1MXBA

S-adenosylmethionine synthetase with adp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
Knots found
sequence length
383
structure length
377
Chain Sequence
b'AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
total genus 125
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxbA01
4L7IA 3A4IA 1RG9A 5T8SA 1O93A 5T8TA 3UOWA 1QM4A 2DPLA 1O92A 3TDEA 1MXAA 5A19A 4L2ZA 1MXCA 5A1IA 1FUGA 4HPVA 1P7LA 2P02A 1XRCA 2YWCA 2YWBA 1GPMA 4K0BA 3IMLA 4WS9A 4NDNA 2OBVA 3S82A 3TQIA 3SO4A 4LE5A 1XRAA 1MXBA 4L4QA 4KTTA 1O90A 4ODJA 5A1GA 1XRBA 1O9TA 5H9UA 4KTVA 3RV2A
chains in the Genus database with same CATH superfamily
2CXCA 1HH2P 1HNZC 2Y4OA 3ETOA 5A1IA 2VSQA 1WCJA 1XRCA 3LNOA 1XMOC 4G37A 4DR7C 2JNVA 2MM9A 4XX2A 4DCUA 1O90A 4JI1C 5BUQA 4RVNA 3T1YC 2QVZX 3LAXA 4BCAA 3GKUA 1J5EC 3UZ0A 3DLPX 4NXNC 1N34C 4FUQA 4R1MA 3G7SA 2NCLA 2ONFA 2AYAA 2Y4NA 3IMLA 4WS9A 5JRHA 4DG8A 2UU9C 2WD9A 4EATA 3AF6A 2QVXX 2UXBC 1LQLA 2PT7G 1ULTA 3CJEA 4LFCC 2D1RA 4GKKC 1XRBA 4DUYC 1FJGC 4BC9A 4PUGA 2KZ0A 2PN2A 1BA3A 1FLOA 4LF8C 1P7LA 2F4VC 1LCIA 4DR2C 1USPA 4K0BA 3NI2A 2UUCC 1PU1A 1MXBA 3FCCA 2D27A 3NYQA 4LF5C 2VZEA 3CQ3A 3JAMD 1P4EC 5A2QD 3A4IA 1O93A 2EGTA 5FLXD 1M6XA 4D4IA 3CQ1A 4JI3C 2D1TA 3UX2A 4I9GA 1XHJA 4DV6C 4DR3C 4B3RC 5CZXA 3B7WA 5BSWA 4DR5C 4JI2C 3I07A 1MXAA 4OX9C 2YWBA 4GS5A 4OYCA 4BC7A 3VNRA 2P2QA 5BSMA 1RG9A 5LMNC 2ZZMA 3UOWA 3CW8X 3AF5A 4PUHA 1QM4A 2P2JA 2M5HA 2DPLA 2E8FA 3E7WA 4L2ZA 2YX1A 4I9FA 1VEHA 3L8CA 4YHHC 1QWIA 2E5LC 2M5OA 1MDFA 2P2FA 4YY3C 4GXQA 4L4QA 3TUFA 4IR7A 4BSZA 2BJOA 3CW9A 5BSRA 2VQEC 2P2MA 4JM1A 1NYEA 3LNVA 5LMUC 4GKJC 1IBMC 4KTVA 3TR3A 3IEVA 1N36C 4DG9A 4DUZC 1XS3A 4KHPC 2OPLA 3R9XA 4WV3A 1MXCA 3DAYA 2HJGA 1PG4A 5BSVA 4OXIA 1XNRC 3GR0A 2BH1X 2CU6A 1IB8A 1EGAA 2DYJA 5DV9A 4LF9C 1V60A 1HR0C 1V25A 4JI4C 2KZFA 3H2TA 3J80D 2DHMA 1AMUA 4JYAC 4R1LA 3A9UA 4LE5A 2CY1A 2YCBA 4D57A 3IPLA 2P2BA 3PBKA 3N54B 1IBKC 1L2FA 2P20A 4JI7C 4DV5C 4JI6C 4B3TC 4R0MA 4B3SC 3RG2A 2MCQA 3A25A 4B3MC 2ZZNA 1FUGA 1USPB 4JV5C 4ZJZA 3ETCA 3L95X 2D1QA 5KEIA 4ZLPA 1N32C 5AE3A 1O9TA 4RM2A 4D56A 2UXDC 2HHHC 4LF6C 3K6RA 4DV3C 2YWCA 3EQ6A 2VQFC 1I94C 1V26A 4X65C 1PA4A 4IZ6A 4MH4A 4JI0C 3LUSA 3GPCA 3NYRA 3O2EA 5A1GA 2ZM6C 3PESA 4PROC 2WP0C 4L7IA 1ML8A 2E8CA 5BSUA 2KDNA 4G36A 4DCSA 5AE2A 5AE1A 1O92A 2V7BA 4DV0C 3PROC 4DCVA 4HPVA 1P4EA 3UEBA 2P02A 4NOZA 5IT9D 1PG3A 4DCTA 5K85A 4NDNA 4GXRA 4PHTA 4JI8C 5BSTA 3T1HC 2QVYX 1NY8A 2Y27A 3E7XA 4RLFA 1KKGA 3LGXA 5IFIA 1RY2A 5LCIA 5T8SA 5GTDA 4X64C 2ATWA 5A19A 1XNQC 5CZVA 4U5YD 4RMNA 4X66C 3SO4A 3NPDA 5BUSA 4DV2C 1MDBA 2UUAC 4FTFA 4ODJA 1M6XC 2OPLB 3DHVA 2XR1A 1T5DX 3EERA 2ASBA 3R44A 2Z51A 4NXMC 1GPMA 5KYVA 1YJ7A 3KXWA 3OTOC 5BR8C 5E7QA 4DV4C 4D4GA 1T5HX 3CQ2A 3J81D 3A26A 1MKYA 4LF7C 5K8FA 5KYTA 1UKKA 4FUTA 5IWAC 2D7VA 2D28C 4G1IA 4DV7C 4RM3A 3UX3A 4DR1C 3IEUA 2UUBC 1VLAA 2QW0X 4DV1C 3S82A 3FCEA 3TQIA 4LF4C 5ADZA 1MD9A 3VNSA 4TPSB 3VNQA 1XMQC 4BBYA 5H9UA 5BURA 2MMAB 4AQYC 1UWDA 2E7GA 1WH9A 2E8EA 4DR6C 1TH5A 4K0KC 3TDEA 4DR4C 1K0RA 3AY0A 3A9VA 1WF3A 4PUIA 1N33C 2OBVA 2QL8A 3R9WA 1HNWC 4KTTA 4PZPA 4JI5C 4ISBA 3GR1A 4RVOA 1N2FA 4LFAC 4MTNA 3RV2A 1ZB8A 1IBLC 5T8TA 3I08A 4X62C 2OO4A 2PROA 2D1SA 1JOSA 1ZB9A 1HNXC 4LFBC 2JMPA 4RLQA 2UXCC 2E0GA 1XRAA 3C5EA 3N2QA
chains in the Genus database with same CATH topology
2CXCA 1HH2P 1HNZC 2Y4OA 3ETOA 5A1IA 2VSQA 1XRCA 1XMOC 4G37A 4DR7C 4XX2A 4DCUA 1O90A 4JI1C 5BUQA 4RVNA 3T1YC 2QVZX 3LAXA 4BCAA 3GKUA 1J5EC 3UZ0A 3DLPX 4NXNC 1N34C 4FUQA 4R1MA 3G7SA 2ONFA 2AYAA 2Y4NA 3IMLA 4WS9A 5JRHA 4DG8A 2UU9C 2WD9A 4EATA 3AF6A 2QVXX 2UXBC 1LQLA 2PT7G 1ULTA 3CJEA 4LFCC 2D1RA 4GKKC 1XRBA 4DUYC 1FJGC 4BC9A 2PN2A 1BA3A 4LF8C 1P7LA 2F4VC 1LCIA 4DR2C 1USPA 4K0BA 3NI2A 2UUCC 1MXBA 3FCCA 2D27A 3NYQA 4LF5C 2VZEA 3JAMD 5A2QD 3A4IA 1O93A 2EGTA 5FLXD 4D4IA 4JI3C 2D1TA 4I9GA 4DV6C 4DR3C 4B3RC 5CZXA 3B7WA 5BSWA 4DR5C 4JI2C 3I07A 1MXAA 4OX9C 2YWBA 4GS5A 4OYCA 4BC7A 3VNRA 2P2QA 5BSMA 1RG9A 5LMNC 3UOWA 3CW8X 3AF5A 1QM4A 2P2JA 2DPLA 2E8FA 3E7WA 4L2ZA 4I9FA 3L8CA 4YHHC 1QWIA 2E5LC 1MDFA 2P2FA 4YY3C 2VQEC 4GXQA 4L4QA 4IR7A 3TUFA 2BJOA 3CW9A 5BSRA 4BSZA 2P2MA 4JM1A 1NYEA 3LNVA 5LMUC 4GKJC 1IBMC 4KTVA 3IEVA 1N36C 4DG9A 4DUZC 4KHPC 2OPLA 3R9XA 4WV3A 1MXCA 3DAYA 2HJGA 1PG4A 5BSVA 4OXIA 1XNRC 3GR0A 2BH1X 1EGAA 2DYJA 5DV9A 4LF9C 1HR0C 1V25A 4JI4C 2KZFA 3H2TA 3J80D 1AMUA 4JYAC 4R1LA 3A9UA 4LE5A 2CY1A 2YCBA 4D57A 3IPLA 2P2BA 3PBKA 3N54B 1IBKC 1L2FA 2P20A 4JI7C 4DV5C 4JI6C 4B3TC 4R0MA 4B3SC 3RG2A 4B3MC 1FUGA 1USPB 4JV5C 4ZJZA 3ETCA 3L95X 2D1QA 5KEIA 4ZLPA 1N32C 5AE3A 1O9TA 4RM2A 4D56A 2UXDC 2HHHC 4LF6C 4DV3C 2YWCA 3EQ6A 2VQFC 1I94C 1V26A 4X65C 1PA4A 4IZ6A 4MH4A 4JI0C 3LUSA 3GPCA 3NYRA 5A1GA 2ZM6C 3PESA 4PROC 2WP0C 4L7IA 1ML8A 2E8CA 5BSUA 4G36A 4DCSA 5AE2A 5AE1A 1O92A 2V7BA 4DV0C 3PROC 4DCVA 4HPVA 2P02A 4NOZA 5IT9D 1PG3A 4DCTA 5K85A 4NDNA 4GXRA 4PHTA 4JI8C 5BSTA 3T1HC 2QVYX 2Y27A 3E7XA 4RLFA 1KKGA 3LGXA 5IFIA 1RY2A 5GTDA 5T8SA 4X64C 2ATWA 5A19A 1XNQC 5CZVA 4U5YD 4RMNA 4X66C 3SO4A 3NPDA 5BUSA 4DV2C 1MDBA 2UUAC 4FTFA 4ODJA 2OPLB 3DHVA 2XR1A 1T5DX 3EERA 2ASBA 3R44A 4NXMC 1GPMA 5KYVA 1YJ7A 3KXWA 3OTOC 5BR8C 5E7QA 4DV4C 4D4GA 1T5HX 3J81D 1MKYA 4LF7C 5K8FA 5KYTA 1UKKA 4FUTA 5IWAC 2D7VA 2D28C 4G1IA 4DV7C 4RM3A 4DR1C 3IEUA 2UUBC 1VLAA 2QW0X 4DV1C 3S82A 3FCEA 3TQIA 4LF4C 5ADZA 1MD9A 3VNSA 4TPSB 3VNQA 1XMQC 4BBYA 5H9UA 5BURA 4AQYC 2E7GA 1WH9A 2E8EA 4DR6C 4K0KC 3TDEA 4DR4C 1K0RA 3A9VA 1WF3A 1N33C 2OBVA 2QL8A 3R9WA 1HNWC 4KTTA 4PZPA 4JI5C 4ISBA 3GR1A 4RVOA 1N2FA 4LFAC 4MTNA 3RV2A 1ZB8A 1IBLC 5T8TA 3I08A 4X62C 2OO4A 2PROA 2D1SA 1JOSA 1ZB9A 1HNXC 4LFBC 2JMPA 4RLQA 2UXCC 2E0GA 1XRAA 3C5EA 3N2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L7I A;  3A4I A;  1RG9 A;  5T8S A;  1O93 A;  5T8T A;  3UOW A;  1QM4 A;  2DPL A;  1O92 A;  3TDE A;  1MXA A;  5A19 A;  4L2Z A;  1MXC A;  5A1I A;  1FUG A;  4HPV A;  1P7L A;  2P02 A;  1XRC A;  2YWC A;  2YWB A;  1GPM A;  4K0B A;  3IML A;  4WS9 A;  4NDN A;  2OBV A;  3S82 A;  3TQI A;  3SO4 A;  4LE5 A;  1XRA A;  1MXB A;  4L4Q A;  4KTT A;  1O90 A;  4ODJ A;  5A1G A;  1XRB A;  1O9T A;  5H9U A;  4KTV A;  3RV2 A; 
#chains in the Genus database with same CATH topology
 2CXC A;  1HH2 P;  1HNZ C;  2Y4O A;  3ETO A;  5A1I A;  2VSQ A;  1WCJ A;  1XRC A;  3LNO A;  1XMO C;  4G37 A;  4DR7 C;  2JNV A;  2MM9 A;  4XX2 A;  4DCU A;  1O90 A;  4JI1 C;  5BUQ A;  4RVN A;  3T1Y C;  2QVZ X;  3LAX A;  4BCA A;  3GKU A;  1J5E C;  3UZ0 A;  3DLP X;  4NXN C;  1N34 C;  4FUQ A;  4R1M A;  3G7S A;  2NCL A;  2ONF A;  2AYA A;  2Y4N A;  3IML A;  4WS9 A;  5JRH A;  4DG8 A;  2UU9 C;  2WD9 A;  4EAT A;  3AF6 A;  2QVX X;  2UXB C;  1LQL A;  2PT7 G;  1ULT A;  3CJE A;  4LFC C;  2D1R A;  4GKK C;  1XRB A;  4DUY C;  1FJG C;  4BC9 A;  4PUG A;  2KZ0 A;  2PN2 A;  1BA3 A;  1FLO A;  4LF8 C;  1P7L A;  2F4V C;  1LCI A;  4DR2 C;  1USP A;  4K0B A;  3NI2 A;  2UUC C;  1PU1 A;  1MXB A;  3FCC A;  2D27 A;  3NYQ A;  4LF5 C;  2VZE A;  3CQ3 A;  3JAM D;  1P4E C;  5A2Q D;  3A4I A;  1O93 A;  2EGT A;  5FLX D;  1M6X A;  4D4I A;  3CQ1 A;  4JI3 C;  2D1T A;  3UX2 A;  4I9G A;  1XHJ A;  4DV6 C;  4DR3 C;  4B3R C;  5CZX A;  3B7W A;  5BSW A;  4DR5 C;  4JI2 C;  3I07 A;  1MXA A;  4OX9 C;  2YWB A;  4GS5 A;  4OYC A;  4BC7 A;  3VNR A;  2P2Q A;  5BSM A;  1RG9 A;  5LMN C;  2ZZM A;  3UOW A;  3CW8 X;  3AF5 A;  4PUH A;  1QM4 A;  2P2J A;  2M5H A;  2DPL A;  2E8F A;  3E7W A;  4L2Z A;  2YX1 A;  4I9F A;  1VEH A;  3L8C A;  4YHH C;  1QWI A;  2E5L C;  2M5O A;  1MDF A;  2P2F A;  4YY3 C;  4GXQ A;  4L4Q A;  3TUF A;  4IR7 A;  4BSZ A;  2BJO A;  3CW9 A;  5BSR A;  2VQE C;  2P2M A;  4JM1 A;  1NYE A;  3LNV A;  5LMU C;  4GKJ C;  1IBM C;  4KTV A;  3TR3 A;  3IEV A;  1N36 C;  4DG9 A;  4DUZ C;  1XS3 A;  4KHP C;  2OPL A;  3R9X A;  4WV3 A;  1MXC A;  3DAY A;  2HJG A;  1PG4 A;  5BSV A;  4OXI A;  1XNR C;  3GR0 A;  2BH1 X;  2CU6 A;  1IB8 A;  1EGA A;  2DYJ A;  5DV9 A;  4LF9 C;  1V60 A;  1HR0 C;  1V25 A;  4JI4 C;  2KZF A;  3H2T A;  3J80 D;  2DHM A;  1AMU A;  4JYA C;  4R1L A;  3A9U A;  4LE5 A;  2CY1 A;  2YCB A;  4D57 A;  3IPL A;  2P2B A;  3PBK A;  3N54 B;  1IBK C;  1L2F A;  2P20 A;  4JI7 C;  4DV5 C;  4JI6 C;  4B3T C;  4R0M A;  4B3S C;  3RG2 A;  2MCQ A;  3A25 A;  4B3M C;  2ZZN A;  1FUG A;  1USP B;  4JV5 C;  4ZJZ A;  3ETC A;  3L95 X;  2D1Q A;  5KEI A;  4ZLP A;  1N32 C;  5AE3 A;  1O9T A;  4RM2 A;  4D56 A;  2UXD C;  2HHH C;  4LF6 C;  3K6R A;  4DV3 C;  2YWC A;  3EQ6 A;  2VQF C;  1I94 C;  1V26 A;  4X65 C;  1PA4 A;  4IZ6 A;  4MH4 A;  4JI0 C;  3LUS A;  3GPC A;  3NYR A;  3O2E A;  5A1G A;  2ZM6 C;  3PES A;  4PRO C;  2WP0 C;  4L7I A;  1ML8 A;  2E8C A;  5BSU A;  2KDN A;  4G36 A;  4DCS A;  5AE2 A;  5AE1 A;  1O92 A;  2V7B A;  4DV0 C;  3PRO C;  4DCV A;  4HPV A;  1P4E A;  3UEB A;  2P02 A;  4NOZ A;  5IT9 D;  1PG3 A;  4DCT A;  5K85 A;  4NDN A;  4GXR A;  4PHT A;  4JI8 C;  5BST A;  3T1H C;  2QVY X;  1NY8 A;  2Y27 A;  3E7X A;  4RLF A;  1KKG A;  3LGX A;  5IFI A;  1RY2 A;  5LCI A;  5T8S A;  5GTD A;  4X64 C;  2ATW A;  5A19 A;  1XNQ C;  5CZV A;  4U5Y D;  4RMN A;  4X66 C;  3SO4 A;  3NPD A;  5BUS A;  4DV2 C;  1MDB A;  2UUA C;  4FTF A;  4ODJ A;  1M6X C;  2OPL B;  3DHV A;  2XR1 A;  1T5D X;  3EER A;  2ASB A;  3R44 A;  2Z51 A;  4NXM C;  1GPM A;  5KYV A;  1YJ7 A;  3KXW A;  3OTO C;  5BR8 C;  5E7Q A;  4DV4 C;  4D4G A;  1T5H X;  3CQ2 A;  3J81 D;  3A26 A;  1MKY A;  4LF7 C;  5K8F A;  5KYT A;  1UKK A;  4FUT A;  5IWA C;  2D7V A;  2D28 C;  4G1I A;  4DV7 C;  4RM3 A;  3UX3 A;  4DR1 C;  3IEU A;  2UUB C;  1VLA A;  2QW0 X;  4DV1 C;  3S82 A;  3FCE A;  3TQI A;  4LF4 C;  5ADZ A;  1MD9 A;  3VNS A;  4TPS B;  3VNQ A;  1XMQ C;  4BBY A;  5H9U A;  5BUR A;  2MMA B;  4AQY C;  1UWD A;  2E7G A;  1WH9 A;  2E8E A;  4DR6 C;  1TH5 A;  4K0K C;  3TDE A;  4DR4 C;  1K0R A;  3AY0 A;  3A9V A;  1WF3 A;  4PUI A;  1N33 C;  2OBV A;  2QL8 A;  3R9W A;  1HNW C;  4KTT A;  4PZP A;  4JI5 C;  4ISB A;  3GR1 A;  4RVO A;  1N2F A;  4LFA C;  4MTN A;  3RV2 A;  1ZB8 A;  1IBL C;  5T8T A;  3I08 A;  4X62 C;  2OO4 A;  2PRO A;  2D1S A;  1JOS A;  1ZB9 A;  1HNX C;  4LFB C;  2JMP A;  4RLQ A;  2UXC C;  2E0G A;  1XRA A;  3C5E A;  3N2Q A; 
#chains in the Genus database with same CATH homology
 2CXC A;  1HH2 P;  1HNZ C;  2Y4O A;  3ETO A;  5A1I A;  2VSQ A;  1XRC A;  1XMO C;  4G37 A;  4DR7 C;  4XX2 A;  4DCU A;  1O90 A;  4JI1 C;  5BUQ A;  4RVN A;  3T1Y C;  2QVZ X;  3LAX A;  4BCA A;  3GKU A;  1J5E C;  3UZ0 A;  3DLP X;  4NXN C;  1N34 C;  4FUQ A;  4R1M A;  3G7S A;  2ONF A;  2AYA A;  2Y4N A;  3IML A;  4WS9 A;  5JRH A;  4DG8 A;  2UU9 C;  2WD9 A;  4EAT A;  3AF6 A;  2QVX X;  2UXB C;  1LQL A;  2PT7 G;  1ULT A;  3CJE A;  4LFC C;  2D1R A;  4GKK C;  1XRB A;  4DUY C;  1FJG C;  4BC9 A;  2PN2 A;  1BA3 A;  4LF8 C;  1P7L A;  2F4V C;  1LCI A;  4DR2 C;  1USP A;  4K0B A;  3NI2 A;  2UUC C;  1MXB A;  3FCC A;  2D27 A;  3NYQ A;  4LF5 C;  2VZE A;  3JAM D;  5A2Q D;  3A4I A;  1O93 A;  2EGT A;  5FLX D;  4D4I A;  4JI3 C;  2D1T A;  4I9G A;  4DV6 C;  4DR3 C;  4B3R C;  5CZX A;  3B7W A;  5BSW A;  4DR5 C;  4JI2 C;  3I07 A;  1MXA A;  4OX9 C;  2YWB A;  4GS5 A;  4OYC A;  4BC7 A;  3VNR A;  2P2Q A;  5BSM A;  1RG9 A;  5LMN C;  3UOW A;  3CW8 X;  3AF5 A;  1QM4 A;  2P2J A;  2DPL A;  2E8F A;  3E7W A;  4L2Z A;  4I9F A;  3L8C A;  4YHH C;  1QWI A;  2E5L C;  1MDF A;  2P2F A;  4YY3 C;  2VQE C;  4GXQ A;  4L4Q A;  4IR7 A;  3TUF A;  2BJO A;  3CW9 A;  5BSR A;  4BSZ A;  2P2M A;  4JM1 A;  1NYE A;  3LNV A;  5LMU C;  4GKJ C;  1IBM C;  4KTV A;  3IEV A;  1N36 C;  4DG9 A;  4DUZ C;  4KHP C;  2OPL A;  3R9X A;  4WV3 A;  1MXC A;  3DAY A;  2HJG A;  1PG4 A;  5BSV A;  4OXI A;  1XNR C;  3GR0 A;  2BH1 X;  1EGA A;  2DYJ A;  5DV9 A;  4LF9 C;  1HR0 C;  1V25 A;  4JI4 C;  2KZF A;  3H2T A;  3J80 D;  1AMU A;  4JYA C;  4R1L A;  3A9U A;  4LE5 A;  2CY1 A;  2YCB A;  4D57 A;  3IPL A;  2P2B A;  3PBK A;  3N54 B;  1IBK C;  1L2F A;  2P20 A;  4JI7 C;  4DV5 C;  4JI6 C;  4B3T C;  4R0M A;  4B3S C;  3RG2 A;  4B3M C;  1FUG A;  1USP B;  4JV5 C;  4ZJZ A;  3ETC A;  3L95 X;  2D1Q A;  5KEI A;  4ZLP A;  1N32 C;  5AE3 A;  1O9T A;  4RM2 A;  4D56 A;  2UXD C;  2HHH C;  4LF6 C;  4DV3 C;  2YWC A;  3EQ6 A;  2VQF C;  1I94 C;  1V26 A;  4X65 C;  1PA4 A;  4IZ6 A;  4MH4 A;  4JI0 C;  3LUS A;  3GPC A;  3NYR A;  5A1G A;  2ZM6 C;  3PES A;  4PRO C;  2WP0 C;  4L7I A;  1ML8 A;  2E8C A;  5BSU A;  4G36 A;  4DCS A;  5AE2 A;  5AE1 A;  1O92 A;  2V7B A;  4DV0 C;  3PRO C;  4DCV A;  4HPV A;  2P02 A;  4NOZ A;  5IT9 D;  1PG3 A;  4DCT A;  5K85 A;  4NDN A;  4GXR A;  4PHT A;  4JI8 C;  5BST A;  3T1H C;  2QVY X;  2Y27 A;  3E7X A;  4RLF A;  1KKG A;  3LGX A;  5IFI A;  1RY2 A;  5GTD A;  5T8S A;  4X64 C;  2ATW A;  5A19 A;  1XNQ C;  5CZV A;  4U5Y D;  4RMN A;  4X66 C;  3SO4 A;  3NPD A;  5BUS A;  4DV2 C;  1MDB A;  2UUA C;  4FTF A;  4ODJ A;  2OPL B;  3DHV A;  2XR1 A;  1T5D X;  3EER A;  2ASB A;  3R44 A;  4NXM C;  1GPM A;  5KYV A;  1YJ7 A;  3KXW A;  3OTO C;  5BR8 C;  5E7Q A;  4DV4 C;  4D4G A;  1T5H X;  3J81 D;  1MKY A;  4LF7 C;  5K8F A;  5KYT A;  1UKK A;  4FUT A;  5IWA C;  2D7V A;  2D28 C;  4G1I A;  4DV7 C;  4RM3 A;  4DR1 C;  3IEU A;  2UUB C;  1VLA A;  2QW0 X;  4DV1 C;  3S82 A;  3FCE A;  3TQI A;  4LF4 C;  5ADZ A;  1MD9 A;  3VNS A;  4TPS B;  3VNQ A;  1XMQ C;  4BBY A;  5H9U A;  5BUR A;  4AQY C;  2E7G A;  1WH9 A;  2E8E A;  4DR6 C;  4K0K C;  3TDE A;  4DR4 C;  1K0R A;  3A9V A;  1WF3 A;  1N33 C;  2OBV A;  2QL8 A;  3R9W A;  1HNW C;  4KTT A;  4PZP A;  4JI5 C;  4ISB A;  3GR1 A;  4RVO A;  1N2F A;  4LFA C;  4MTN A;  3RV2 A;  1ZB8 A;  1IBL C;  5T8T A;  3I08 A;  4X62 C;  2OO4 A;  2PRO A;  2D1S A;  1JOS A;  1ZB9 A;  1HNX C;  4LFB C;  2JMP A;  4RLQ A;  2UXC C;  2E0G A;  1XRA A;  3C5E A;  3N2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...