RM2 A;  2KZF A;  4JYA C;  1EGA A;  1USP A;  4PRO C;  2DYJ A;  4DR3 C;  4RM3 A;  2OBV A;  4DR4 C;  4X65 C;  3TUF A;  3G7S A;  3R9W A;  2QL8 A;  3VNS A;  4FUQ A;  1O93 A;  1QWI A;  2E8E A;  1XMQ C;  1J5E C;  1MKY A;  2E7G A;  5BUQ A;  3SO4 A;  4JI3 C;  4RLF A;  4MTN A;  3A9V A;  1HNX C;  3GR0 A;  3B7W A;  4RMN A;  4R0M A;  1PG4 A;  4DG8 A;  3GR1 A;  1QM4 A;  3IEV A;  2CY1 A;  5DV9 A;  4G1I A;  3R44 A;  2WP0 C;  3T1Y C;  3PBK A;  4BSZ A;  3J80 D;  3PRO C;  4X64 C;  3N54 B;  4LF8 C;  4DUY C;  2VQF C;  4G36 A;  4X66 C;  4JM1 A;  2E0G A;  2V7B A;  1FJG C;  1I94 C;  1WF3 A;  1XRA A;  5AE1 A;  2Y27 A;  3EQ6 A;  4DG9 A;  4KTT A;  2UU9 C;  4D4I A;  2QW0 X;  1P7L A;  1O9T A;  4R1M A;  4EAT A;  3LGX A;  4GXR A;  3RG2 A;  2D1R A;  4JI7 C;  4BCA A;  3TQI A;  4JI6 C;  3LAX A;  2VSQ A;  1T5D X;  1WH9 A;  5FLX D;  1ML8 A;  5BSR A;  1NYE A;  1L2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...