1MXBA

S-adenosylmethionine synthetase with adp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
total genus 125
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA01
5A19A 4KTVA 1XRBA 1RG9A 5A1IA 1MXBA 4L7IA 3TDEA 1O93A 4L4QA 1MXAA 1O92A 3IMLA 1XRAA 4LE5A 1O9TA 4HPVA 3UOWA 1MXCA 4WS9A 3A4IA 1P7LA 1QM4A 3SO4A 2YWBA 4L2ZA 3TQIA 5A1GA 4K0BA 4ODJA 1XRCA 4NDNA 5T8SA 1O90A 5H9UA 4KTTA 5T8TA 2P02A 3S82A 1GPMA 3RV2A 2YWCA 2OBVA 2DPLA 1FUGA
chains in the Genus database with same CATH superfamily
4ZLPA 5A1IA 4JI0C 3IMLA 3VNQA 2QVZX 2KDNA 1M6XC 3PBKA 3GR1A 1P7LA 2YX1A 1HR0C 4RM2A 1HNXC 2D27A 3S82A 4RMNA 4D57A 2ONFA 2YWCA 1XRBA 2M5HA 3VNSA 5AE2A 4YHHC 4X64C 4OX9C 4B3MC 3RG2A 4DCVA 3DLPX 1BA3A 1M6XA 1UKKA 1MDFA 4KHPC 1AMUA 4RLFA 4PUHA 5KYTA 4DV5C 2Y4OA 3LNVA 2JMPA 2P2JA 5BSTA 2ZZMA 3ETCA 3EERA 1J5EC 2OPLA 3G7SA 1HNWC 1ZB9A 3GR0A 2Y27A 4R1LA 1LCIA 4DV2C 5LCIA 4JI3C 1FLOA 2E7GA 2D1QA 3TUFA 4PROC 3CQ1A 4DR1C 1XNQC 3TDEA 4IZ6A 2UXDC 2OO4A 3L8CA 3UOWA 3CJEA 3NYQA 2NCLA 2UUBC 2D1TA 1IB8A 2DYJA 3GPCA 4ODJA 1N34C 2VQFC 4DG8A 3IPLA 5DV9A 3L95X 1ULTA 2MM9A 2HHHC 3T1HC 4FTFA 1PG3A 2D1SA 1PG4A 3CQ3A 3DHVA 5A19A 3R44A 1KKGA 4LF5C 5E7QA 4L7IA 2D1RA 3IEUA 2UXCC 4DV4C 4G1IA 1XMQC 2OPLB 2VSQA 4FUTA 1V60A 2KZ0A 4BBYA 3A9UA 3AF5A 3N2QA 3B7WA 2V7BA 3GKUA 4OXIA 1I94C 1FUGA 4WV3A 3R9WA 4G37A 4DR4C 3ETOA 2PROA 4R0MA 2UUCC 3KXWA 3K6RA 3TR3A 4I9GA 4DG9A 1V25A 3CW9A 3NI2A 3SO4A 2EGTA 4DR6C 1EGAA 5A1GA 4RVNA 5ADZA 1USPA 1HH2P 1HNZC 4PZPA 2BH1X 3CQ2A 2Y4NA 1IBLC 1MXAA 4GKKC 5IWAC 1T5HX 2D7VA 5K85A 4EATA 5BUQA 1VEHA 4U5YD 4GS5A 4DCTA 4RM3A 2QW0X 4LF4C 4GXRA 1N2FA 4ZJZA 4B3RC 3FCEA 5GTDA 4JI4C 1YJ7A 4LF8C 2QL8A 1K0RA 1JOSA 3N54B 4MTNA 1LQLA 3A25A 3A4IA 4DUZC 4TPSB 4GKJC 4L2ZA 5K8FA 1TH5A 2P02A 4YY3C 1L2FA 2P2MA 1NYEA 1GPMA 3NYRA 2PN2A 4X65C 3I08A 3UX2A 2MCQA 4NOZA 1XMOC 2XR1A 1QWIA 5JRHA 4DR3C 1MDBA 1FJGC 4JI1C 4FUQA 3AF6A 2ZM6C 3E7WA 3DAYA 4LF9C 4NDNA 4X62C 3VNRA 2YCBA 1USPB 5CZVA 4GXQA 4DR2C 3PESA 5CZXA 4JI8C 2CU6A 5BSRA 4BC9A 2MMAB 4JYAC 3O2EA 5IT9D 4PUIA 4X66C 1N33C 4NXNC 2P2FA 3A26A 4K0BA 5IFIA 1XHJA 4DV3C 3J80D 4B3SC 3T1YC 1O9TA 4DCUA 4D4IA 4JI5C 1VLAA 4BC7A 1WF3A 4WS9A 2ASBA 3JAMD 2QVYX 5BSVA 1O90A 3J81D 4PUGA 4JV5C 3R9XA 2AYAA 4NXMC 1N36C 5KEIA 1PU1A 4OYCA 3A9VA 1T5DX 1WH9A 5BUSA 2JNVA 4L4QA 1PA4A 1O92A 2E5LC 4LF7C 4LFCC 2E8FA 2F4VC 4HPVA 3LGXA 3E7XA 5BR8C 2E0GA 1QM4A 2UXBC 3TQIA 1MKYA 1XRCA 5KYVA 2E8CA 2D28C 4LFBC 1RY2A 5A2QD 2BJOA 2WD9A 3LNOA 4MH4A 2CXCA 2HJGA 4K0KC 2PT7G 4KTVA 1V26A 5BSMA 1NY8A 1RG9A 3H2TA 3UX3A 5LMUC 1N32C 5BSWA 2KZFA 2ATWA 1MXCA 4DV7C 4BSZA 4DUYC 4RVOA 5AE1A 5T8TA 2UUAC 2VZEA 2M5OA 4BCAA 2OBVA 2VQEC 4JI7C 4I9FA 1XS3A 4DV1C 1IBMC 1O93A 4ISBA 2Z51A 3PROC 3FCCA 4IR7A 4LF6C 4RLQA 2P2BA 4G36A 3AY0A 2YWBA 5FLXD 2P2QA 1ZB8A 4DCSA 3RV2A 1UWDA 4XX2A 5BURA 2WP0C 3OTOC 3I07A 1P4EA 1MXBA 3EQ6A 4JI6C 3LAXA 4DV0C 5LMNC 3CW8X 1XNRC 4LFAC 2CY1A 5AE3A 4D4GA 3NPDA 3UZ0A 5BSUA 2ZZNA 3C5EA 1WCJA 2DHMA 1IBKC 2E8EA 4DV6C 3UEBA 4AQYC 4JM1A 4PHTA 1XRAA 4LE5A 4R1MA 2UU9C 1ML8A 4D56A 4JI2C 1P4EC 4B3TC 3IEVA 2P20A 5T8SA 5H9UA 3LUSA 4KTTA 2QVXX 1MD9A 4DR5C 4DR7C 2DPLA
chains in the Genus database with same CATH topology
4ZLPA 5A1IA 4JI0C 3IMLA 3VNQA 2QVZX 3PBKA 3GR1A 1P7LA 1HR0C 4RM2A 1HNXC 2D27A 3S82A 4RMNA 4D57A 2ONFA 2YWCA 1XRBA 3VNSA 5AE2A 4YHHC 4X64C 4OX9C 4B3MC 3RG2A 4DCVA 3DLPX 1BA3A 1UKKA 1MDFA 4KHPC 1AMUA 4RLFA 5KYTA 4DV5C 2Y4OA 3LNVA 2JMPA 2P2JA 5BSTA 3ETCA 3EERA 1J5EC 2OPLA 3G7SA 1HNWC 1ZB9A 3GR0A 2Y27A 4R1LA 1LCIA 4DV2C 4JI3C 2E7GA 2D1QA 3TUFA 4PROC 4DR1C 1XNQC 3TDEA 4IZ6A 2UXDC 2OO4A 3L8CA 3UOWA 3CJEA 3NYQA 2UUBC 2D1TA 2DYJA 3GPCA 4ODJA 1N34C 2VQFC 5DV9A 3IPLA 4DG8A 3L95X 1ULTA 2HHHC 3T1HC 4FTFA 1PG3A 2D1SA 1PG4A 3DHVA 5A19A 1KKGA 3R44A 4LF5C 5E7QA 4L7IA 2D1RA 3IEUA 2UXCC 4DV4C 4G1IA 1XMQC 2OPLB 2VSQA 4FUTA 4BBYA 3A9UA 3AF5A 3N2QA 3B7WA 2V7BA 3GKUA 4OXIA 1I94C 1FUGA 4WV3A 3R9WA 4G37A 4DR4C 2UUCC 3ETOA 2PROA 4R0MA 3KXWA 4I9GA 4DG9A 1V25A 3CW9A 3NI2A 3SO4A 2EGTA 4DR6C 1EGAA 5A1GA 4RVNA 5ADZA 1USPA 1HH2P 1HNZC 4PZPA 2BH1X 2Y4NA 1IBLC 1MXAA 4GKKC 5IWAC 1T5HX 2D7VA 5K85A 4EATA 5BUQA 4U5YD 4GS5A 4DCTA 4RM3A 2QW0X 4LF4C 4GXRA 1N2FA 4ZJZA 4B3RC 3FCEA 5GTDA 4JI4C 1YJ7A 4LF8C 2QL8A 1K0RA 1JOSA 3N54B 4MTNA 1LQLA 3A4IA 4DUZC 4TPSB 4GKJC 4L2ZA 5K8FA 2P02A 4YY3C 1L2FA 2P2MA 1NYEA 1GPMA 3NYRA 2PN2A 4X65C 3I08A 4NOZA 1XMOC 2XR1A 1QWIA 5JRHA 4DR3C 1MDBA 1FJGC 4JI1C 4FUQA 3AF6A 2ZM6C 3E7WA 3DAYA 4LF9C 4NDNA 4X62C 3VNRA 2YCBA 1USPB 5CZVA 4GXQA 4DR2C 3PESA 5CZXA 4JI8C 5BSRA 4BC9A 4JYAC 5IT9D 4X66C 1N33C 4NXNC 2P2FA 4K0BA 5IFIA 4DV3C 3J80D 4B3SC 3T1YC 1O9TA 4DCUA 4D4IA 4JI5C 1VLAA 4BC7A 1WF3A 4WS9A 2ASBA 3JAMD 2QVYX 5BSVA 1O90A 3J81D 4JV5C 3R9XA 2AYAA 4NXMC 1N36C 5KEIA 4OYCA 3A9VA 1T5DX 1WH9A 5BUSA 4LF7C 4L4QA 1PA4A 1O92A 2E5LC 4LFCC 2E8FA 2F4VC 4HPVA 3LGXA 3E7XA 5BR8C 2E0GA 1QM4A 2UXBC 3TQIA 1MKYA 1XRCA 5KYVA 2E8CA 2D28C 4LFBC 1RY2A 5A2QD 2BJOA 2WD9A 4MH4A 2CXCA 2HJGA 4K0KC 2PT7G 4KTVA 1V26A 5BSMA 1RG9A 3H2TA 5LMUC 1N32C 5BSWA 2KZFA 2ATWA 1MXCA 4DV7C 4BSZA 4DUYC 4RVOA 5AE1A 5T8TA 2UUAC 2VZEA 4BCAA 2OBVA 2VQEC 4JI7C 4I9FA 4DV1C 1IBMC 1O93A 4ISBA 3PROC 3FCCA 4IR7A 4LF6C 4RLQA 2P2BA 4G36A 2YWBA 5FLXD 2P2QA 1ZB8A 4DCSA 3RV2A 4XX2A 5BURA 2WP0C 3OTOC 3I07A 1MXBA 3EQ6A 4JI6C 3LAXA 4DV0C 5LMNC 3CW8X 1XNRC 4LFAC 2CY1A 5AE3A 4D4GA 3NPDA 3UZ0A 5BSUA 3C5EA 1IBKC 2E8EA 4DV6C 4AQYC 4JM1A 4PHTA 1XRAA 2UU9C 4LE5A 4R1MA 1ML8A 4D56A 4JI2C 4B3TC 3IEVA 2P20A 5T8SA 5H9UA 3LUSA 4KTTA 2QVXX 1MD9A 4DR5C 4DR7C 2DPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A19 A;  4KTV A;  1XRB A;  1RG9 A;  5A1I A;  1MXB A;  4L7I A;  3TDE A;  1O93 A;  4L4Q A;  1MXA A;  1O92 A;  3IML A;  1XRA A;  4LE5 A;  1O9T A;  4HPV A;  3UOW A;  1MXC A;  4WS9 A;  3A4I A;  1P7L A;  1QM4 A;  3SO4 A;  2YWB A;  4L2Z A;  3TQI A;  5A1G A;  4K0B A;  4ODJ A;  1XRC A;  4NDN A;  5T8S A;  1O90 A;  5H9U A;  4KTT A;  5T8T A;  2P02 A;  3S82 A;  1GPM A;  3RV2 A;  2YWC A;  2OBV A;  2DPL A;  1FUG A; 
#chains in the Genus database with same CATH topology
 4ZLP A;  5A1I A;  4JI0 C;  3IML A;  3VNQ A;  2QVZ X;  2KDN A;  1M6X C;  3PBK A;  3GR1 A;  1P7L A;  2YX1 A;  1HR0 C;  4RM2 A;  1HNX C;  2D27 A;  3S82 A;  4RMN A;  4D57 A;  2ONF A;  2YWC A;  1XRB A;  2M5H A;  3VNS A;  5AE2 A;  4YHH C;  4X64 C;  4OX9 C;  4B3M C;  3RG2 A;  4DCV A;  3DLP X;  1BA3 A;  1M6X A;  1UKK A;  1MDF A;  4KHP C;  1AMU A;  4RLF A;  4PUH A;  5KYT A;  4DV5 C;  2Y4O A;  3LNV A;  2JMP A;  2P2J A;  5BST A;  2ZZM A;  3ETC A;  3EER A;  1J5E C;  2OPL A;  3G7S A;  1HNW C;  1ZB9 A;  3GR0 A;  2Y27 A;  4R1L A;  1LCI A;  4DV2 C;  5LCI A;  4JI3 C;  1FLO A;  2E7G A;  2D1Q A;  3TUF A;  4PRO C;  3CQ1 A;  4DR1 C;  1XNQ C;  3TDE A;  4IZ6 A;  2UXD C;  2OO4 A;  3L8C A;  3UOW A;  3CJE A;  3NYQ A;  2NCL A;  2UUB C;  2D1T A;  1IB8 A;  2DYJ A;  3GPC A;  4ODJ A;  1N34 C;  2VQF C;  4DG8 A;  3IPL A;  5DV9 A;  3L95 X;  1ULT A;  2MM9 A;  2HHH C;  3T1H C;  4FTF A;  1PG3 A;  2D1S A;  1PG4 A;  3CQ3 A;  3DHV A;  5A19 A;  3R44 A;  1KKG A;  4LF5 C;  5E7Q A;  4L7I A;  2D1R A;  3IEU A;  2UXC C;  4DV4 C;  4G1I A;  1XMQ C;  2OPL B;  2VSQ A;  4FUT A;  1V60 A;  2KZ0 A;  4BBY A;  3A9U A;  3AF5 A;  3N2Q A;  3B7W A;  2V7B A;  3GKU A;  4OXI A;  1I94 C;  1FUG A;  4WV3 A;  3R9W A;  4G37 A;  4DR4 C;  3ETO A;  2PRO A;  4R0M A;  2UUC C;  3KXW A;  3K6R A;  3TR3 A;  4I9G A;  4DG9 A;  1V25 A;  3CW9 A;  3NI2 A;  3SO4 A;  2EGT A;  4DR6 C;  1EGA A;  5A1G A;  4RVN A;  5ADZ A;  1USP A;  1HH2 P;  1HNZ C;  4PZP A;  2BH1 X;  3CQ2 A;  2Y4N A;  1IBL C;  1MXA A;  4GKK C;  5IWA C;  1T5H X;  2D7V A;  5K85 A;  4EAT A;  5BUQ A;  1VEH A;  4U5Y D;  4GS5 A;  4DCT A;  4RM3 A;  2QW0 X;  4LF4 C;  4GXR A;  1N2F A;  4ZJZ A;  4B3R C;  3FCE A;  5GTD A;  4JI4 C;  1YJ7 A;  4LF8 C;  2QL8 A;  1K0R A;  1JOS A;  3N54 B;  4MTN A;  1LQL A;  3A25 A;  3A4I A;  4DUZ C;  4TPS B;  4GKJ C;  4L2Z A;  5K8F A;  1TH5 A;  2P02 A;  4YY3 C;  1L2F A;  2P2M A;  1NYE A;  1GPM A;  3NYR A;  2PN2 A;  4X65 C;  3I08 A;  3UX2 A;  2MCQ A;  4NOZ A;  1XMO C;  2XR1 A;  1QWI A;  5JRH A;  4DR3 C;  1MDB A;  1FJG C;  4JI1 C;  4FUQ A;  3AF6 A;  2ZM6 C;  3E7W A;  3DAY A;  4LF9 C;  4NDN A;  4X62 C;  3VNR A;  2YCB A;  1USP B;  5CZV A;  4GXQ A;  4DR2 C;  3PES A;  5CZX A;  4JI8 C;  2CU6 A;  5BSR A;  4BC9 A;  2MMA B;  4JYA C;  3O2E A;  5IT9 D;  4PUI A;  4X66 C;  1N33 C;  4NXN C;  2P2F A;  3A26 A;  4K0B A;  5IFI A;  1XHJ A;  4DV3 C;  3J80 D;  4B3S C;  3T1Y C;  1O9T A;  4DCU A;  4D4I A;  4JI5 C;  1VLA A;  4BC7 A;  1WF3 A;  4WS9 A;  2ASB A;  3JAM D;  2QVY X;  5BSV A;  1O90 A;  3J81 D;  4PUG A;  4JV5 C;  3R9X A;  2AYA A;  4NXM C;  1N36 C;  5KEI A;  1PU1 A;  4OYC A;  3A9V A;  1T5D X;  1WH9 A;  5BUS A;  2JNV A;  4L4Q A;  1PA4 A;  1O92 A;  2E5L C;  4LF7 C;  4LFC C;  2E8F A;  2F4V C;  4HPV A;  3LGX A;  3E7X A;  5BR8 C;  2E0G A;  1QM4 A;  2UXB C;  3TQI A;  1MKY A;  1XRC A;  5KYV A;  2E8C A;  2D28 C;  4LFB C;  1RY2 A;  5A2Q D;  2BJO A;  2WD9 A;  3LNO A;  4MH4 A;  2CXC A;  2HJG A;  4K0K C;  2PT7 G;  4KTV A;  1V26 A;  5BSM A;  1NY8 A;  1RG9 A;  3H2T A;  3UX3 A;  5LMU C;  1N32 C;  5BSW A;  2KZF A;  2ATW A;  1MXC A;  4DV7 C;  4BSZ A;  4DUY C;  4RVO A;  5AE1 A;  5T8T A;  2UUA C;  2VZE A;  2M5O A;  4BCA A;  2OBV A;  2VQE C;  4JI7 C;  4I9F A;  1XS3 A;  4DV1 C;  1IBM C;  1O93 A;  4ISB A;  2Z51 A;  3PRO C;  3FCC A;  4IR7 A;  4LF6 C;  4RLQ A;  2P2B A;  4G36 A;  3AY0 A;  2YWB A;  5FLX D;  2P2Q A;  1ZB8 A;  4DCS A;  3RV2 A;  1UWD A;  4XX2 A;  5BUR A;  2WP0 C;  3OTO C;  3I07 A;  1P4E A;  1MXB A;  3EQ6 A;  4JI6 C;  3LAX A;  4DV0 C;  5LMN C;  3CW8 X;  1XNR C;  4LFA C;  2CY1 A;  5AE3 A;  4D4G A;  3NPD A;  3UZ0 A;  5BSU A;  2ZZN A;  3C5E A;  1WCJ A;  2DHM A;  1IBK C;  2E8E A;  4DV6 C;  3UEB A;  4AQY C;  4JM1 A;  4PHT A;  1XRA A;  4LE5 A;  4R1M A;  2UU9 C;  1ML8 A;  4D56 A;  4JI2 C;  1P4E C;  4B3T C;  3IEV A;  2P20 A;  5T8S A;  5H9U A;  3LUS A;  4KTT A;  2QVX X;  1MD9 A;  4DR5 C;  4DR7 C;  2DPL A; 
#chains in the Genus database with same CATH homology
 4ZLP A;  5A1I A;  4JI0 C;  3IML A;  3VNQ A;  2QVZ X;  3PBK A;  3GR1 A;  1P7L A;  1HR0 C;  4RM2 A;  1HNX C;  2D27 A;  3S82 A;  4RMN A;  4D57 A;  2ONF A;  2YWC A;  1XRB A;  3VNS A;  5AE2 A;  4YHH C;  4X64 C;  4OX9 C;  4B3M C;  3RG2 A;  4DCV A;  3DLP X;  1BA3 A;  1UKK A;  1MDF A;  4KHP C;  1AMU A;  4RLF A;  5KYT A;  4DV5 C;  2Y4O A;  3LNV A;  2JMP A;  2P2J A;  5BST A;  3ETC A;  3EER A;  1J5E C;  2OPL A;  3G7S A;  1HNW C;  1ZB9 A;  3GR0 A;  2Y27 A;  4R1L A;  1LCI A;  4DV2 C;  4JI3 C;  2E7G A;  2D1Q A;  3TUF A;  4PRO C;  4DR1 C;  1XNQ C;  3TDE A;  4IZ6 A;  2UXD C;  2OO4 A;  3L8C A;  3UOW A;  3CJE A;  3NYQ A;  2UUB C;  2D1T A;  2DYJ A;  3GPC A;  4ODJ A;  1N34 C;  2VQF C;  5DV9 A;  3IPL A;  4DG8 A;  3L95 X;  1ULT A;  2HHH C;  3T1H C;  4FTF A;  1PG3 A;  2D1S A;  1PG4 A;  3DHV A;  5A19 A;  1KKG A;  3R44 A;  4LF5 C;  5E7Q A;  4L7I A;  2D1R A;  3IEU A;  2UXC C;  4DV4 C;  4G1I A;  1XMQ C;  2OPL B;  2VSQ A;  4FUT A;  4BBY A;  3A9U A;  3AF5 A;  3N2Q A;  3B7W A;  2V7B A;  3GKU A;  4OXI A;  1I94 C;  1FUG A;  4WV3 A;  3R9W A;  4G37 A;  4DR4 C;  2UUC C;  3ETO A;  2PRO A;  4R0M A;  3KXW A;  4I9G A;  4DG9 A;  1V25 A;  3CW9 A;  3NI2 A;  3SO4 A;  2EGT A;  4DR6 C;  1EGA A;  5A1G A;  4RVN A;  5ADZ A;  1USP A;  1HH2 P;  1HNZ C;  4PZP A;  2BH1 X;  2Y4N A;  1IBL C;  1MXA A;  4GKK C;  5IWA C;  1T5H X;  2D7V A;  5K85 A;  4EAT A;  5BUQ A;  4U5Y D;  4GS5 A;  4DCT A;  4RM3 A;  2QW0 X;  4LF4 C;  4GXR A;  1N2F A;  4ZJZ A;  4B3R C;  3FCE A;  5GTD A;  4JI4 C;  1YJ7 A;  4LF8 C;  2QL8 A;  1K0R A;  1JOS A;  3N54 B;  4MTN A;  1LQL A;  3A4I A;  4DUZ C;  4TPS B;  4GKJ C;  4L2Z A;  5K8F A;  2P02 A;  4YY3 C;  1L2F A;  2P2M A;  1NYE A;  1GPM A;  3NYR A;  2PN2 A;  4X65 C;  3I08 A;  4NOZ A;  1XMO C;  2XR1 A;  1QWI A;  5JRH A;  4DR3 C;  1MDB A;  1FJG C;  4JI1 C;  4FUQ A;  3AF6 A;  2ZM6 C;  3E7W A;  3DAY A;  4LF9 C;  4NDN A;  4X62 C;  3VNR A;  2YCB A;  1USP B;  5CZV A;  4GXQ A;  4DR2 C;  3PES A;  5CZX A;  4JI8 C;  5BSR A;  4BC9 A;  4JYA C;  5IT9 D;  4X66 C;  1N33 C;  4NXN C;  2P2F A;  4K0B A;  5IFI A;  4DV3 C;  3J80 D;  4B3S C;  3T1Y C;  1O9T A;  4DCU A;  4D4I A;  4JI5 C;  1VLA A;  4BC7 A;  1WF3 A;  4WS9 A;  2ASB A;  3JAM D;  2QVY X;  5BSV A;  1O90 A;  3J81 D;  4JV5 C;  3R9X A;  2AYA A;  4NXM C;  1N36 C;  5KEI A;  4OYC A;  3A9V A;  1T5D X;  1WH9 A;  5BUS A;  4LF7 C;  4L4Q A;  1PA4 A;  1O92 A;  2E5L C;  4LFC C;  2E8F A;  2F4V C;  4HPV A;  3LGX A;  3E7X A;  5BR8 C;  2E0G A;  1QM4 A;  2UXB C;  3TQI A;  1MKY A;  1XRC A;  5KYV A;  2E8C A;  2D28 C;  4LFB C;  1RY2 A;  5A2Q D;  2BJO A;  2WD9 A;  4MH4 A;  2CXC A;  2HJG A;  4K0K C;  2PT7 G;  4KTV A;  1V26 A;  5BSM A;  1RG9 A;  3H2T A;  5LMU C;  1N32 C;  5BSW A;  2KZF A;  2ATW A;  1MXC A;  4DV7 C;  4BSZ A;  4DUY C;  4RVO A;  5AE1 A;  5T8T A;  2UUA C;  2VZE A;  4BCA A;  2OBV A;  2VQE C;  4JI7 C;  4I9F A;  4DV1 C;  1IBM C;  1O93 A;  4ISB A;  3PRO C;  3FCC A;  4IR7 A;  4LF6 C;  4RLQ A;  2P2B A;  4G36 A;  2YWB A;  5FLX D;  2P2Q A;  1ZB8 A;  4DCS A;  3RV2 A;  4XX2 A;  5BUR A;  2WP0 C;  3OTO C;  3I07 A;  1MXB A;  3EQ6 A;  4JI6 C;  3LAX A;  4DV0 C;  5LMN C;  3CW8 X;  1XNR C;  4LFA C;  2CY1 A;  5AE3 A;  4D4G A;  3NPD A;  3UZ0 A;  5BSU A;  3C5E A;  1IBK C;  2E8E A;  4DV6 C;  4AQY C;  4JM1 A;  4PHT A;  1XRA A;  2UU9 C;  4LE5 A;  4R1M A;  1ML8 A;  4D56 A;  4JI2 C;  4B3T C;  3IEV A;  2P20 A;  5T8S A;  5H9U A;  3LUS A;  4KTT A;  2QVX X;  1MD9 A;  4DR5 C;  4DR7 C;  2DPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...