4OYCA

Crystal structure of the prgk periplasmic domain 2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
83
Chain Sequence
HMSSPRAEKARLYSAIEQRLEQSLQTMEGVLSARVHISYVHLSALAVYERGSPLAHQISDIKRFLKNSFADVDYDNISVVLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Lipoprotein PrgK
publication title The Modular Structure of the Inner-Membrane Ring Component PrgK Facilitates Assembly of the Type III Secretion System Basal Body.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 27
structure length 83
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4oycA00
3LNVA 3L8CA 4IR7A 4GXQA 2D1QA 3CW9A 1T5HX 4RLFA 3CW8X 4DG8A 5BSMA 2QVZX 4OYCA 5K8FA 3E7XA 2P2QA 3NI2A 3R44A 4RM3A 5BSRA 3E7WA 3IPLA 5BUSA 2Y27A 1YJ7A 4DG9A 4D4IA 4GXRA 3A9VA 3VNRA 3RG2A 2QVXX 4U5YD 5KEIA 2P2MA 1BA3A 5JRHA 1MDBA 5IFIA 4RMNA 1T5DX 4RVNA 5DV9A 2P2BA 2WD9A 5BSWA 1PG3A 4G37A 4WV3A 3FCCA 2D1SA 2VSQA 2D1RA 5BSTA 4OXIA 3PBKA 1PG4A 1MD9A 4R1MA 5K85A 4D4GA 1LCIA 3C5EA 2V7BA 2P2JA 3KXWA 3DAYA 3VNQA 1ULTA 1MDFA 4R1LA 4D56A 4RVOA 2D1TA 4D57A 4G36A 3A9UA 4RM2A 4GS5A 5E7QA 4FUTA 5KYVA 3VNSA 3GPCA 3LAXA 2Y4OA 4ISBA 5KYTA 5BUQA 3G7SA 2QW0X 4RLQA 4PZPA 2VZEA 4FUQA 5BSUA 4IZ6A 3LGXA 3ETCA 3B7WA 3NYRA 4EATA 5BURA 3NYQA 2Y4NA 3EQ6A 1AMUA 3DLPX 4ZJZA 4R0MA 3FCEA 2P2FA 1RY2A 2P20A 3DHVA 2QVYX 5GTDA 5BSVA
chains in the Genus database with same CATH superfamily
2QL8A 3L8CA 3LNVA 2M5OA 2D1QA 1M6XC 1I94C 4DG8A 1N2FA 4HPVA 5BSMA 2DHMA 4GKJC 4WS9A 3O2EA 2YWBA 1IBMC 1JOSA 1N32C 4PHTA 3AF5A 4LE5A 5H9UA 4I9FA 4DR3C 3J81D 3IEVA 2OO4A 3IEUA 2OPLA 4JI2C 2OBVA 3CQ2A 4DCVA 5A19A 3UX3A 4D4IA 3A9VA 4DV3C 3AY0A 5KEIA 5JRHA 2KZ0A 2CY1A 4RMNA 4DV1C 1WH9A 2YWCA 2P2BA 2WD9A 2D27A 5BSTA 2ONFA 1MXAA 2YCBA 4G1IA 4DV2C 4DCSA 5K85A 2E8EA 4DCTA 3IMLA 2P2JA 3KXWA 1L2FA 1IBKC 3NPDA 4R1LA 4RVOA 2D1TA 2E8CA 3AF6A 2UUAC 4LFAC 3A9UA 4L2ZA 4NXNC 4L4QA 4JI3C 2UXDC 1N34C 1XMOC 1WCJA 4FTFA 5KYTA 5BUQA 1MXBA 2QW0X 4RLQA 4FUQA 5BR8C 2DYJA 3B7WA 2Y4NA 2EGTA 3EQ6A 3I08A 4ZJZA 2XR1A 3FCEA 2P20A 1O93A 3UX2A 5AE1A 2MMAB 3TQIA 5GTDA 1LQLA 4BC7A 4JI5C 1QWIA 1ZB9A 3CW9A 1T5HX 3LNOA 2UXBC 3CW8X 4JV5C 4DR4C 3E7XA 4DR1C 1XNQC 4LF6C 3JAMD 5BSRA 4X64C 4DV4C 2E8FA 1O90A 4DR5C 3T1YC 1FJGC 3IPLA 4DV7C 5BUSA 1QM4A 2D7VA 2Y27A 4BBYA 5T8SA 2YX1A 4ZLPA 1UKKA 3VNRA 4DV0C 1BA3A 4OX9C 1MDBA 1EGAA 4DR7C 1T5DX 4RVNA 4MH4A 4BC9A 1O9TA 1PG3A 4B3SC 2ZZNA 1ML8A 2VSQA 4X65C 2UXCC 3UEBA 3LUSA 4LF9C 5IT9D 3C5EA 1MXCA 2V7BA 3DAYA 3VNQA 2NCLA 2PROA 5CZXA 4G36A 1VEHA 1XNRC 1XRBA 4XX2A 3VNSA 5LMUC 1TH5A 4TPSB 5LCIA 4PZPA 2VZEA 1XRCA 2VQFC 1ZB8A 4IZ6A 4EATA 2WP0C 2JMPA 1AMUA 4DV6C 3J80D 2JNVA 1HNWC 1RG9A 2CXCA 4KTVA 4IR7A 3K6RA 4JM1A 2KDNA 4RLFA 2AYAA 2QVZX 2CU6A 3TDEA 4LF8C 4KHPC 2E0GA 3N2QA 2P2QA 1IBLC 1KKGA 1XRAA 2HHHC 3NI2A 4PROC 2MM9A 1USPB 2PT7G 1HNXC 2D28C 3CQ3A 1XS3A 3A4IA 2ZM6C 1YJ7A 4B3TC 4X62C 3L95X 5FLXD 2P2MA 3I07A 4B3RC 3PROC 3UOWA 5DV9A 3S82A 3FCCA 2P02A 4ODJA 4LF7C 2D1RA 4OXIA 2DPLA 4BSZA 3PBKA 1PG4A 1MD9A 4PUIA 4R1MA 4NDNA 1V26A 3T1HC 4LF4C 4B3MC 4L7IA 1M6XA 3TR3A 4D56A 4K0BA 4D57A 2BH1X 3CQ1A 4JI0C 1VLAA 4RM2A 1IB8A 4I9GA 2OPLB 1MKYA 2UUBC 1V25A 5KYVA 3UZ0A 3LAXA 2ZZMA 4ISBA 2PN2A 1XHJA 4DR6C 2ATWA 2F4VC 3LGXA 5IWAC 3ETCA 5A1GA 5BURA 3NYQA 4YHHC 1HH2P 1K0RA 4BCAA 1O92A 3DLPX 2P2FA 1P7LA 3DHVA 5AE2A 2ASBA 2MCQA 4LF5C 4GKKC 4GXQA 2UUCC 4PUHA 1P4EA 3TUFA 4OYCA 4DR2C 5K8FA 2Z51A 3SO4A 5T8TA 1N33C 3R9XA 1J5EC 3RV2A 3R44A 4RM3A 1XMQC 2HJGA 4DUZC 3E7WA 4PUGA 4JI1C 2UU9C 1WF3A 1P4EC 3GR1A 4DG9A 4GXRA 3RG2A 4JI8C 2QVXX 4U5YD 1FLOA 3H2TA 4AQYC 4YY3C 1PU1A 5IFIA 3GR0A 1GPMA 4JI4C 5LMNC 4K0KC 1UWDA 5BSWA 4LFBC 4G37A 4WV3A 2M5HA 2D1SA 5AE3A 2KZFA 4DUYC 5ADZA 4DV5C 2BJOA 4KTTA 3A25A 4D4GA 2E5LC 1LCIA 3R9WA 1ULTA 1MDFA 4X66C 5A1IA 2E7GA 3EERA 3GKUA 5CZVA 1FUGA 4GS5A 5E7QA 1V60A 3PESA 3CJEA 3OTOC 1N36C 4FUTA 4DCUA 3GPCA 3N54B 2Y4OA 1PA4A 3G7SA 4LFCC 1USPA 3A26A 3ETOA 4MTNA 4JYAC 5BSUA 5A2QD 4NXMC 3NYRA 4JI7C 2VQEC 4JI6C 1NYEA 1HNZC 4R0MA 1NY8A 1RY2A 2QVYX 1HR0C 4NOZA 5BSVA
chains in the Genus database with same CATH topology
2QL8A 3L8CA 3LNVA 2D1QA 1I94C 4DG8A 1N2FA 4HPVA 5BSMA 4GKJC 4WS9A 2YWBA 1IBMC 1JOSA 1N32C 4PHTA 3AF5A 4LE5A 5H9UA 4I9FA 4DR3C 3J81D 3IEVA 2OO4A 3IEUA 2OPLA 4JI2C 2OBVA 4DCVA 5A19A 4D4IA 3A9VA 4DV3C 5KEIA 5JRHA 2CY1A 4RMNA 4DV1C 1WH9A 2YWCA 2P2BA 2WD9A 2D27A 5BSTA 2ONFA 1MXAA 2YCBA 4G1IA 4DV2C 4DCSA 5K85A 2E8EA 4DCTA 3IMLA 2P2JA 3KXWA 1L2FA 1IBKC 3NPDA 4R1LA 4RVOA 2D1TA 2E8CA 3AF6A 2UUAC 4LFAC 3A9UA 4L2ZA 4NXNC 4L4QA 4JI3C 2UXDC 1N34C 1XMOC 4FTFA 5KYTA 1MXBA 5BUQA 2QW0X 4RLQA 4FUQA 5BR8C 2DYJA 3B7WA 2Y4NA 2EGTA 3EQ6A 3I08A 4ZJZA 2XR1A 3FCEA 2P20A 1O93A 5AE1A 3TQIA 5GTDA 1LQLA 4BC7A 4JI5C 1QWIA 1ZB9A 3CW9A 1T5HX 2UXBC 3CW8X 4JV5C 4DR4C 3E7XA 4DR1C 1XNQC 4LF6C 3JAMD 5BSRA 4X64C 4DV4C 2E8FA 1O90A 4DR5C 3T1YC 1FJGC 3IPLA 4DV7C 5BUSA 1QM4A 2D7VA 2Y27A 4BBYA 5T8SA 4ZLPA 1UKKA 3VNRA 4DV0C 1BA3A 4OX9C 1MDBA 1EGAA 4DR7C 1T5DX 4RVNA 4MH4A 4BC9A 1O9TA 1PG3A 4B3SC 1ML8A 2VSQA 4X65C 2UXCC 3LUSA 4LF9C 5IT9D 3C5EA 1MXCA 2V7BA 3DAYA 3VNQA 2PROA 5CZXA 4G36A 1XNRC 1XRBA 4XX2A 3VNSA 5LMUC 4TPSB 4PZPA 2VZEA 1XRCA 2VQFC 1ZB8A 4IZ6A 4EATA 2WP0C 2JMPA 1AMUA 4DV6C 3J80D 1HNWC 1RG9A 2CXCA 4KTVA 4IR7A 4JM1A 4RLFA 2AYAA 2QVZX 3TDEA 4LF8C 4KHPC 2E0GA 3N2QA 2P2QA 1IBLC 1KKGA 1XRAA 2HHHC 3NI2A 4PROC 1USPB 2PT7G 1HNXC 2D28C 3A4IA 2ZM6C 1YJ7A 4B3TC 4X62C 3L95X 5FLXD 2P2MA 3I07A 4B3RC 3PROC 3UOWA 5DV9A 3S82A 3FCCA 2P02A 4ODJA 4LF7C 2D1RA 4OXIA 2DPLA 4BSZA 3PBKA 1PG4A 1MD9A 4R1MA 4NDNA 1V26A 3T1HC 4LF4C 4B3MC 4L7IA 4D56A 4K0BA 4D57A 2BH1X 4JI0C 1VLAA 4RM2A 4I9GA 2OPLB 1MKYA 2UUBC 1V25A 5KYVA 3UZ0A 3LAXA 4ISBA 2PN2A 4DR6C 2ATWA 2F4VC 3LGXA 5IWAC 3ETCA 5A1GA 5BURA 3NYQA 4YHHC 1HH2P 1K0RA 4BCAA 1O92A 3DLPX 2P2FA 1P7LA 3DHVA 5AE2A 2ASBA 4LF5C 4GKKC 4GXQA 2UUCC 3TUFA 4OYCA 4DR2C 5K8FA 3SO4A 5T8TA 1N33C 3R9XA 1J5EC 3RV2A 3R44A 4RM3A 1XMQC 2HJGA 4DUZC 3E7WA 4JI1C 2UU9C 1WF3A 3GR1A 4DG9A 4GXRA 3RG2A 4JI8C 2QVXX 4U5YD 3H2TA 4AQYC 4YY3C 5IFIA 3GR0A 1GPMA 4JI4C 5LMNC 4K0KC 5BSWA 4LFBC 4G37A 4WV3A 2D1SA 5AE3A 2KZFA 4DUYC 5ADZA 4DV5C 2BJOA 4KTTA 4D4GA 2E5LC 1LCIA 3R9WA 1ULTA 1MDFA 4X66C 5A1IA 2E7GA 3EERA 3GKUA 5CZVA 1FUGA 4GS5A 5E7QA 3PESA 3CJEA 3OTOC 1N36C 4FUTA 4DCUA 3GPCA 3N54B 2Y4OA 1PA4A 3G7SA 4LFCC 1USPA 3ETOA 4MTNA 4JYAC 5BSUA 5A2QD 4NXMC 3NYRA 4JI7C 2VQEC 4JI6C 1NYEA 1HNZC 4R0MA 1RY2A 2QVYX 1HR0C 4NOZA 5BSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNV A;  3L8C A;  4IR7 A;  4GXQ A;  2D1Q A;  3CW9 A;  1T5H X;  4RLF A;  3CW8 X;  4DG8 A;  5BSM A;  2QVZ X;  4OYC A;  5K8F A;  3E7X A;  2P2Q A;  3NI2 A;  3R44 A;  4RM3 A;  5BSR A;  3E7W A;  3IPL A;  5BUS A;  2Y27 A;  1YJ7 A;  4DG9 A;  4D4I A;  4GXR A;  3A9V A;  3VNR A;  3RG2 A;  2QVX X;  4U5Y D;  5KEI A;  2P2M A;  1BA3 A;  5JRH A;  1MDB A;  5IFI A;  4RMN A;  1T5D X;  4RVN A;  5DV9 A;  2P2B A;  2WD9 A;  5BSW A;  1PG3 A;  4G37 A;  4WV3 A;  3FCC A;  2D1S A;  2VSQ A;  2D1R A;  5BST A;  4OXI A;  3PBK A;  1PG4 A;  1MD9 A;  4R1M A;  5K85 A;  4D4G A;  1LCI A;  3C5E A;  2V7B A;  2P2J A;  3KXW A;  3DAY A;  3VNQ A;  1ULT A;  1MDF A;  4R1L A;  4D56 A;  4RVO A;  2D1T A;  4D57 A;  4G36 A;  3A9U A;  4RM2 A;  4GS5 A;  5E7Q A;  4FUT A;  5KYV A;  3VNS A;  3GPC A;  3LAX A;  2Y4O A;  4ISB A;  5KYT A;  5BUQ A;  3G7S A;  2QW0 X;  4RLQ A;  4PZP A;  2VZE A;  4FUQ A;  5BSU A;  4IZ6 A;  3LGX A;  3ETC A;  3B7W A;  3NYR A;  4EAT A;  5BUR A;  3NYQ A;  2Y4N A;  3EQ6 A;  1AMU A;  3DLP X;  4ZJZ A;  4R0M A;  3FCE A;  2P2F A;  1RY2 A;  2P20 A;  3DHV A;  2QVY X;  5GTD A;  5BSV A; 
#chains in the Genus database with same CATH topology
 2QL8 A;  3L8C A;  3LNV A;  2M5O A;  2D1Q A;  1M6X C;  1I94 C;  4DG8 A;  1N2F A;  4HPV A;  5BSM A;  2DHM A;  4GKJ C;  4WS9 A;  3O2E A;  2YWB A;  1IBM C;  1JOS A;  1N32 C;  4PHT A;  3AF5 A;  4LE5 A;  5H9U A;  4I9F A;  4DR3 C;  3J81 D;  3IEV A;  2OO4 A;  3IEU A;  2OPL A;  4JI2 C;  2OBV A;  3CQ2 A;  4DCV A;  5A19 A;  3UX3 A;  4D4I A;  3A9V A;  4DV3 C;  3AY0 A;  5KEI A;  5JRH A;  2KZ0 A;  2CY1 A;  4RMN A;  4DV1 C;  1WH9 A;  2YWC A;  2P2B A;  2WD9 A;  2D27 A;  5BST A;  2ONF A;  1MXA A;  2YCB A;  4G1I A;  4DV2 C;  4DCS A;  5K85 A;  2E8E A;  4DCT A;  3IML A;  2P2J A;  3KXW A;  1L2F A;  1IBK C;  3NPD A;  4R1L A;  4RVO A;  2D1T A;  2E8C A;  3AF6 A;  2UUA C;  4LFA C;  3A9U A;  4L2Z A;  4NXN C;  4L4Q A;  4JI3 C;  2UXD C;  1N34 C;  1XMO C;  1WCJ A;  4FTF A;  5KYT A;  5BUQ A;  1MXB A;  2QW0 X;  4RLQ A;  4FUQ A;  5BR8 C;  2DYJ A;  3B7W A;  2Y4N A;  2EGT A;  3EQ6 A;  3I08 A;  4ZJZ A;  2XR1 A;  3FCE A;  2P20 A;  1O93 A;  3UX2 A;  5AE1 A;  2MMA B;  3TQI A;  5GTD A;  1LQL A;  4BC7 A;  4JI5 C;  1QWI A;  1ZB9 A;  3CW9 A;  1T5H X;  3LNO A;  2UXB C;  3CW8 X;  4JV5 C;  4DR4 C;  3E7X A;  4DR1 C;  1XNQ C;  4LF6 C;  3JAM D;  5BSR A;  4X64 C;  4DV4 C;  2E8F A;  1O90 A;  4DR5 C;  3T1Y C;  1FJG C;  3IPL A;  4DV7 C;  5BUS A;  1QM4 A;  2D7V A;  2Y27 A;  4BBY A;  5T8S A;  2YX1 A;  4ZLP A;  1UKK A;  3VNR A;  4DV0 C;  1BA3 A;  4OX9 C;  1MDB A;  1EGA A;  4DR7 C;  1T5D X;  4RVN A;  4MH4 A;  4BC9 A;  1O9T A;  1PG3 A;  4B3S C;  2ZZN A;  1ML8 A;  2VSQ A;  4X65 C;  2UXC C;  3UEB A;  3LUS A;  4LF9 C;  5IT9 D;  3C5E A;  1MXC A;  2V7B A;  3DAY A;  3VNQ A;  2NCL A;  2PRO A;  5CZX A;  4G36 A;  1VEH A;  1XNR C;  1XRB A;  4XX2 A;  3VNS A;  5LMU C;  1TH5 A;  4TPS B;  5LCI A;  4PZP A;  2VZE A;  1XRC A;  2VQF C;  1ZB8 A;  4IZ6 A;  4EAT A;  2WP0 C;  2JMP A;  1AMU A;  4DV6 C;  3J80 D;  2JNV A;  1HNW C;  1RG9 A;  2CXC A;  4KTV A;  4IR7 A;  3K6R A;  4JM1 A;  2KDN A;  4RLF A;  2AYA A;  2QVZ X;  2CU6 A;  3TDE A;  4LF8 C;  4KHP C;  2E0G A;  3N2Q A;  2P2Q A;  1IBL C;  1KKG A;  1XRA A;  2HHH C;  3NI2 A;  4PRO C;  2MM9 A;  1USP B;  2PT7 G;  1HNX C;  2D28 C;  3CQ3 A;  1XS3 A;  3A4I A;  2ZM6 C;  1YJ7 A;  4B3T C;  4X62 C;  3L95 X;  5FLX D;  2P2M A;  3I07 A;  4B3R C;  3PRO C;  3UOW A;  5DV9 A;  3S82 A;  3FCC A;  2P02 A;  4ODJ A;  4LF7 C;  2D1R A;  4OXI A;  2DPL A;  4BSZ A;  3PBK A;  1PG4 A;  1MD9 A;  4PUI A;  4R1M A;  4NDN A;  1V26 A;  3T1H C;  4LF4 C;  4B3M C;  4L7I A;  1M6X A;  3TR3 A;  4D56 A;  4K0B A;  4D57 A;  2BH1 X;  3CQ1 A;  4JI0 C;  1VLA A;  4RM2 A;  1IB8 A;  4I9G A;  2OPL B;  1MKY A;  2UUB C;  1V25 A;  5KYV A;  3UZ0 A;  3LAX A;  2ZZM A;  4ISB A;  2PN2 A;  1XHJ A;  4DR6 C;  2ATW A;  2F4V C;  3LGX A;  5IWA C;  3ETC A;  5A1G A;  5BUR A;  3NYQ A;  4YHH C;  1HH2 P;  1K0R A;  4BCA A;  1O92 A;  3DLP X;  2P2F A;  1P7L A;  3DHV A;  5AE2 A;  2ASB A;  2MCQ A;  4LF5 C;  4GKK C;  4GXQ A;  2UUC C;  4PUH A;  1P4E A;  3TUF A;  4OYC A;  4DR2 C;  5K8F A;  2Z51 A;  3SO4 A;  5T8T A;  1N33 C;  3R9X A;  1J5E C;  3RV2 A;  3R44 A;  4RM3 A;  1XMQ C;  2HJG A;  4DUZ C;  3E7W A;  4PUG A;  4JI1 C;  2UU9 C;  1WF3 A;  1P4E C;  3GR1 A;  4DG9 A;  4GXR A;  3RG2 A;  4JI8 C;  2QVX X;  4U5Y D;  1FLO A;  3H2T A;  4AQY C;  4YY3 C;  1PU1 A;  5IFI A;  3GR0 A;  1GPM A;  4JI4 C;  5LMN C;  4K0K C;  1UWD A;  5BSW A;  4LFB C;  4G37 A;  4WV3 A;  2M5H A;  2D1S A;  5AE3 A;  2KZF A;  4DUY C;  5ADZ A;  4DV5 C;  2BJO A;  4KTT A;  3A25 A;  4D4G A;  2E5L C;  1LCI A;  3R9W A;  1ULT A;  1MDF A;  4X66 C;  5A1I A;  2E7G A;  3EER A;  3GKU A;  5CZV A;  1FUG A;  4GS5 A;  5E7Q A;  1V60 A;  3PES A;  3CJE A;  3OTO C;  1N36 C;  4FUT A;  4DCU A;  3GPC A;  3N54 B;  2Y4O A;  1PA4 A;  3G7S A;  4LFC C;  1USP A;  3A26 A;  3ETO A;  4MTN A;  4JYA C;  5BSU A;  5A2Q D;  4NXM C;  3NYR A;  4JI7 C;  2VQE C;  4JI6 C;  1NYE A;  1HNZ C;  4R0M A;  1NY8 A;  1RY2 A;  2QVY X;  1HR0 C;  4NOZ A;  5BSV A; 
#chains in the Genus database with same CATH homology
 2QL8 A;  3L8C A;  3LNV A;  2D1Q A;  1I94 C;  4DG8 A;  1N2F A;  4HPV A;  5BSM A;  4GKJ C;  4WS9 A;  2YWB A;  1IBM C;  1JOS A;  1N32 C;  4PHT A;  3AF5 A;  4LE5 A;  5H9U A;  4I9F A;  4DR3 C;  3J81 D;  3IEV A;  2OO4 A;  3IEU A;  2OPL A;  4JI2 C;  2OBV A;  4DCV A;  5A19 A;  4D4I A;  3A9V A;  4DV3 C;  5KEI A;  5JRH A;  2CY1 A;  4RMN A;  4DV1 C;  1WH9 A;  2YWC A;  2P2B A;  2WD9 A;  2D27 A;  5BST A;  2ONF A;  1MXA A;  2YCB A;  4G1I A;  4DV2 C;  4DCS A;  5K85 A;  2E8E A;  4DCT A;  3IML A;  2P2J A;  3KXW A;  1L2F A;  1IBK C;  3NPD A;  4R1L A;  4RVO A;  2D1T A;  2E8C A;  3AF6 A;  2UUA C;  4LFA C;  3A9U A;  4L2Z A;  4NXN C;  4L4Q A;  4JI3 C;  2UXD C;  1N34 C;  1XMO C;  4FTF A;  5KYT A;  1MXB A;  5BUQ A;  2QW0 X;  4RLQ A;  4FUQ A;  5BR8 C;  2DYJ A;  3B7W A;  2Y4N A;  2EGT A;  3EQ6 A;  3I08 A;  4ZJZ A;  2XR1 A;  3FCE A;  2P20 A;  1O93 A;  5AE1 A;  3TQI A;  5GTD A;  1LQL A;  4BC7 A;  4JI5 C;  1QWI A;  1ZB9 A;  3CW9 A;  1T5H X;  2UXB C;  3CW8 X;  4JV5 C;  4DR4 C;  3E7X A;  4DR1 C;  1XNQ C;  4LF6 C;  3JAM D;  5BSR A;  4X64 C;  4DV4 C;  2E8F A;  1O90 A;  4DR5 C;  3T1Y C;  1FJG C;  3IPL A;  4DV7 C;  5BUS A;  1QM4 A;  2D7V A;  2Y27 A;  4BBY A;  5T8S A;  4ZLP A;  1UKK A;  3VNR A;  4DV0 C;  1BA3 A;  4OX9 C;  1MDB A;  1EGA A;  4DR7 C;  1T5D X;  4RVN A;  4MH4 A;  4BC9 A;  1O9T A;  1PG3 A;  4B3S C;  1ML8 A;  2VSQ A;  4X65 C;  2UXC C;  3LUS A;  4LF9 C;  5IT9 D;  3C5E A;  1MXC A;  2V7B A;  3DAY A;  3VNQ A;  2PRO A;  5CZX A;  4G36 A;  1XNR C;  1XRB A;  4XX2 A;  3VNS A;  5LMU C;  4TPS B;  4PZP A;  2VZE A;  1XRC A;  2VQF C;  1ZB8 A;  4IZ6 A;  4EAT A;  2WP0 C;  2JMP A;  1AMU A;  4DV6 C;  3J80 D;  1HNW C;  1RG9 A;  2CXC A;  4KTV A;  4IR7 A;  4JM1 A;  4RLF A;  2AYA A;  2QVZ X;  3TDE A;  4LF8 C;  4KHP C;  2E0G A;  3N2Q A;  2P2Q A;  1IBL C;  1KKG A;  1XRA A;  2HHH C;  3NI2 A;  4PRO C;  1USP B;  2PT7 G;  1HNX C;  2D28 C;  3A4I A;  2ZM6 C;  1YJ7 A;  4B3T C;  4X62 C;  3L95 X;  5FLX D;  2P2M A;  3I07 A;  4B3R C;  3PRO C;  3UOW A;  5DV9 A;  3S82 A;  3FCC A;  2P02 A;  4ODJ A;  4LF7 C;  2D1R A;  4OXI A;  2DPL A;  4BSZ A;  3PBK A;  1PG4 A;  1MD9 A;  4R1M A;  4NDN A;  1V26 A;  3T1H C;  4LF4 C;  4B3M C;  4L7I A;  4D56 A;  4K0B A;  4D57 A;  2BH1 X;  4JI0 C;  1VLA A;  4RM2 A;  4I9G A;  2OPL B;  1MKY A;  2UUB C;  1V25 A;  5KYV A;  3UZ0 A;  3LAX A;  4ISB A;  2PN2 A;  4DR6 C;  2ATW A;  2F4V C;  3LGX A;  5IWA C;  3ETC A;  5A1G A;  5BUR A;  3NYQ A;  4YHH C;  1HH2 P;  1K0R A;  4BCA A;  1O92 A;  3DLP X;  2P2F A;  1P7L A;  3DHV A;  5AE2 A;  2ASB A;  4LF5 C;  4GKK C;  4GXQ A;  2UUC C;  3TUF A;  4OYC A;  4DR2 C;  5K8F A;  3SO4 A;  5T8T A;  1N33 C;  3R9X A;  1J5E C;  3RV2 A;  3R44 A;  4RM3 A;  1XMQ C;  2HJG A;  4DUZ C;  3E7W A;  4JI1 C;  2UU9 C;  1WF3 A;  3GR1 A;  4DG9 A;  4GXR A;  3RG2 A;  4JI8 C;  2QVX X;  4U5Y D;  3H2T A;  4AQY C;  4YY3 C;  5IFI A;  3GR0 A;  1GPM A;  4JI4 C;  5LMN C;  4K0K C;  5BSW A;  4LFB C;  4G37 A;  4WV3 A;  2D1S A;  5AE3 A;  2KZF A;  4DUY C;  5ADZ A;  4DV5 C;  2BJO A;  4KTT A;  4D4G A;  2E5L C;  1LCI A;  3R9W A;  1ULT A;  1MDF A;  4X66 C;  5A1I A;  2E7G A;  3EER A;  3GKU A;  5CZV A;  1FUG A;  4GS5 A;  5E7Q A;  3PES A;  3CJE A;  3OTO C;  1N36 C;  4FUT A;  4DCU A;  3GPC A;  3N54 B;  2Y4O A;  1PA4 A;  3G7S A;  4LFC C;  1USP A;  3ETO A;  4MTN A;  4JYA C;  5BSU A;  5A2Q D;  4NXM C;  3NYR A;  4JI7 C;  2VQE C;  4JI6 C;  1NYE A;  1HNZ C;  4R0M A;  1RY2 A;  2QVY X;  1HR0 C;  4NOZ A;  5BSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...