1MXBA

S-adenosylmethionine synthetase with adp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
total genus 125
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA01
4L4QA 5A19A 3SO4A 1XRCA 1MXCA 3S82A 3TQIA 1XRAA 2YWCA 5A1IA 4KTVA 4NDNA 1O92A 5H9UA 4KTTA 4LE5A 4WS9A 1FUGA 4HPVA 4L7IA 3TDEA 3UOWA 2DPLA 1MXAA 1RG9A 2YWBA 4L2ZA 2OBVA 5T8SA 1MXBA 5A1GA 3IMLA 3A4IA 1O93A 2P02A 1O9TA 1QM4A 5T8TA 1O90A 4ODJA 1XRBA 1GPMA 3RV2A 1P7LA 4K0BA
chains in the Genus database with same CATH superfamily
2VQFC 4NOZA 1HNXC 3AY0A 1XMOC 2MMAB 3CW9A 5AE3A 4LFBC 3T1YC 5JRHA 3R9XA 5H9UA 4KTTA 2QVYX 3LNOA 2E8CA 3UZ0A 4L7IA 4GS5A 1MD9A 2E8EA 1O93A 5KEIA 1ZB9A 2D27A 3CQ3A 1UKKA 4DV3C 5BR8C 4B3RC 1N34C 2KZFA 2UUAC 4BSZA 3A26A 3SO4A 4DV4C 2OPLA 2ATWA 3IEUA 1J5EC 5CZXA 5IT9D 4XX2A 2UU9C 2AYAA 3UEBA 4LFAC 1M6XA 4DCSA 4GXRA 3NYRA 3RV2A 3AF5A 2CU6A 4U5YD 4RLQA 4G37A 4I9FA 4JV5C 5A1IA 4KTVA 3GPCA 3NYQA 3A9UA 1YJ7A 2P2JA 4DR7C 2E8FA 3ETCA 2CY1A 3PESA 4DCVA 4DCUA 2UXCC 4RVNA 3UX3A 4ODJA 3CQ1A 3R44A 1N33C 1TH5A 4PHTA 2JNVA 5BUQA 5ADZA 2D7VA 1UWDA 4JI4C 3JAMD 5A2QD 4DG8A 3DHVA 4JI2C 1P4EA 4R1MA 4PUGA 4JI5C 2P2MA 1IB8A 3IMLA 1USPB 5T8TA 4RVOA 1ULTA 5K8FA 3KXWA 2E7GA 5FLXD 1GPMA 2QL8A 1QWIA 4JI8C 4DV7C 4X65C 5IWAC 2E5LC 3ETOA 5BSVA 1XS3A 4LE5A 4DV1C 1ZB8A 4FUQA 4RMNA 4LF6C 3UX2A 1V25A 1V60A 4D57A 1HNZC 1EGAA 2Y4OA 4JYAC 4DV5C 3DLPX 1LQLA 2P2FA 2ZM6C 2NCLA 1M6XC 3LGXA 2VZEA 1JOSA 3TDEA 2DPLA 3I08A 4GKJC 4L2ZA 4YY3C 1K0RA 1O9TA 2P02A 1AMUA 4PZPA 4B3SC 4K0BA 4PUIA 3GR1A 5A19A 3TR3A 2E0GA 3N54B 3IEVA 2BH1X 4R1LA 4BC9A 3UOWA 4LF4C 4JM1A 2OBVA 3J81D 2QVZX 1XMQC 1XNQC 5DV9A 3EERA 1IBMC 2BJOA 2YCBA 1LCIA 3TQIA 1MDFA 1XRCA 4KHPC 4NXNC 2OO4A 1IBLC 4BCAA 4DV0C 4MH4A 1HR0C 2KZ0A 3CJEA 5CZVA 2P2BA 2ASBA 3CW8X 2DYJA 2M5OA 2YWBA 3DAYA 4DR2C 4D4IA 3PROC 1VLAA 1VEHA 1I94C 2ONFA 4JI6C 4BBYA 4MTNA 4RLFA 4LF5C 4BC7A 2HJGA 2UXDC 4ISBA 3L8CA 4D4GA 5KYVA 3VNRA 4D56A 2V7BA 4RM2A 5E7QA 4G1IA 2WD9A 5BUSA 4ZLPA 4GKKC 1T5HX 3VNQA 4DR5C 4DUYC 2MCQA 4YHHC 4R0MA 1FJGC 2P20A 3GKUA 1PA4A 1WF3A 5LCIA 3N2QA 5LMNC 2CXCA 3R9WA 3S82A 1HH2P 1XRAA 1KKGA 2D1RA 1T5DX 1WCJA 3EQ6A 5T8SA 1PU1A 5A1GA 3CQ2A 4NXMC 3AF6A 3L95X 2Y4NA 3IPLA 4DUZC 1V26A 5K85A 2Y27A 4L4QA 4LF7C 4ZJZA 2HHHC 3E7XA 2VQEC 5BSUA 5LMUC 4WS9A 4LF9C 2D28C 5BSRA 1HNWC 4JI1C 1XHJA 3A4IA 4X66C 4WV3A 4JI7C 2F4VC 1XRBA 4PROC 3LAXA 2Z51A 4IZ6A 2EGTA 4FTFA 3E7WA 1USPA 1N2FA 2YWCA 4RM3A 1O92A 2M5HA 1L2FA 2MM9A 1P4EC 3J80D 1O90A 4G36A 1WH9A 1P7LA 2PN2A 3FCCA 2ZZNA 4TPSB 4DV2C 5BSWA 1NY8A 4DR1C 1N32C 5KYTA 4LFCC 2UUCC 1BA3A 4OX9C 5BSTA 4DR4C 2YX1A 4DR3C 4DCTA 2D1SA 1MXAA 1RG9A 3PBKA 1ML8A 3A25A 3LUSA 5AE2A 4LF8C 1IBKC 2D1QA 2XR1A 3RG2A 3LNVA 3K6RA 4K0KC 2UUBC 3GR0A 4IR7A 1MKYA 1MXCA 5BSMA 2VSQA 4NDNA 2OPLB 3NI2A 3OTOC 1PG3A 4DV6C 5GTDA 1QM4A 1FLOA 4X64C 2JMPA 2KDNA 2WP0C 4JI3C 1XNRC 5AE1A 2P2QA 3B7WA 2ZZMA 4AQYC 4JI0C 4B3MC 4GXQA 1PG4A 1MDBA 4HPVA 2PROA 2UXBC 4X62C 3TUFA 3FCEA 4OYCA 1NYEA 4EATA 3NPDA 3T1HC 2PT7G 4PUHA 3G7SA 3VNSA 4DR6C 5IFIA 4B3TC 1N36C 2QW0X 2QVXX 1FUGA 3I07A 4I9GA 1RY2A 2DHMA 4FUTA 4DG9A 3H2TA 2D1TA 3A9VA 1MXBA 5BURA 3O2EA 4OXIA 3C5EA
chains in the Genus database with same CATH topology
2VQFC 4NOZA 1HNXC 1XMOC 3CW9A 5AE3A 4LFBC 3T1YC 5JRHA 3R9XA 5H9UA 4KTTA 2QVYX 2E8CA 3UZ0A 4L7IA 4GS5A 1MD9A 2E8EA 1O93A 5KEIA 1ZB9A 2D27A 1UKKA 4DV3C 5BR8C 4B3RC 1N34C 2KZFA 2UUAC 4BSZA 3SO4A 4DV4C 2OPLA 2ATWA 3IEUA 1J5EC 5CZXA 5IT9D 4XX2A 2UU9C 2AYAA 4LFAC 4DCSA 4GXRA 3NYRA 3RV2A 3AF5A 4U5YD 4RLQA 4G37A 4I9FA 4JV5C 5A1IA 4KTVA 3GPCA 3NYQA 3A9UA 1YJ7A 2P2JA 4DR7C 2E8FA 3ETCA 2CY1A 3PESA 4DCVA 4DCUA 2UXCC 4RVNA 4ODJA 3R44A 1N33C 4PHTA 5BUQA 5ADZA 2D7VA 4JI4C 3JAMD 5A2QD 4DG8A 3DHVA 4JI2C 4R1MA 4JI5C 2P2MA 3IMLA 1USPB 5T8TA 4RVOA 1ULTA 5K8FA 3KXWA 2E7GA 5FLXD 1GPMA 2QL8A 4JI8C 1QWIA 4DV7C 4X65C 5IWAC 2E5LC 3ETOA 5BSVA 4LE5A 4DV1C 1ZB8A 4FUQA 4RMNA 4LF6C 1V25A 4D57A 1HNZC 1EGAA 2Y4OA 4JYAC 4DV5C 3DLPX 1LQLA 2P2FA 2ZM6C 3LGXA 2VZEA 1JOSA 3TDEA 2DPLA 3I08A 4GKJC 4L2ZA 4YY3C 1K0RA 1O9TA 2P02A 1AMUA 4PZPA 4B3SC 4K0BA 3GR1A 5A19A 2E0GA 3N54B 3IEVA 2BH1X 4R1LA 4BC9A 3UOWA 4LF4C 4JM1A 2OBVA 3J81D 2QVZX 1XMQC 1XNQC 5DV9A 3EERA 1IBMC 2BJOA 2YCBA 1LCIA 3TQIA 1MDFA 1XRCA 4KHPC 4NXNC 2OO4A 1IBLC 4BCAA 4DV0C 4MH4A 1HR0C 3CJEA 5CZVA 2P2BA 2ASBA 3CW8X 2DYJA 2YWBA 3DAYA 4DR2C 4D4IA 3PROC 1VLAA 1I94C 2ONFA 4JI6C 4BBYA 4MTNA 4RLFA 4LF5C 4BC7A 2HJGA 2UXDC 4ISBA 3L8CA 4D4GA 5KYVA 3VNRA 4D56A 2V7BA 4RM2A 5E7QA 4G1IA 2WD9A 5BUSA 4ZLPA 4GKKC 1T5HX 3VNQA 4DR5C 4DUYC 4YHHC 4R0MA 1FJGC 2P20A 3GKUA 1PA4A 1WF3A 3N2QA 5LMNC 2CXCA 3R9WA 3S82A 1HH2P 1XRAA 1KKGA 2D1RA 1T5DX 3EQ6A 5T8SA 5A1GA 4NXMC 3AF6A 3L95X 2Y4NA 3IPLA 4DUZC 1V26A 5K85A 2Y27A 4L4QA 4LF7C 4ZJZA 2HHHC 3E7XA 2VQEC 5BSUA 5LMUC 4LF9C 4WS9A 2D28C 5BSRA 1HNWC 4JI1C 3A4IA 4X66C 4WV3A 4JI7C 2F4VC 1XRBA 4PROC 3LAXA 4IZ6A 2EGTA 4FTFA 3E7WA 1USPA 1N2FA 2YWCA 4RM3A 1O92A 1L2FA 3J80D 1O90A 4G36A 1WH9A 1P7LA 2PN2A 3FCCA 4TPSB 4DV2C 5BSWA 4DR1C 1N32C 5KYTA 4LFCC 2UUCC 1BA3A 4OX9C 5BSTA 4DR4C 4DR3C 4DCTA 2D1SA 1MXAA 1RG9A 3PBKA 1ML8A 3LUSA 5AE2A 4LF8C 1IBKC 2D1QA 2XR1A 3RG2A 3LNVA 4K0KC 2UUBC 3GR0A 4IR7A 1MKYA 1MXCA 5BSMA 2VSQA 4NDNA 2OPLB 3NI2A 3OTOC 1PG3A 4DV6C 5GTDA 1QM4A 4X64C 2JMPA 2WP0C 4JI3C 1XNRC 5AE1A 2P2QA 3B7WA 4AQYC 4JI0C 4B3MC 4GXQA 1PG4A 1MDBA 4HPVA 2PROA 2UXBC 4X62C 3TUFA 3FCEA 4OYCA 1NYEA 4EATA 3NPDA 3T1HC 2PT7G 3G7SA 3VNSA 4DR6C 5IFIA 4B3TC 1N36C 2QW0X 2QVXX 1FUGA 3I07A 4I9GA 1RY2A 4FUTA 4DG9A 3H2TA 2D1TA 3A9VA 1MXBA 5BURA 4OXIA 3C5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L4Q A;  5A19 A;  3SO4 A;  1XRC A;  1MXC A;  3S82 A;  3TQI A;  1XRA A;  2YWC A;  5A1I A;  4KTV A;  4NDN A;  1O92 A;  5H9U A;  4KTT A;  4LE5 A;  4WS9 A;  1FUG A;  4HPV A;  4L7I A;  3TDE A;  3UOW A;  2DPL A;  1MXA A;  1RG9 A;  2YWB A;  4L2Z A;  2OBV A;  5T8S A;  1MXB A;  5A1G A;  3IML A;  3A4I A;  1O93 A;  2P02 A;  1O9T A;  1QM4 A;  5T8T A;  1O90 A;  4ODJ A;  1XRB A;  1GPM A;  3RV2 A;  1P7L A;  4K0B A; 
#chains in the Genus database with same CATH topology
 2VQF C;  4NOZ A;  1HNX C;  3AY0 A;  1XMO C;  2MMA B;  3CW9 A;  5AE3 A;  4LFB C;  3T1Y C;  5JRH A;  3R9X A;  5H9U A;  4KTT A;  2QVY X;  3LNO A;  2E8C A;  3UZ0 A;  4L7I A;  4GS5 A;  1MD9 A;  2E8E A;  1O93 A;  5KEI A;  1ZB9 A;  2D27 A;  3CQ3 A;  1UKK A;  4DV3 C;  5BR8 C;  4B3R C;  1N34 C;  2KZF A;  2UUA C;  4BSZ A;  3A26 A;  3SO4 A;  4DV4 C;  2OPL A;  2ATW A;  3IEU A;  1J5E C;  5CZX A;  5IT9 D;  4XX2 A;  2UU9 C;  2AYA A;  3UEB A;  4LFA C;  1M6X A;  4DCS A;  4GXR A;  3NYR A;  3RV2 A;  3AF5 A;  2CU6 A;  4U5Y D;  4RLQ A;  4G37 A;  4I9F A;  4JV5 C;  5A1I A;  4KTV A;  3GPC A;  3NYQ A;  3A9U A;  1YJ7 A;  2P2J A;  4DR7 C;  2E8F A;  3ETC A;  2CY1 A;  3PES A;  4DCV A;  4DCU A;  2UXC C;  4RVN A;  3UX3 A;  4ODJ A;  3CQ1 A;  3R44 A;  1N33 C;  1TH5 A;  4PHT A;  2JNV A;  5BUQ A;  5ADZ A;  2D7V A;  1UWD A;  4JI4 C;  3JAM D;  5A2Q D;  4DG8 A;  3DHV A;  4JI2 C;  1P4E A;  4R1M A;  4PUG A;  4JI5 C;  2P2M A;  1IB8 A;  3IML A;  1USP B;  5T8T A;  4RVO A;  1ULT A;  5K8F A;  3KXW A;  2E7G A;  5FLX D;  1GPM A;  2QL8 A;  1QWI A;  4JI8 C;  4DV7 C;  4X65 C;  5IWA C;  2E5L C;  3ETO A;  5BSV A;  1XS3 A;  4LE5 A;  4DV1 C;  1ZB8 A;  4FUQ A;  4RMN A;  4LF6 C;  3UX2 A;  1V25 A;  1V60 A;  4D57 A;  1HNZ C;  1EGA A;  2Y4O A;  4JYA C;  4DV5 C;  3DLP X;  1LQL A;  2P2F A;  2ZM6 C;  2NCL A;  1M6X C;  3LGX A;  2VZE A;  1JOS A;  3TDE A;  2DPL A;  3I08 A;  4GKJ C;  4L2Z A;  4YY3 C;  1K0R A;  1O9T A;  2P02 A;  1AMU A;  4PZP A;  4B3S C;  4K0B A;  4PUI A;  3GR1 A;  5A19 A;  3TR3 A;  2E0G A;  3N54 B;  3IEV A;  2BH1 X;  4R1L A;  4BC9 A;  3UOW A;  4LF4 C;  4JM1 A;  2OBV A;  3J81 D;  2QVZ X;  1XMQ C;  1XNQ C;  5DV9 A;  3EER A;  1IBM C;  2BJO A;  2YCB A;  1LCI A;  3TQI A;  1MDF A;  1XRC A;  4KHP C;  4NXN C;  2OO4 A;  1IBL C;  4BCA A;  4DV0 C;  4MH4 A;  1HR0 C;  2KZ0 A;  3CJE A;  5CZV A;  2P2B A;  2ASB A;  3CW8 X;  2DYJ A;  2M5O A;  2YWB A;  3DAY A;  4DR2 C;  4D4I A;  3PRO C;  1VLA A;  1VEH A;  1I94 C;  2ONF A;  4JI6 C;  4BBY A;  4MTN A;  4RLF A;  4LF5 C;  4BC7 A;  2HJG A;  2UXD C;  4ISB A;  3L8C A;  4D4G A;  5KYV A;  3VNR A;  4D56 A;  2V7B A;  4RM2 A;  5E7Q A;  4G1I A;  2WD9 A;  5BUS A;  4ZLP A;  4GKK C;  1T5H X;  3VNQ A;  4DR5 C;  4DUY C;  2MCQ A;  4YHH C;  4R0M A;  1FJG C;  2P20 A;  3GKU A;  1PA4 A;  1WF3 A;  5LCI A;  3N2Q A;  5LMN C;  2CXC A;  3R9W A;  3S82 A;  1HH2 P;  1XRA A;  1KKG A;  2D1R A;  1T5D X;  1WCJ A;  3EQ6 A;  5T8S A;  1PU1 A;  5A1G A;  3CQ2 A;  4NXM C;  3AF6 A;  3L95 X;  2Y4N A;  3IPL A;  4DUZ C;  1V26 A;  5K85 A;  2Y27 A;  4L4Q A;  4LF7 C;  4ZJZ A;  2HHH C;  3E7X A;  2VQE C;  5BSU A;  5LMU C;  4WS9 A;  4LF9 C;  2D28 C;  5BSR A;  1HNW C;  4JI1 C;  1XHJ A;  3A4I A;  4X66 C;  4WV3 A;  4JI7 C;  2F4V C;  1XRB A;  4PRO C;  3LAX A;  2Z51 A;  4IZ6 A;  2EGT A;  4FTF A;  3E7W A;  1USP A;  1N2F A;  2YWC A;  4RM3 A;  1O92 A;  2M5H A;  1L2F A;  2MM9 A;  1P4E C;  3J80 D;  1O90 A;  4G36 A;  1WH9 A;  1P7L A;  2PN2 A;  3FCC A;  2ZZN A;  4TPS B;  4DV2 C;  5BSW A;  1NY8 A;  4DR1 C;  1N32 C;  5KYT A;  4LFC C;  2UUC C;  1BA3 A;  4OX9 C;  5BST A;  4DR4 C;  2YX1 A;  4DR3 C;  4DCT A;  2D1S A;  1MXA A;  1RG9 A;  3PBK A;  1ML8 A;  3A25 A;  3LUS A;  5AE2 A;  4LF8 C;  1IBK C;  2D1Q A;  2XR1 A;  3RG2 A;  3LNV A;  3K6R A;  4K0K C;  2UUB C;  3GR0 A;  4IR7 A;  1MKY A;  1MXC A;  5BSM A;  2VSQ A;  4NDN A;  2OPL B;  3NI2 A;  3OTO C;  1PG3 A;  4DV6 C;  5GTD A;  1QM4 A;  1FLO A;  4X64 C;  2JMP A;  2KDN A;  2WP0 C;  4JI3 C;  1XNR C;  5AE1 A;  2P2Q A;  3B7W A;  2ZZM A;  4AQY C;  4JI0 C;  4B3M C;  4GXQ A;  1PG4 A;  1MDB A;  4HPV A;  2PRO A;  2UXB C;  4X62 C;  3TUF A;  3FCE A;  4OYC A;  1NYE A;  4EAT A;  3NPD A;  3T1H C;  2PT7 G;  4PUH A;  3G7S A;  3VNS A;  4DR6 C;  5IFI A;  4B3T C;  1N36 C;  2QW0 X;  2QVX X;  1FUG A;  3I07 A;  4I9G A;  1RY2 A;  2DHM A;  4FUT A;  4DG9 A;  3H2T A;  2D1T A;  3A9V A;  1MXB A;  5BUR A;  3O2E A;  4OXI A;  3C5E A; 
#chains in the Genus database with same CATH homology
 2VQF C;  4NOZ A;  1HNX C;  1XMO C;  3CW9 A;  5AE3 A;  4LFB C;  3T1Y C;  5JRH A;  3R9X A;  5H9U A;  4KTT A;  2QVY X;  2E8C A;  3UZ0 A;  4L7I A;  4GS5 A;  1MD9 A;  2E8E A;  1O93 A;  5KEI A;  1ZB9 A;  2D27 A;  1UKK A;  4DV3 C;  5BR8 C;  4B3R C;  1N34 C;  2KZF A;  2UUA C;  4BSZ A;  3SO4 A;  4DV4 C;  2OPL A;  2ATW A;  3IEU A;  1J5E C;  5CZX A;  5IT9 D;  4XX2 A;  2UU9 C;  2AYA A;  4LFA C;  4DCS A;  4GXR A;  3NYR A;  3RV2 A;  3AF5 A;  4U5Y D;  4RLQ A;  4G37 A;  4I9F A;  4JV5 C;  5A1I A;  4KTV A;  3GPC A;  3NYQ A;  3A9U A;  1YJ7 A;  2P2J A;  4DR7 C;  2E8F A;  3ETC A;  2CY1 A;  3PES A;  4DCV A;  4DCU A;  2UXC C;  4RVN A;  4ODJ A;  3R44 A;  1N33 C;  4PHT A;  5BUQ A;  5ADZ A;  2D7V A;  4JI4 C;  3JAM D;  5A2Q D;  4DG8 A;  3DHV A;  4JI2 C;  4R1M A;  4JI5 C;  2P2M A;  3IML A;  1USP B;  5T8T A;  4RVO A;  1ULT A;  5K8F A;  3KXW A;  2E7G A;  5FLX D;  1GPM A;  2QL8 A;  4JI8 C;  1QWI A;  4DV7 C;  4X65 C;  5IWA C;  2E5L C;  3ETO A;  5BSV A;  4LE5 A;  4DV1 C;  1ZB8 A;  4FUQ A;  4RMN A;  4LF6 C;  1V25 A;  4D57 A;  1HNZ C;  1EGA A;  2Y4O A;  4JYA C;  4DV5 C;  3DLP X;  1LQL A;  2P2F A;  2ZM6 C;  3LGX A;  2VZE A;  1JOS A;  3TDE A;  2DPL A;  3I08 A;  4GKJ C;  4L2Z A;  4YY3 C;  1K0R A;  1O9T A;  2P02 A;  1AMU A;  4PZP A;  4B3S C;  4K0B A;  3GR1 A;  5A19 A;  2E0G A;  3N54 B;  3IEV A;  2BH1 X;  4R1L A;  4BC9 A;  3UOW A;  4LF4 C;  4JM1 A;  2OBV A;  3J81 D;  2QVZ X;  1XMQ C;  1XNQ C;  5DV9 A;  3EER A;  1IBM C;  2BJO A;  2YCB A;  1LCI A;  3TQI A;  1MDF A;  1XRC A;  4KHP C;  4NXN C;  2OO4 A;  1IBL C;  4BCA A;  4DV0 C;  4MH4 A;  1HR0 C;  3CJE A;  5CZV A;  2P2B A;  2ASB A;  3CW8 X;  2DYJ A;  2YWB A;  3DAY A;  4DR2 C;  4D4I A;  3PRO C;  1VLA A;  1I94 C;  2ONF A;  4JI6 C;  4BBY A;  4MTN A;  4RLF A;  4LF5 C;  4BC7 A;  2HJG A;  2UXD C;  4ISB A;  3L8C A;  4D4G A;  5KYV A;  3VNR A;  4D56 A;  2V7B A;  4RM2 A;  5E7Q A;  4G1I A;  2WD9 A;  5BUS A;  4ZLP A;  4GKK C;  1T5H X;  3VNQ A;  4DR5 C;  4DUY C;  4YHH C;  4R0M A;  1FJG C;  2P20 A;  3GKU A;  1PA4 A;  1WF3 A;  3N2Q A;  5LMN C;  2CXC A;  3R9W A;  3S82 A;  1HH2 P;  1XRA A;  1KKG A;  2D1R A;  1T5D X;  3EQ6 A;  5T8S A;  5A1G A;  4NXM C;  3AF6 A;  3L95 X;  2Y4N A;  3IPL A;  4DUZ C;  1V26 A;  5K85 A;  2Y27 A;  4L4Q A;  4LF7 C;  4ZJZ A;  2HHH C;  3E7X A;  2VQE C;  5BSU A;  5LMU C;  4LF9 C;  4WS9 A;  2D28 C;  5BSR A;  1HNW C;  4JI1 C;  3A4I A;  4X66 C;  4WV3 A;  4JI7 C;  2F4V C;  1XRB A;  4PRO C;  3LAX A;  4IZ6 A;  2EGT A;  4FTF A;  3E7W A;  1USP A;  1N2F A;  2YWC A;  4RM3 A;  1O92 A;  1L2F A;  3J80 D;  1O90 A;  4G36 A;  1WH9 A;  1P7L A;  2PN2 A;  3FCC A;  4TPS B;  4DV2 C;  5BSW A;  4DR1 C;  1N32 C;  5KYT A;  4LFC C;  2UUC C;  1BA3 A;  4OX9 C;  5BST A;  4DR4 C;  4DR3 C;  4DCT A;  2D1S A;  1MXA A;  1RG9 A;  3PBK A;  1ML8 A;  3LUS A;  5AE2 A;  4LF8 C;  1IBK C;  2D1Q A;  2XR1 A;  3RG2 A;  3LNV A;  4K0K C;  2UUB C;  3GR0 A;  4IR7 A;  1MKY A;  1MXC A;  5BSM A;  2VSQ A;  4NDN A;  2OPL B;  3NI2 A;  3OTO C;  1PG3 A;  4DV6 C;  5GTD A;  1QM4 A;  4X64 C;  2JMP A;  2WP0 C;  4JI3 C;  1XNR C;  5AE1 A;  2P2Q A;  3B7W A;  4AQY C;  4JI0 C;  4B3M C;  4GXQ A;  1PG4 A;  1MDB A;  4HPV A;  2PRO A;  2UXB C;  4X62 C;  3TUF A;  3FCE A;  4OYC A;  1NYE A;  4EAT A;  3NPD A;  3T1H C;  2PT7 G;  3G7S A;  3VNS A;  4DR6 C;  5IFI A;  4B3T C;  1N36 C;  2QW0 X;  2QVX X;  1FUG A;  3I07 A;  4I9G A;  1RY2 A;  4FUT A;  4DG9 A;  3H2T A;  2D1T A;  3A9V A;  1MXB A;  5BUR A;  4OXI A;  3C5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...